Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.4657057026230.0
CAGL0J02904g5435317671e-94
YER054C (GIP2)5481896327e-75
Scas_704.415821805114e-57
Sklu_2260.63991924373e-48
YIL045W (PIG2)5381804341e-46
CAGL0L00803g8271844211e-43
Kwal_23.57644622023739e-39
ADL083C3541663591e-37
KLLA0F27533g4981012315e-20
YOR178C (GAC1)7931301452e-09
YLR273C (PIG1)6481191202e-06
CAGL0H04037g915881015e-04
KLLA0D09240g748163880.017
AGR275C67994830.058
Kwal_56.2326242961770.25
CAGL0F04917g68278760.42
Scas_521.1579102750.45
Scas_659.21594102730.89
CAGL0H02189g19784701.3
CAGL0M10109g46393711.4
Kwal_27.12639156882711.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.46
         (570 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.46                                                          1014   0.0  
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...   300   1e-94
YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...   248   7e-75
Scas_704.41                                                           201   4e-57
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement       172   3e-48
YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...   171   1e-46
CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...   166   1e-43
Kwal_23.5764                                                          148   9e-39
ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...   142   1e-37
KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...    94   5e-20
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    60   2e-09
YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein t...    51   2e-06
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    44   5e-04
KLLA0D09240g complement(775848..778094) some similarities with s...    39   0.017
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    37   0.058
Kwal_56.23262                                                          34   0.25 
CAGL0F04917g complement(499132..501180) weakly similar to sp|P28...    34   0.42 
Scas_521.1                                                             33   0.45 
Scas_659.21                                                            33   0.89 
CAGL0H02189g complement(199107..199700) weakly similar to sp|Q03...    32   1.3  
CAGL0M10109g 1006975..1008366 similar to sp|P36075 Saccharomyces...    32   1.4  
Kwal_27.12639                                                          32   1.6  

>Scas_715.46
          Length = 570

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/570 (87%), Positives = 500/570 (87%)

Query: 1   MYIKAENRKNVLPPPIETKAEKDKRGSDTHHGHNSKSHIIDEVIENKDEHEDFSHDANAE 60
           MYIKAENRKNVLPPPIETKAEKDKRGSDTHHGHNSKSHIIDEVIENKDEHEDFSHDANAE
Sbjct: 1   MYIKAENRKNVLPPPIETKAEKDKRGSDTHHGHNSKSHIIDEVIENKDEHEDFSHDANAE 60

Query: 61  CSSPTFEEFTHMTNKIGGERKTSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNK 120
           CSSPTFEEFTHMTNKIGGERKTSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNK
Sbjct: 61  CSSPTFEEFTHMTNKIGGERKTSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNK 120

Query: 121 NIRLVTSGSVAKDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITP 180
           NIRLVTSGSVAKDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITP
Sbjct: 121 NIRLVTSGSVAKDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITP 180

Query: 181 LSPIYXXXXXXXXXXXXXXXXXXXXXXEILQKSLRFENDAMEMVRSKSVHFDQKAPVKYF 240
           LSPIY                      EILQKSLRFENDAMEMVRSKSVHFDQKAPVKYF
Sbjct: 181 LSPIYKKSGELLKSSLKRRSKSLPSTSEILQKSLRFENDAMEMVRSKSVHFDQKAPVKYF 240

Query: 241 REDESPSTVNMMAEFDNLLNLMHKPVNRVFEYGDKELAALGLDKVGDTAVNKGAETKLRK 300
           REDESPSTVNMMAEFDNLLNLMHKPVNRVFEYGDKELAALGLDKVGDTAVNKGAETKLRK
Sbjct: 241 REDESPSTVNMMAEFDNLLNLMHKPVNRVFEYGDKELAALGLDKVGDTAVNKGAETKLRK 300

Query: 301 SKRFQNVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSENEIRRVSDAIADNLX 360
           SKRFQNVI                                   SENEIRRVSDAIADNL 
Sbjct: 301 SKRFQNVIKDKKKDNDANGNANGNDNDNINDRENNKKKIKNEDSENEIRRVSDAIADNLK 360

Query: 361 XXXXXXXXXXXXPYSNSKRMNVITHTKVVGLYNINFPILSNKNPKSLKLNIFIKLSKDKK 420
                       PYSNSKRMNVITHTKVVGLYNINFPILSNKNPKSLKLNIFIKLSKDKK
Sbjct: 361 INTKKNNKIVTNPYSNSKRMNVITHTKVVGLYNINFPILSNKNPKSLKLNIFIKLSKDKK 420

Query: 421 CFLQEVTLHIEKENPLKRLLPANGSNSEFGQGSIIQRSTRLITGKILVKNIFYDKRVIVR 480
           CFLQEVTLHIEKENPLKRLLPANGSNSEFGQGSIIQRSTRLITGKILVKNIFYDKRVIVR
Sbjct: 421 CFLQEVTLHIEKENPLKRLLPANGSNSEFGQGSIIQRSTRLITGKILVKNIFYDKRVIVR 480

Query: 481 YTWNDWRTVHDVECIWVSDGDGIVPGTNMDVFRFLIDDANKLEARAKLEFCIQYTARNDT 540
           YTWNDWRTVHDVECIWVSDGDGIVPGTNMDVFRFLIDDANKLEARAKLEFCIQYTARNDT
Sbjct: 481 YTWNDWRTVHDVECIWVSDGDGIVPGTNMDVFRFLIDDANKLEARAKLEFCIQYTARNDT 540

Query: 541 ERLEYWDNNDGKNYKVGVIMNGFTNPFALN 570
           ERLEYWDNNDGKNYKVGVIMNGFTNPFALN
Sbjct: 541 ERLEYWDNNDGKNYKVGVIMNGFTNPFALN 570

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score =  300 bits (767), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 197/531 (37%), Positives = 265/531 (49%), Gaps = 63/531 (11%)

Query: 76  IGGERKTSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTS-------- 127
           +GG  K     L S+ FL+KPQRV+Q+N D+FPEEE+ RNT LNKN+  V S        
Sbjct: 34  VGGSGK-----LTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQG 88

Query: 128 -GSVAKDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSPIYX 186
            G     E +  R+     DL  +SP+ST+   +    + T +  D   + + P SP   
Sbjct: 89  PGDGGASERQQARD-----DLIPLSPKSTLPELDTNMLDNTLDS-DNSSNDLAPFSPPVY 142

Query: 187 XXXXXXXXXXXXXXXXXXXXXEILQKSLRFENDAMEMVRSKSVHFDQKAPVKYFREDESP 246
                                  L  S+   +   +++RSKSVHFDQ APV+YF E+E P
Sbjct: 143 KKSGEPVKSVLKRRSKSLPGTPGLNTSMHGASPPNKLMRSKSVHFDQTAPVRYFNENERP 202

Query: 247 ---STVNMMAEFDNLLNLM----HKPVNRV---------FEYGDK--------ELAALGL 282
              S  ++  ++   LN       +   R              DK        EL +  +
Sbjct: 203 IDVSNADIYQQYGAYLNEYGIEDRRKAGRAGGLSAMMQEMSLDDKTKERLRALELESKRV 262

Query: 283 DKVGDTAVNKG----AETKLRKSKRFQNVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 338
           D+  D+ +  G    A  KLRKSKRF  +                               
Sbjct: 263 DEGYDSTIAAGGQGNAGPKLRKSKRFHAIKKKDKDNENNKENVSNPNSTPSSANSSSTSL 322

Query: 339 XXXXXSENEIRRVSDAIADNLXXXXXXXXXXXXXPYSNSKRMNVITHTKVVGLYNINFPI 398
                + N+          +               YS  ++  V+      GLYN NFPI
Sbjct: 323 RDMGTAANQGNTPYSNYRTDSGASVSNGGSMFNGSYSGKQQQRVV------GLYNENFPI 376

Query: 399 LSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNSEFGQGSIIQRS 458
           LSNKNPKSLKLNIFI LS+ K+ FLQE++LHI +E    R   + GS  + G       +
Sbjct: 377 LSNKNPKSLKLNIFINLSQGKEVFLQELSLHIHRE----RAFYSPGSGVDIG----TPIN 428

Query: 459 TRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVP-GTNMDVFRFLID 517
           TRL++G++LVKNIF+DKRV++RYTW+ WR V DVE +WVS   G+VP G  MDVF F+ID
Sbjct: 429 TRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVID 488

Query: 518 DANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNYKVGVIMNGFTNPFA 568
           DA K E +A LEFCIQYT R+DT+RLE+WDNN GKNY V ++M+GF NPFA
Sbjct: 489 DATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVDLVMDGFRNPFA 539

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score =  248 bits (632), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 115/189 (60%), Positives = 144/189 (76%), Gaps = 8/189 (4%)

Query: 388 VVGLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPA----- 442
           VVGLY+ NFPILSNKNPKSLKLNIFI LS++KK FLQE++L+I ++N       +     
Sbjct: 357 VVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDNNYFSNSSSFYNIP 416

Query: 443 ---NGSNSEFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSD 499
              NG++            TRLI G+ILVKNIFYDKRV+VRYTW+ WRT H+VEC+++SD
Sbjct: 417 NSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISD 476

Query: 500 GDGIVPGTNMDVFRFLIDDANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNYKVGVI 559
           GDGI+PGTNMD+F F+IDD +K++ R KLEFCI Y+ RND ER EYWDNN+G NYKV V+
Sbjct: 477 GDGILPGTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVV 536

Query: 560 MNGFTNPFA 568
           M+GF +PFA
Sbjct: 537 MDGFNDPFA 545

 Score =  124 bits (310), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 134/271 (49%), Gaps = 50/271 (18%)

Query: 86  SLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTSGSVAKDEEETGREYMSP- 144
           +LNS+ FL+KPQRVTQM  ++FPEEEV+RNTDLNK  R+ ++G+    + E+G   ++  
Sbjct: 55  TLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNK--RIFSAGNDENVDNESGWSKIAAA 112

Query: 145 ------------------IDLPEISPRSTIQSS---EFIQNNKTQEGVDERYDG--ITPL 181
                             I+LP +SP+ST+  S   E+ +       ++  YD   + P 
Sbjct: 113 KNHTSVESLNGSTRPPFKIELPPLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDEEILIPF 172

Query: 182 S-PIYXXXXXXXXXXXXXXXXXXXXXXEILQKSLRFENDAMEM-VRSKSVHFDQKAPVKY 239
           + P+Y                       I   +     D   M +RSKSVHFDQ APVKY
Sbjct: 173 APPVYKKSGELLKSSLKRRSKSLPTTPGIRSGNGVQARDGSPMLIRSKSVHFDQAAPVKY 232

Query: 240 FREDESPSTVNMMAEFDNLLNLMHKPVNRVFEYGDK-ELAALGLD--------------- 283
           F EDESP  VN   + DN L+  HKPVN + +  ++ ++ + GL+               
Sbjct: 233 FAEDESPINVNKTEQHDNCLSFKHKPVNLMVDPEEETKMLSSGLETTSIDDDLTTVAPKG 292

Query: 284 -----KVGDTAVNKGA-ETKLRKSKRFQNVI 308
                K+ +    KG   TKLRKSKRFQN++
Sbjct: 293 FAHPAKISNPNNGKGTNNTKLRKSKRFQNLL 323

>Scas_704.41
          Length = 582

 Score =  201 bits (511), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 93/180 (51%), Positives = 127/180 (70%), Gaps = 13/180 (7%)

Query: 388 VVGLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNS 447
           V+GLY+ NFP L+NKNP+SLKLNIF+  SK KK FLQ++ LHI+ +            N+
Sbjct: 411 VIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQND----------YINN 460

Query: 448 EFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGT 507
             G  +   +  + I G+ LV+NI++DK+V+++YTW++WR+  D+E I+VSD   I+PG+
Sbjct: 461 HVGNNN---KQNKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGS 517

Query: 508 NMDVFRFLIDDANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNYKVGVIMNGFTNPF 567
           NMDVF+FLIDD NK  ++  LEFCIQY  RN+ ER E+WDNND KNYKV V+   F NPF
Sbjct: 518 NMDVFKFLIDDVNKSVSKCHLEFCIQYQTRNEKERKEFWDNNDDKNYKVDVVTEVFRNPF 577

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 91/210 (43%), Gaps = 35/210 (16%)

Query: 82  TSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTS-------------- 127
           +S    +S++FL +P+++ Q+ ++  P+EE++RNT+LNKNI  + +              
Sbjct: 92  SSTKPFSSLNFLQEPRKLDQLKLNALPQEELRRNTNLNKNINPIPTPIKPTIYKNSYYLN 151

Query: 128 --GSVAKDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSPIY 185
              + A  EE+   + +SPI   ++   + I     + NN   E        +  + P+Y
Sbjct: 152 DNDTDAFKEEQENEDEISPIT--QVPANAKIPFP--VPNNAYME--------VNRIKPVY 199

Query: 186 XXXXXXXXXXXXXXXXXXXXXXEILQKSLRFEND-------AMEMVRSKSVHFDQKAPVK 238
                                  I   +LR  N        A  + RSKSVHF    PV+
Sbjct: 200 KKSGELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHFANTLPVR 259

Query: 239 YFREDESPSTVNMMAEFDNLLNLMHKPVNR 268
           +F +DESP  V    E  N LN  HKP+ R
Sbjct: 260 FFSKDESPIIVAESHEITNELNFKHKPLQR 289

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score =  172 bits (437), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 87/192 (45%), Positives = 117/192 (60%), Gaps = 41/192 (21%)

Query: 388 VVGLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNS 447
           V GLYN NFPILSNKNP SLKLNIF+ ++  K+ FLQ+++L                   
Sbjct: 228 VPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSL------------------- 268

Query: 448 EFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGT 507
             G G+        + GK+LVKNI YDK+VIVRYTW+ W T HDV+C+W S GD ++PG 
Sbjct: 269 -LGDGN-------YVVGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGM 320

Query: 508 NMDVFRFLID-------------DANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNY 554
           NMD+F+F++D             D +K E   +++FCI+YT R+   R E+WDNN+GKNY
Sbjct: 321 NMDMFKFVVDVPVDSAEATLATTDPDK-EGGREVQFCIRYTTRDGNYREEHWDNNNGKNY 379

Query: 555 KVGVIMNGFTNP 566
            V V++   T P
Sbjct: 380 IVAVVIGDDTRP 391

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 56/181 (30%), Positives = 73/181 (40%), Gaps = 26/181 (14%)

Query: 72  MTNKIGGERKTSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTSGSVA 131
           +TN   GE K       S+DFL+KPQRVTQ+    + E+ ++RNT+LN+           
Sbjct: 6   LTNNYSGENKP-----RSLDFLHKPQRVTQLKT-LYAEDSLQRNTNLNRG---------- 49

Query: 132 KDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSPIYXXXXXX 191
                   E ++P D  E     T+        N     VDE Y    P  PI       
Sbjct: 50  ---PPPDYENVAPTDSREYYGDGTLHRGSIGSLNSYFPDVDEYY----PPKPIRKKSGEL 102

Query: 192 XXXXXXXXXXXXXXXXEILQKSLRFENDAMEMV-RSKSVHFDQK--APVKYFREDESPST 248
                               +  R E   ME   RSKSVHFDQ+    VKYF++DE P  
Sbjct: 103 VKSSLKQHHRSKSLPATPTGREPRTEIIIMEPPKRSKSVHFDQRDVVSVKYFQKDERPVE 162

Query: 249 V 249
           V
Sbjct: 163 V 163

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score =  171 bits (434), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 84/180 (46%), Positives = 115/180 (63%), Gaps = 30/180 (16%)

Query: 387 KVVGLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSN 446
           ++VGLYN NFPILS++N KSLKLNIF+ LS+ +  FLQE+TL                  
Sbjct: 358 RIVGLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITL------------------ 399

Query: 447 SEFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPG 506
                  +      +I GK+ VKNI++DK++IVRYTW+ WRT H+ EC++ S+ +GI+PG
Sbjct: 400 -------LTGFHNMVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPG 452

Query: 507 TNMDVFRFLIDDANKLEAR----AKLEFCIQY-TARNDTERLEYWDNNDGKNYKVGVIMN 561
           +NMD+F+F IDD +    +    ++LEFCIQY T   D  R EYWDNND  NYK+ V+ N
Sbjct: 453 SNMDIFKFSIDDIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYWDNNDSANYKIDVVTN 512

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 89/206 (43%), Gaps = 41/206 (19%)

Query: 87  LNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRL-----------VTSGS----VA 131
           LNS++FL+KP+R++ + + + P++E++RNTD+NK +             + SG+      
Sbjct: 50  LNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNAHH 109

Query: 132 KDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSPIYXXXXXX 191
           +D  + G E        EISP S     +  Q    + G         P  PIY      
Sbjct: 110 QDVSKLGEEE------DEISPLS----HDNFQYESEENG--------NPSPPIYKKSGEL 151

Query: 192 XXXXXXXXXXXXXXXXEIL-------QKSLRFEN-DAMEMVRSKSVHFDQKAPVKYFRED 243
                           + +        K +  ++ D   + RSKSVHFD+  P+K F E+
Sbjct: 152 VKSSLKRRSKSLPITPKSIFNKTGSKSKHVNLDHVDTRLLQRSKSVHFDRVLPIKLFNEN 211

Query: 244 ESPSTVNMMAEFDNLLNLMHKPVNRV 269
           E P  V       ++LN  HKP+ R+
Sbjct: 212 EKPIDVGKQMVQQDVLNFKHKPLTRL 237

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score =  166 bits (421), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/184 (45%), Positives = 120/184 (65%), Gaps = 19/184 (10%)

Query: 387 KVVGLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSN 446
           K+  L + NFP L +K  KSLKLNIF+  + DKK  LQEV+L+++K         +N  N
Sbjct: 650 KMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRK-------SNYYN 702

Query: 447 SEFGQGSIIQRSTR------LITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDG 500
           S FG   I   + R      +ITG +LVKNI++DK+V +RYTW+ WR+ ++VE ++V  G
Sbjct: 703 SNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGSG 762

Query: 501 DGIVPGTNMDVFRFLID-----DANKLEARAK-LEFCIQYTARNDTERLEYWDNNDGKNY 554
           +  +PG+ MD+FRF+ID     +   +  R++ LEFCIQYT R++T R EYWDNN+GKNY
Sbjct: 763 NNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYWDNNNGKNY 822

Query: 555 KVGV 558
            V +
Sbjct: 823 IVEI 826

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/254 (29%), Positives = 116/254 (45%), Gaps = 51/254 (20%)

Query: 82  TSLNSLNSMDFLYKPQRVTQMNVDKF-PEEEVKRNTDLNKNIRLV-----------TSGS 129
           T    +NS+DFL+KPQRVTQM  + F   EE+KRNTD+NK I +                
Sbjct: 305 TGKGRINSLDFLHKPQRVTQMKSEDFISPEELKRNTDMNKQILMAKILPDDRINDKIDDI 364

Query: 130 VAKDEEETGREY----MSPIDLPEISPR-STIQSSEFIQ-------------------NN 165
              +EE TG ++    MS  +    SP  ++I++ E I+                    N
Sbjct: 365 TTPEEEITGLKHELGKMSIGNGSANSPAINSIKAEEIIELAQDESISPTEHHYPILNRAN 424

Query: 166 KTQEGV----DERYDG------ITPLSPIYXXXXXXXXXXXXXXXXXXXXXXEILQKS-- 213
           + Q+ V     + YD       + PL P+Y                         +++  
Sbjct: 425 QAQQDVCLPLHDSYDQSPVEDHMMPLPPVYKKSGELVKSSLKRRSKSLPVTPNSNRRTQN 484

Query: 214 ---LRFENDAMEMVRSKSVHFDQKAPVKYFREDESPSTVNMMAEFDNLLNLMHKPVNRVF 270
              +R  N   +++RSKSVHFDQ+ PVKYF ++ESPS V++  E D++L+  HKP+ R  
Sbjct: 485 SRGVRMNNPRDQLIRSKSVHFDQRLPVKYFFKEESPSVVSIRDEEDDVLSFQHKPLVRSI 544

Query: 271 EYGDKELAALGLDK 284
           +  +     L L++
Sbjct: 545 DRNNGRKKRLDLNR 558

>Kwal_23.5764
          Length = 462

 Score =  148 bits (373), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 109/202 (53%), Gaps = 51/202 (25%)

Query: 390 GLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNSEF 449
           GLY+ NF  L++ +  SLK NIF+ ++ +  CFLQE++L  ++                 
Sbjct: 284 GLYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSLIGDQH---------------- 327

Query: 450 GQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNM 509
                       + G +LVKN++Y+K V+VRYT + WRT  D+EC+W S GD ++PG +M
Sbjct: 328 -----------YLVGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHM 376

Query: 510 DVFRFLIDDANKLE--------------------ARAKLEFCIQYTARNDTERLEYWDNN 549
           D F+ +ID A   E                    +  +L+FCIQY +R+   R+EYWDNN
Sbjct: 377 DRFKLVIDLAGLQEGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYWDNN 436

Query: 550 DGKNYKVGVIMN----GFTNPF 567
            G+NY V V+ +    GFTNPF
Sbjct: 437 AGRNYVVDVVSSAPRMGFTNPF 458

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 74/184 (40%), Gaps = 39/184 (21%)

Query: 89  SMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNK-NIRLVTSGSVAKDEEETGREYMSPIDL 147
           S+ FL+KPQRVTQ     + +E ++RNTD+N+ N+++          E    +Y S  + 
Sbjct: 23  SLAFLHKPQRVTQPRA-LYADEWLRRNTDMNRGNVKV----------ENCPEDYFS-QNF 70

Query: 148 PEISPRSTIQSSEFIQNNKTQEGVDERYDGITPL--SPIYXXXXXXXXXXXXXXXXXXXX 205
               P     +SE    + +        D  +PL  +P +                    
Sbjct: 71  KGDGPTKQTAASEANGFDPSASNASAG-DTASPLRVNPYFPAEEDSVVADAAAPPLVRKK 129

Query: 206 XXEILQKSLRFENDAMEMV---------------------RSKSVHFDQKAPV--KYFRE 242
             E+++ SL+    +  +                      RSKSVHFDQ+  V  KYF +
Sbjct: 130 SGEVVRPSLKMAQRSRSLPATPSDREPDKRLGGPPAAGPKRSKSVHFDQRDVVKFKYFWQ 189

Query: 243 DESP 246
           ++SP
Sbjct: 190 EDSP 193

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score =  142 bits (359), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 66/166 (39%), Positives = 98/166 (59%), Gaps = 28/166 (16%)

Query: 391 LYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNSEFG 450
           L N+NFPIL+NK+P  L LNIF+ ++ ++K FLQ+++L                      
Sbjct: 214 LRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSLD--------------------- 252

Query: 451 QGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNMD 510
                  S  ++TG++LVKNI YDK VIVRYTW++W    D   +W+S G+ ++PG +MD
Sbjct: 253 -------SMLVMTGRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMD 305

Query: 511 VFRFLIDDANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNYKV 556
           +F F ID    +    +LEFCI+Y  R++++   +WDNN G NY V
Sbjct: 306 LFEFAIDVPAPVSGTPRLEFCIRYQVRDNSDFQTHWDNNHGNNYVV 351

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 89/236 (37%), Gaps = 59/236 (25%)

Query: 80  RKTSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLVTSGSVAKDEEETGR 139
           R +     +S+  L KPQR++     +  E  +KRNTD N   R    G+ A DE     
Sbjct: 17  RSSQEGKYSSLALLRKPQRISSRTEREEQENILKRNTDYN---RKRGGGTWAADEN---- 69

Query: 140 EYMSPIDLPEISPRST----IQSSEFIQNNKTQEGVDERYDGITPLSPIYXXXXXXXXXX 195
             + P+D  E SPR      + +  F Q++   + V  +     P +P            
Sbjct: 70  --IDPLDGDE-SPRRAGSPVVLTDYFSQSHAVYDNVGHQRSNSLPGTPT----------- 115

Query: 196 XXXXXXXXXXXXEILQKSLRFENDAMEMVRSKSVHFDQK--APVKYFREDESPSTVNMMA 253
                         L++          + RSKSVHFD +    VKYF  DES   V    
Sbjct: 116 ------------SALKR-------PGGVRRSKSVHFDNRDVVSVKYFNSDESTLLVAHAQ 156

Query: 254 EFDNLLNLMHKPVNRVFEYGDKELAALGLDKV----GDTAVNKGAETKLRKSKRFQ 305
            F++ L L             +ELA  GL  V    G     K     LRKSK F+
Sbjct: 157 SFEDQLRLRQDA---------RELAPNGLTLVAPAGGMAGGAKSPRKPLRKSKCFR 203

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score = 93.6 bits (231), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 66/101 (65%), Gaps = 4/101 (3%)

Query: 461 LITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGT---NMDVFRFLID 517
           ++ G ++V+NI Y+KRVIVRYT + W++  DVE +W+++   +  GT   ++DVF+F I 
Sbjct: 396 MLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESVWITNHCNLKSGTGAIDIDVFQFAI- 454

Query: 518 DANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNYKVGV 558
           D  K+     +E CI Y  R  +  +++WDNN G+NYKV V
Sbjct: 455 DLGKINTIEHIEMCILYQTREGSSWIDHWDNNSGQNYKVSV 495

 Score = 36.6 bits (83), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 19/24 (79%), Gaps = 2/24 (8%)

Query: 225 RSKSVHFDQ--KAPVKYFREDESP 246
           RSKSVHF Q  K  VKYFREDESP
Sbjct: 194 RSKSVHFAQSEKFEVKYFREDESP 217

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%)

Query: 87  LNSMDFLYKPQRVTQMNVDKFPEEEVKRNTDLNKNIRLV 125
            +S++FL KPQR++         + +KRNTDLNK+  +V
Sbjct: 15  FSSLNFLRKPQRISCQVETTAMNDALKRNTDLNKSKIIV 53

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 62/130 (47%), Gaps = 25/130 (19%)

Query: 443 NGSNSEFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDG 502
           NG N +    + +   +  ITG + VKN+ ++K + +++T+N WR +H     +V+    
Sbjct: 239 NGQNVKLHSLTQLGDDSSKITGLVYVKNLSFEKYLEIKFTFNSWRDIH-----YVTANFN 293

Query: 503 IVPGTNMDVFRFLID----------------DANKLEARAKLEFCIQYTARNDTERLEYW 546
               +N+D F+F ID                + N       +E C +Y   N+T    Y+
Sbjct: 294 RTINSNVDEFKFTIDLNSLKYILLIKRIITMEKNTSSCPLNIELCCRYDVNNET----YY 349

Query: 547 DNNDGKNYKV 556
           DNN+GKNY +
Sbjct: 350 DNNNGKNYHL 359

>YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein that
           interacts with Gsy2p, possible regulatory subunit for
           the PP1 family protein phosphatase Glc7p [1947 bp, 648
           aa]
          Length = 648

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 60/119 (50%), Gaps = 24/119 (20%)

Query: 462 ITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNMDVFRFLID-DAN 520
           I G I V N+ ++K++ +++T N+W  +H +   +      + P  ++D F+F+ID  A 
Sbjct: 224 IWGLIFVNNLNFEKKIEIKFTLNNWADIHYINAHY---NKSVTP--HVDEFKFIIDISAL 278

Query: 521 KLEARAK-----------------LEFCIQYTARNDTERLEYWDNNDGKNYKVGVIMNG 562
           KL   +K                 L+FC +Y   N  E   ++DNND KNY++ + ++ 
Sbjct: 279 KLNLISKNLIYTNFFERKTTCLLNLQFCCRYDV-NGFEYRSFYDNNDYKNYEITISLSA 336

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 9/88 (10%)

Query: 462 ITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWV----SDGDGIVPGTNMDVFRFLID 517
           I GKILVKN+ Y+K + V+YT+N+W  +H +   +     ++ D      N+   ++++ 
Sbjct: 298 IVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTKSISAEIDEFEFKINLSSLKYILQ 357

Query: 518 DANKLEARA-----KLEFCIQYTARNDT 540
               L+ ++      +E C +Y    +T
Sbjct: 358 FKRILQFKSNDTYLNMELCCRYDVNGET 385

>KLLA0D09240g complement(775848..778094) some similarities with
           sp|P28006 Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, regulatory chain,
           hypothetical start
          Length = 748

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 76/163 (46%), Gaps = 26/163 (15%)

Query: 392 YNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNSEFGQ 451
           +N NF     K+P  +K  I +K +  KK +    +L I ++  L + L   G+N +  +
Sbjct: 409 FNFNFNTSPTKDPIQIKSWI-LKGTNIKKFY--PTSLDINQD--LSKYL--QGNNIKLHE 461

Query: 452 GSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNMDV 511
            + +Q S   +TG I V N+ ++K + +++++N W+ +H     +V+          +D 
Sbjct: 462 CNSLQLSQGKLTGLIYVNNLSFEKFIEIKFSFNGWKDIH-----YVTANFKRTITDTVDE 516

Query: 512 FRFLIDDA--------------NKLEARAKLEFCIQYTARNDT 540
           F+FLI+ +              N L +   ++ C +Y    +T
Sbjct: 517 FQFLINLSSFVYFLKVKNLILFNSLISPLTIQLCCRYDVNGET 559

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 36.6 bits (83), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 9/94 (9%)

Query: 426 VTLHIEKENPLKRLLPA--NGSNSEFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTW 483
           V+ H +   PL+  L     G N    + S++   T  I G + V N+ ++K + V++++
Sbjct: 250 VSFHPQGALPLQDQLFQFLQGHNIRLNKVSLVDMHT--IKGSLYVTNLHFEKFIEVKFSF 307

Query: 484 NDWRTVHDVECIWVSDGDGIVPGTNMDVFRFLID 517
           ++W+ +H V   ++         + +D F+F+ID
Sbjct: 308 DEWKNIHYVTAQYLK-----TVTSKVDEFQFIID 336

>Kwal_56.23262
          Length = 429

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 11/61 (18%)

Query: 462 ITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIW---VSDGDGIVPGTNMDVFRFLIDD 518
           + G I V N+ ++K + +++T+N+WR VH V       ++D         +D F+F ID 
Sbjct: 36  LQGLIYVANLNFEKSLEIKFTFNNWRDVHYVAAHHHRSITDA--------IDEFKFTIDL 87

Query: 519 A 519
           A
Sbjct: 88  A 88

>CAGL0F04917g complement(499132..501180) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 682

 Score = 33.9 bits (76), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 40/78 (51%), Gaps = 14/78 (17%)

Query: 443 NGSNSEFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIW---VSD 499
           NGSN +        + T  + G I V N+ ++K + V++++N+W+ +H     +   ++D
Sbjct: 176 NGSNIKLHNLQ---KKTNKLKGLIYVNNLNFEKFIEVKFSFNNWKDIHYATATYNKSITD 232

Query: 500 GDGIVPGTNMDVFRFLID 517
                   ++D FRF ID
Sbjct: 233 --------HIDEFRFTID 242

>Scas_521.1
          Length = 579

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 8/102 (7%)

Query: 417 KDKKCFLQEVTLHIEKENPLKRLLPANGSNSE-FGQGSIIQRSTRLITGKILVKNIFYDK 475
           +D +     V    + E P ++LL  NG N + +   S        + G ILV NI ++K
Sbjct: 161 RDWQLMSSPVQSQFKSEMPFEQLL--NGQNIKLYSLKSENDGQAFKLVGLILVNNIQFEK 218

Query: 476 RVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNMDVFRFLID 517
            + V++T+N+W  +    C  V+  +  +     D F+F ID
Sbjct: 219 NIEVKFTFNNWENI----CYQVAYFNRSL-NAKFDEFKFTID 255

>Scas_659.21
          Length = 594

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 8/102 (7%)

Query: 417 KDKKCFLQEVTLHIEKENPLKRLLPANGSNSE-FGQGSIIQRSTRLITGKILVKNIFYDK 475
           +D +     V    + E P ++LL  NG N + +   S        + G ILV NI ++K
Sbjct: 179 RDWQLMSSPVQSQFKNEVPFEQLL--NGQNIKLYSLKSENDGQAFKLVGLILVNNIQFEK 236

Query: 476 RVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNMDVFRFLID 517
            + V++T+N+W  +    C  V+  +  +     D F+F ID
Sbjct: 237 NIEVKFTFNNWENI----CYQVAYFNRSL-NVKFDEFKFTID 273

>CAGL0H02189g complement(199107..199700) weakly similar to sp|Q03525
           Saccharomyces cerevisiae YMR269w, hypothetical start
          Length = 197

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 35/84 (41%), Gaps = 17/84 (20%)

Query: 8   RKNVLPPPIETKAEKDKRGSDTHHGHNSKSHIIDEVIENKDEHEDFSHDANAE------- 60
           RK  L  PI  K ++DK+G     GHN      + + + + ++ D S D+N++       
Sbjct: 19  RKGSLKKPILVKHKRDKKGLGGAVGHNDGEAWWERLFDGQLKNLDVSTDSNSDGEIVFKQ 78

Query: 61  ----------CSSPTFEEFTHMTN 74
                      SSP ++ F   T 
Sbjct: 79  NSVVASGVPKSSSPLYQWFVKGTG 102

>CAGL0M10109g 1006975..1008366 similar to sp|P36075 Saccharomyces
           cerevisiae YKL090w, start by similarity
          Length = 463

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 7/93 (7%)

Query: 20  AEKDKRGSDTHHGHNSKSHIIDEVIENKDEH----EDFSHDANAECSSPTFEEFTHMTNK 75
           A +  R   +H   + K + +D   EN  EH     D   D  +   +PT+E+   +   
Sbjct: 195 AIRGGRVQSSHGIAHRKQNGLDLKTENSFEHLCDVTDNMSDTISTVEAPTYEDVADLKKL 254

Query: 76  IGGERKTSLNSLNSMDFLYKPQRVTQMNVDKFP 108
           + GE+  +L++ N M+F+ K  R   +N+DK  
Sbjct: 255 LSGEQ--TLSAFN-MEFINKAYRYYHLNLDKLA 284

>Kwal_27.12639
          Length = 1568

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 5/82 (6%)

Query: 451 QGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGTNMD 510
           QG ++ RST    G  +    F D R +V    N W  +     ++VSD     P   +D
Sbjct: 415 QGYMVVRSTANAQGWRVSHFRFRDWRAMVERHTNKWFLIRHSYIVYVSDLHSATP---LD 471

Query: 511 VFRFLIDDANKLEARAKLEFCI 532
           V  FL+D + K+    ++E  +
Sbjct: 472 V--FLVDSSFKIRVPGEIEISM 491

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,000,409
Number of extensions: 799625
Number of successful extensions: 2150
Number of sequences better than 10.0: 56
Number of HSP's gapped: 2166
Number of HSP's successfully gapped: 71
Length of query: 570
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 463
Effective length of database: 12,891,983
Effective search space: 5968988129
Effective search space used: 5968988129
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)