Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.4530530516260.0
Sklu_2260.530230212221e-170
YER053C30030812121e-169
Kwal_23.575730729711241e-155
Sklu_1119.13072976239e-80
Kwal_33.155973052976203e-79
YJR077C (MIR1)3113056204e-79
CAGL0F00231g3072926125e-78
KLLA0B14454g3052975924e-75
Scas_673.173142925864e-74
AER450C3082925579e-70
Kwal_26.86692962591992e-17
CAGL0L05742g3053021973e-17
YPR021C (AGC1)9022971989e-17
Sklu_1149.22962841799e-15
KLLA0D07073g2972591781e-14
YJL133W (MRS3)3142831781e-14
Scas_379.23012891772e-14
CAGL0K02365g9193111802e-14
Scas_640.253062651719e-14
KLLA0E13453g9062961731e-13
Scas_602.88852881732e-13
Sklu_2432.52882351692e-13
CAGL0L02079g2972931655e-13
CAGL0J09790g3002821656e-13
ADL049W9122951687e-13
YKR052C (MRS4)3042951631e-12
YBR291C (CTP1)2992591621e-12
Kwal_47.173218812971652e-12
Sklu_2359.69022881642e-12
Scas_582.73292961622e-12
YOR222W (ODC2)3072901612e-12
ACR109W2992591603e-12
YJR095W (SFC1)3222901603e-12
CAGL0K08250g2972941576e-12
Kwal_23.47313143061569e-12
Scas_489.42973161541e-11
KLLA0B11319g3552301542e-11
Sklu_2334.23192851542e-11
Kwal_23.29133202781523e-11
Kwal_26.79672972911505e-11
CAGL0G01166g2952401505e-11
Scas_562.123002841481e-10
Kwal_23.39653071741471e-10
KLLA0F13464g3002791462e-10
Sklu_2127.52781681452e-10
Scas_702.103022951462e-10
CAGL0K10362g3011781453e-10
YOR130C (ORT1)2921871443e-10
ACR260W3112951443e-10
Scas_721.273741851445e-10
YLR348C (DIC1)2982331435e-10
Sklu_2037.23103081435e-10
AGL311C3622871436e-10
Sklu_2430.103242081427e-10
KLLA0E23705g3681971428e-10
Sklu_2117.22982791419e-10
ADL009W3792751429e-10
YGR096W (TPC1)3141851419e-10
Kwal_27.120813691891411e-09
YMR166C3683111411e-09
Scas_691.43342961401e-09
YDL198C (YHM1)3002691391e-09
Kwal_27.116262992821382e-09
YPL134C (ODC1)3102661392e-09
KLLA0B12826g3192011382e-09
CAGL0J01661g3273231373e-09
Scas_632.92921721363e-09
Scas_716.293162051373e-09
Scas_589.103162641364e-09
Kwal_23.43543432571355e-09
CAGL0G08910g2892931338e-09
YHR002W (LEU5)3571431348e-09
Kwal_33.140503143041339e-09
KLLA0F03212g3052751339e-09
Kwal_23.30425422491341e-08
Kwal_14.22103153071312e-08
Scas_721.1293231801302e-08
AEL253W3652001303e-08
KLLA0E02772g2841711283e-08
CAGL0J02002g3611881293e-08
YPR011C3263151293e-08
Kwal_33.154463051901284e-08
KLLA0D15015g3172251294e-08
AER366W2932601284e-08
YBR192W (RIM2)3771831294e-08
Kwal_26.76533252081275e-08
Kwal_26.79723581741275e-08
KLLA0E09680g3071951275e-08
Sklu_2431.53701951276e-08
Scas_645.93912501276e-08
AGR191W2982801267e-08
KLLA0F04697g3073141267e-08
Scas_662.123081831267e-08
CAGL0M09020g3482561277e-08
KLLA0C13431g3282941267e-08
Kwal_23.35293953071277e-08
CAGL0M05225g3811881277e-08
ADR036C3402321259e-08
YIL006W3731871261e-07
AGL047C3163121241e-07
AFL196W3613041242e-07
CAGL0J04114g3032811232e-07
Scas_669.63733131232e-07
Sklu_2363.23233031232e-07
CAGL0G03135g3072731222e-07
YIL134W (FLX1)3113041223e-07
Scas_709.93651761223e-07
KLLA0F17864g3071961213e-07
CAGL0K11616g3201791213e-07
AFR146W2811841204e-07
KLLA0E08877g2942681204e-07
Sklu_2435.23443041196e-07
CAGL0J05522g5192831206e-07
Kwal_55.213353171801188e-07
AFR542W3101501179e-07
Sklu_2075.33452001171e-06
Sklu_2194.33121241171e-06
YNL003C (PET8)2842961161e-06
YKL120W (OAC1)3241761161e-06
CAGL0C02013g3291591161e-06
Sklu_2115.42992941152e-06
Scas_697.473282741152e-06
CAGL0H10538g2972911152e-06
AGL065C3351391152e-06
Kwal_55.211063282821152e-06
AGR383W2932801142e-06
CAGL0K02915g3421431143e-06
Sklu_2374.75132561143e-06
Scas_687.15*3281601133e-06
Scas_717.203561221134e-06
Kwal_47.192282811271124e-06
KLLA0E15532g3263021124e-06
KLLA0F08547g3081291116e-06
KLLA0A09383g3662371116e-06
Scas_696.93121241116e-06
Kwal_55.208683801961117e-06
YPR058W (YMC1)3071931108e-06
Kwal_47.182163333051108e-06
YOR100C (CRC1)3272941099e-06
Sklu_2433.84201271101e-05
CAGL0K07436g3071241091e-05
AER419W4932741101e-05
KLLA0D14036g4312071091e-05
Scas_714.183051881082e-05
CAGL0F07711g3682801082e-05
CAGL0B04543g3171781072e-05
Kwal_34.159073121461072e-05
KLLA0D04290g1881371042e-05
KLLA0B08503g3032501072e-05
ABL023W3091781062e-05
KLLA0C11363g5172571072e-05
KLLA0E18810g3771771063e-05
YFR045W2851661053e-05
CAGL0D04774g3222741044e-05
Kwal_0.2322742681034e-05
AFR131C3443011045e-05
AFR253W3441251036e-05
ADL264C3292731036e-05
YEL006W3352011037e-05
CAGL0F08305g3742471028e-05
CAGL0D01606g305661028e-05
Scas_578.3*5243291038e-05
CAGL0H03839g2822641018e-05
YMR241W (YHM2)3141241011e-04
Scas_558.2289279992e-04
Scas_667.22306210992e-04
Scas_671.1*12395942e-04
Sklu_2442.8275265973e-04
Sklu_1275.1311190973e-04
KLLA0D09889g364300973e-04
Sklu_1926.230566974e-04
Kwal_27.12599304144964e-04
YBR104W (YMC2)329193965e-04
Kwal_33.1298830365965e-04
Kwal_56.23011303194956e-04
CAGL0K12210g31162930.001
AAL014C271239910.002
Kwal_27.11419298172910.002
CAGL0B03883g306203910.002
AGL064W296258880.004
YDL119C30764880.004
YMR056C (AAC1)309159880.004
AAR036W317176870.006
KLLA0D04950g274186840.011
Scas_705.9323180830.018
AFR147C315162820.025
Sklu_2398.4309203800.040
Scas_718.532468800.042
KLLA0E18788g381344800.050
KLLA0A00979g343135790.054
KLLA0E02750g30462750.16
YGR257C (MTM1)36697750.17
Scas_613.2417765720.26
KLLA0E12353g305162740.26
YNL083W545198740.29
Sklu_2127.4323172730.32
YBR085W (AAC3)30777730.33
Kwal_55.21338323167690.87
CAGL0F04213g30676662.0
Scas_667.4308166652.7
KLLA0E22880g43678653.1
Kwal_27.12481304132634.8
ACL205C890119627.6
YIL116W (HIS5)38563619.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.45
         (305 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.45                                                           630   0.0  
Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement        475   e-170
YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of ...   471   e-169
Kwal_23.5757                                                          437   e-155
Sklu_1119.1 YJR077C, Contig c1119 366-1289                            244   9e-80
Kwal_33.15597                                                         243   3e-79
YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate...   243   4e-79
CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomy...   240   5e-78
KLLA0B14454g complement(1268709..1269626) highly similar to sp|P...   232   4e-75
Scas_673.17                                                           230   4e-74
AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH] (1500683..1...   219   9e-70
Kwal_26.8669                                                           81   2e-17
CAGL0L05742g complement(630844..631761) similar to sp|P10566 Sac...    80   3e-17
YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of...    81   9e-17
Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement         74   9e-15
KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces c...    73   1e-14
YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the mitoc...    73   1e-14
Scas_379.2                                                             73   2e-14
CAGL0K02365g 212702..215461 highly similar to tr|Q12482 Saccharo...    74   2e-14
Scas_640.25                                                            70   9e-14
KLLA0E13453g complement(1184806..1187526) similar to sgd|S000622...    71   1e-13
Scas_602.8                                                             71   2e-13
Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement       70   2e-13
CAGL0L02079g 243467..244360 highly similar to sp|P38152 Saccharo...    68   5e-13
CAGL0J09790g complement(957759..958661) highly similar to sp|P38...    68   6e-13
ADL049W [1692] [Homologous to ScYPR021C - SH] complement(598135....    69   7e-13
YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of...    67   1e-12
YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondri...    67   1e-12
Kwal_47.17321                                                          68   2e-12
Sklu_2359.6 YPR021C, Contig c2359 14617-17325                          68   2e-12
Scas_582.7                                                             67   2e-12
YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate ...    67   2e-12
ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C (...    66   3e-12
YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membr...    66   3e-12
CAGL0K08250g complement(820185..821078) highly similar to sp|P23...    65   6e-12
Kwal_23.4731                                                           65   9e-12
Scas_489.4                                                             64   1e-11
KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyce...    64   2e-11
Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement         64   2e-11
Kwal_23.2913                                                           63   3e-11
Kwal_26.7967                                                           62   5e-11
CAGL0G01166g complement(111298..112185) highly similar to tr|Q06...    62   5e-11
Scas_562.12                                                            62   1e-10
Kwal_23.3965                                                           61   1e-10
KLLA0F13464g 1246646..1247548 highly similar to sp|P38988 Saccha...    61   2e-10
Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement         60   2e-10
Scas_702.10                                                            61   2e-10
CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375 S...    60   3e-10
YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine...    60   3e-10
ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C (...    60   3e-10
Scas_721.27                                                            60   5e-10
YLR348C (DIC1) [3731] chr12 complement(826976..827872) Mitochond...    60   5e-10
Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement         60   5e-10
AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH] (119645..12...    60   6e-10
Sklu_2430.10 YKL120W, Contig c2430 18856-19830                         59   7e-10
KLLA0E23705g complement(2099965..2101071) highly similar to sp|P...    59   8e-10
Sklu_2117.2 YDL198C, Contig c2117 3737-4633                            59   9e-10
ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH] co...    59   9e-10
YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiami...    59   9e-10
Kwal_27.12081                                                          59   1e-09
YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member...    59   1e-09
Scas_691.4                                                             59   1e-09
YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of t...    58   1e-09
Kwal_27.11626                                                          58   2e-09
YPL134C (ODC1) [5311] chr16 complement(298570..299502) 2-Oxodica...    58   2e-09
KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces...    58   2e-09
CAGL0J01661g 154646..155629 highly similar to tr|Q12251 Saccharo...    57   3e-09
Scas_632.9                                                             57   3e-09
Scas_716.29                                                            57   3e-09
Scas_589.10                                                            57   4e-09
Kwal_23.4354                                                           57   5e-09
CAGL0G08910g complement(853693..854562) similar to sp|P40464 Sac...    56   8e-09
YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similar...    56   8e-09
Kwal_33.14050                                                          56   9e-09
KLLA0F03212g 302915..303832 highly similar to sp|P33303 Saccharo...    56   9e-09
Kwal_23.3042                                                           56   1e-08
Kwal_14.2210                                                           55   2e-08
Scas_721.129                                                           55   2e-08
AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH] complement(...    55   3e-08
KLLA0E02772g complement(261895..262749) similar to sp|Q12375 Sac...    54   3e-08
CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces c...    54   3e-08
YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protei...    54   3e-08
Kwal_33.15446                                                          54   4e-08
KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces...    54   4e-08
AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH] complement(...    54   4e-08
YBR192W (RIM2) [375] chr2 (607609..608742) Member of the mitocho...    54   4e-08
Kwal_26.7653                                                           54   5e-08
Kwal_26.7972                                                           54   5e-08
KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaY...    54   5e-08
Sklu_2431.5 YBR192W, Contig c2431 8526-9638                            54   6e-08
Scas_645.9                                                             54   6e-08
AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH] complement(...    53   7e-08
KLLA0F04697g complement(461126..462049) similar to sp|P40464 Sac...    53   7e-08
Scas_662.12                                                            53   7e-08
CAGL0M09020g complement(896312..897358) highly similar to sp|P33...    54   7e-08
KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomy...    53   7e-08
Kwal_23.3529                                                           54   7e-08
CAGL0M05225g 563163..564308 highly similar to sp|P38127 Saccharo...    54   7e-08
ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH] (771097..77...    53   9e-08
YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the mit...    53   1e-07
AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803) ...    52   1e-07
AFL196W [2999] [Homologous to ScYMR166C - SH] complement(66955.....    52   2e-07
CAGL0J04114g complement(384321..385232) similar to sp|Q99297 Sac...    52   2e-07
Scas_669.6                                                             52   2e-07
Sklu_2363.2 YPR011C, Contig c2363 11969-12940                          52   2e-07
CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces c...    52   2e-07
YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in tr...    52   3e-07
Scas_709.9                                                             52   3e-07
KLLA0F17864g complement(1634241..1635164) similar to sp|P32331 S...    51   3e-07
CAGL0K11616g complement(1121834..1122796) highly similar to sp|P...    51   3e-07
AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH] complement(...    51   4e-07
KLLA0E08877g complement(791157..792041) similar to sgd|S0002277 ...    51   4e-07
Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement         50   6e-07
CAGL0J05522g complement(524930..526489) highly similar to sp|P48...    51   6e-07
Kwal_55.21335                                                          50   8e-07
AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH] complement(...    50   9e-07
Sklu_2075.3 , Contig c2075 6414-7451 reverse complement                50   1e-06
Sklu_2194.3 YMR241W, Contig c2194 5245-6183                            50   1e-06
YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein o...    49   1e-06
YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial oxalo...    49   1e-06
CAGL0C02013g complement(209930..210919) weakly similar to sp|P38...    49   1e-06
Sklu_2115.4 YDL119C, Contig c2115 2906-3805                            49   2e-06
Scas_697.47                                                            49   2e-06
CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534 Saccha...    49   2e-06
AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH] (585963..58...    49   2e-06
Kwal_55.21106                                                          49   2e-06
AGR383W [4694] [Homologous to ScYDL119C - SH] complement(1436769...    49   2e-06
CAGL0K02915g 259026..260054 highly similar to sp|P38702 Saccharo...    49   3e-06
Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement       49   3e-06
Scas_687.15*                                                           48   3e-06
Scas_717.20                                                            48   4e-06
Kwal_47.19228                                                          48   4e-06
KLLA0E15532g complement(1383230..1384210) similar to sp|P23500 S...    48   4e-06
KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces c...    47   6e-06
KLLA0A09383g complement(818752..819852) similar to sp|P53320 Sac...    47   6e-06
Scas_696.9                                                             47   6e-06
Kwal_55.20868                                                          47   7e-06
YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the mitoc...    47   8e-06
Kwal_47.18216                                                          47   8e-06
YOR100C (CRC1) [4905] chr15 complement(513295..514278) Mitochond...    47   9e-06
Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement       47   1e-05
CAGL0K07436g complement(734496..735419) highly similar to sp|Q04...    47   1e-05
AER419W [2919] [Homologous to ScYNL083W - SH] complement(1442595...    47   1e-05
KLLA0D14036g complement(1203522..1204817) some similarities with...    47   1e-05
Scas_714.18                                                            46   2e-05
CAGL0F07711g complement(751794..752900) similar to sp|Q03829 Sac...    46   2e-05
CAGL0B04543g 441599..442552 highly similar to tr|Q12289 Saccharo...    46   2e-05
Kwal_34.15907                                                          46   2e-05
KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyce...    45   2e-05
KLLA0B08503g complement(753498..754409) similar to sp|P32331 Sac...    46   2e-05
ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH] complement(3...    45   2e-05
KLLA0C11363g complement(975442..976995) similar to sp|P48233 Sac...    46   2e-05
KLLA0E18810g 1663220..1664353 some similarities with sp|P38152 S...    45   3e-05
YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the mit...    45   3e-05
CAGL0D04774g complement(467712..468680) similar to tr|Q06497 Sac...    45   4e-05
Kwal_0.232                                                             44   4e-05
AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033) [...    45   5e-05
AFR253W [3445] [Homologous to ScYFR045W - SH] complement(892939....    44   6e-05
ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH] (241532..24...    44   6e-05
YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the mit...    44   7e-05
CAGL0F08305g complement(827705..828829) similar to sp|P53320 Sac...    44   8e-05
CAGL0D01606g complement(169066..169983) highly similar to sp|P32...    44   8e-05
Scas_578.3*                                                            44   8e-05
CAGL0H03839g 359987..360835 highly similar to sp|P38921 Saccharo...    44   8e-05
YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1 ...    44   1e-04
Scas_558.2                                                             43   2e-04
Scas_667.22                                                            43   2e-04
Scas_671.1*                                                            41   2e-04
Sklu_2442.8 YNL003C, Contig c2442 12309-13136                          42   3e-04
Sklu_1275.1 , Contig c1275 314-1249                                    42   3e-04
KLLA0D09889g complement(834904..835998) similar to sp|Q03829 Sac...    42   3e-04
Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement          42   4e-04
Kwal_27.12599                                                          42   4e-04
YBR104W (YMC2) [293] chr2 (449624..450613) Member of the mitocho...    42   5e-04
Kwal_33.12988                                                          42   5e-04
Kwal_56.23011                                                          41   6e-04
CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces...    40   0.001
AAL014C [173] [Homologous to ScYNL003C (PET8) - SH] (317388..318...    40   0.002
Kwal_27.11419                                                          40   0.002
CAGL0B03883g 383602..384522 weakly similar to sp|P32331 Saccharo...    40   0.002
AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH] complement(...    39   0.004
YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member o...    39   0.004
YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP c...    39   0.004
AAR036W [222] [Homologous to ScYGR096W - SH] complement(406887.....    38   0.006
KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces c...    37   0.011
Scas_705.9                                                             37   0.018
AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 3...    36   0.025
Sklu_2398.4 , Contig c2398 9476-10405                                  35   0.040
Scas_718.5                                                             35   0.042
KLLA0E18788g complement(1661093..1662238) similar to sp|P38702 S...    35   0.050
KLLA0A00979g complement(92561..93592) weakly similar to sp|P3815...    35   0.054
KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida ...    33   0.16 
YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member o...    33   0.17 
Scas_613.24                                                            32   0.26 
KLLA0E12353g complement(1092303..1093220) gi|1351895|sp|P49382|A...    33   0.26 
YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the mi...    33   0.29 
Sklu_2127.4 , Contig c2127 6322-7293                                   33   0.32 
YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter p...    33   0.33 
Kwal_55.21338                                                          31   0.87 
CAGL0F04213g 419473..420393 highly similar to sp|P18239 Saccharo...    30   2.0  
Scas_667.4                                                             30   2.7  
KLLA0E22880g complement(2033077..2034387) similar to ca|CA2800|I...    30   3.1  
Kwal_27.12481                                                          29   4.8  
ACL205C [844] [Homologous to ScYPR194C (OPT2) - NSH] (1169..3841...    28   7.6  
YIL116W (HIS5) [2560] chr9 (142925..144082) Histidinol-phosphate...    28   9.1  

>Scas_715.45
          Length = 305

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/305 (100%), Positives = 305/305 (100%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ 60
           MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ
Sbjct: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ 60

Query: 61  ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL 120
           ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL
Sbjct: 61  ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL 120

Query: 121 SSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR 180
           SSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR
Sbjct: 121 SSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR 180

Query: 181 QIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVM 240
           QIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVM
Sbjct: 181 QIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVM 240

Query: 241 VSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVG 300
           VSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVG
Sbjct: 241 VSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVG 300

Query: 301 LPTSG 305
           LPTSG
Sbjct: 301 LPTSG 305

>Sklu_2260.5 YER053C, Contig c2260 6981-7889 reverse complement
          Length = 302

 Score =  475 bits (1222), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 227/302 (75%), Positives = 258/302 (85%), Gaps = 2/302 (0%)

Query: 4   TKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILK 63
           TK PI L++ EYYAACTLGG+VACGPTHSSVTPLDL+KCRLQV+P LYRSN  G   I++
Sbjct: 3   TKQPIPLFSPEYYAACTLGGVVACGPTHSSVTPLDLVKCRLQVNPQLYRSNLDGWKTIVR 62

Query: 64  KEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSA 123
            EGL K+FTGVGAT IGYSLQGA KYGGYE FK+ YS  L  +  TA+++RT++YL +SA
Sbjct: 63  SEGLSKVFTGVGATFIGYSLQGACKYGGYEYFKQTYSNLLSPE--TAHRHRTAVYLCASA 120

Query: 124 TAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183
           +AEF ADI+LCP+EAIKVKQQTT+PP+C N +EGW K+ A EGL+G YKGITPLWCRQIP
Sbjct: 121 SAEFLADILLCPWEAIKVKQQTTIPPFCKNFLEGWSKITAAEGLSGLYKGITPLWCRQIP 180

Query: 184 YTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSK 243
           YTMCKFTSFERIVE IYA+LP  K EMS  QQI VSFVGGY+AGILCA+VSHPADVMVSK
Sbjct: 181 YTMCKFTSFERIVEMIYAKLPRSKQEMSPSQQIGVSFVGGYLAGILCAVVSHPADVMVSK 240

Query: 244 INNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLPT 303
           +N +RK  ESM  A KRIYSRIGF GLWNGLPVRI MIGTLTSFQWLIYDSFKAY+GLPT
Sbjct: 241 VNADRKQGESMVEASKRIYSRIGFGGLWNGLPVRIFMIGTLTSFQWLIYDSFKAYIGLPT 300

Query: 304 SG 305
           +G
Sbjct: 301 TG 302

>YER053C (PIC2) [1481] chr5 complement(258736..259638) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to C. elegans mitochondrial
           phosphate carrier protein [903 bp, 300 aa]
          Length = 300

 Score =  471 bits (1212), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/308 (73%), Positives = 258/308 (83%), Gaps = 11/308 (3%)

Query: 1   MSKTKSP--IELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGI 58
           M   K P  I+LYTKE+YA CTLGGI+ACGPTHSS+TPLDL+KCRLQV+P LY SN  G 
Sbjct: 1   MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGF 60

Query: 59  IQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIY 118
            +I+  EG  K++TG GAT +GYSLQGAGKYGGYE FK LYS+ L            ++Y
Sbjct: 61  RKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPG--------VTVY 112

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEG-LNGFYKGITPL 177
           L++SATAEF ADIMLCPFEAIKVKQQTTMPP+CNNV++GWKKMYA+ G +  FYKGI PL
Sbjct: 113 LMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPL 172

Query: 178 WCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237
           WCRQIPYTMCKFTSFE+IV+ IY+ LP KK EM+ALQQISVSFVGGY+AGILCA VSHPA
Sbjct: 173 WCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPA 232

Query: 238 DVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKA 297
           DVMVSKIN+ERK NESM+VA KRIY +IGF GLWNGL VRI+MIGTLTSFQWLIYDSFKA
Sbjct: 233 DVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKA 292

Query: 298 YVGLPTSG 305
           YVGLPT+G
Sbjct: 293 YVGLPTTG 300

>Kwal_23.5757
          Length = 307

 Score =  437 bits (1124), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 216/297 (72%), Positives = 239/297 (80%), Gaps = 3/297 (1%)

Query: 10  LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGK 69
           LY+ EYYAACTLGG+VACGPTHS+VTPLDL+KCR QVD +LY+SN  G  QI++ EG  K
Sbjct: 13  LYSPEYYAACTLGGLVACGPTHSAVTPLDLVKCRRQVDASLYKSNLDGWRQIVRSEGATK 72

Query: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129
           +FTGVGAT IGYSLQGA KYGGYE FK  YS  LV  E TA+ YRT I+L +SA+AEF A
Sbjct: 73  VFTGVGATAIGYSLQGAFKYGGYEFFKHQYS-QLVSPE-TAHSYRTGIFLAASASAEFIA 130

Query: 130 DIMLCPFEAIKVKQQTTMPP-WCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
           DI LCP+EAIKV+QQT +PP +  NV + + KM   EG    YKGITPLW RQIPYTMCK
Sbjct: 131 DIFLCPWEAIKVRQQTAVPPPFARNVFDAYSKMVGAEGFASLYKGITPLWFRQIPYTMCK 190

Query: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248
           FTSFERIVE IYARLPT K EMS L QISVSF GGY+AGILCA+VSHPADVMVSK+NNER
Sbjct: 191 FTSFERIVEMIYARLPTPKREMSQLGQISVSFAGGYLAGILCAVVSHPADVMVSKVNNER 250

Query: 249 KVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLPTSG 305
           K  ES   A  RIY +IGF GLWNGL VRILMIGTLTSFQWLIYDSFKA  GLPTSG
Sbjct: 251 KSGESTLQATSRIYGKIGFPGLWNGLAVRILMIGTLTSFQWLIYDSFKAAAGLPTSG 307

>Sklu_1119.1 YJR077C, Contig c1119 366-1289
          Length = 307

 Score =  244 bits (623), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 123/297 (41%), Positives = 183/297 (61%), Gaps = 6/297 (2%)

Query: 6   SPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLY-RSNTSGIIQILKK 64
           + I  Y+   YA   L G + CG THS++ P+D++K R+Q++PT+Y +   S   QI+  
Sbjct: 3   AAIPDYSLSDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISS 62

Query: 65  EGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSAT 124
           EG G L TG G T +GYSLQG+ K+GGYE+FK+L+   L  D+A    Y+ SIY+ S+A 
Sbjct: 63  EGAGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDVLGYDQAV--NYKNSIYIGSAAI 120

Query: 125 AEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184
           AEFFADI LCP EA +++   + P + N ++ G+ ++  +EG   FY G TP+  +QIPY
Sbjct: 121 AEFFADIALCPLEATRIR-LVSQPTFANGLVGGFSRILKEEGAGSFYNGFTPILFKQIPY 179

Query: 185 TMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI 244
            + KF  FER  E +Y  +   K  +S      ++ + G  AG+  AIVS PAD ++SK+
Sbjct: 180 NIAKFLVFERAAE-VYFGMAGPKESLSTASTTGINLLSGLTAGLAAAIVSQPADTLLSKV 238

Query: 245 NNERKVNESMNVA-LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVG 300
           N  +K      +  L ++  ++GFVG + GLP R++M+GTLTS Q+ IY S K  +G
Sbjct: 239 NKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTLG 295

>Kwal_33.15597
          Length = 305

 Score =  243 bits (620), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 184/297 (61%), Gaps = 6/297 (2%)

Query: 6   SPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLY-RSNTSGIIQILKK 64
           + I  YT   YA   L G + CG THS++ P+D++K R+Q++PT+Y +   S   QI+  
Sbjct: 3   AAIPQYTISDYAKFALAGAIGCGTTHSAMVPIDVVKTRIQLEPTVYNKGMISSFKQIISS 62

Query: 65  EGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSAT 124
           EG G L TG G T +GYSLQG+ K+GGYE+FK+L+   L  D+A  YK   SIY+ S+A 
Sbjct: 63  EGAGALLTGFGPTLLGYSLQGSFKFGGYEVFKKLFIDTLGYDQAVNYK--NSIYIGSAAI 120

Query: 125 AEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184
           AEFFADI LCP EA +++   + P + N ++ G+ ++  +EGL+ FY G TP+  +QIPY
Sbjct: 121 AEFFADIALCPLEATRIR-LVSQPTFANGLVGGFSRILKEEGLSSFYNGFTPILFKQIPY 179

Query: 185 TMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI 244
            + KF  FER  E +Y  +   K  +S      ++ + G  AG+  AIVS PAD ++SK+
Sbjct: 180 NIAKFLVFERAAE-VYFGMAGPKETLSTSTTTGLNLLSGLTAGLAAAIVSQPADTLLSKV 238

Query: 245 NNERKVNESMNVA-LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVG 300
           N  +K      +  L ++   +GFVG + GLP R++M+GTLTS Q+ IY S K  +G
Sbjct: 239 NKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTRLVMVGTLTSLQFGIYGSLKKTLG 295

>YJR077C (MIR1) [2970] chr10 complement(577169..578104) Phosphate
           transporter of the mitochondrial carrier (MCF) family
           [936 bp, 311 aa]
          Length = 311

 Score =  243 bits (620), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 187/305 (61%), Gaps = 7/305 (2%)

Query: 1   MSKTKSP-IELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII 59
           MS + +P I  Y+   Y    L G + CG THSS+ P+D++K R+Q++PT+Y     G  
Sbjct: 1   MSVSAAPAIPQYSVSDYMKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSF 60

Query: 60  -QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIY 118
            QI+  EG G L TG G T +GYS+QGA K+GGYE+FK+ +  +L  D  TA +Y+ S+Y
Sbjct: 61  KQIIAGEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDNLGYD--TASRYKNSVY 118

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLW 178
           + S+A AEF ADI LCP EA +++   + P + N ++ G+ ++  +EG+  FY G TP+ 
Sbjct: 119 MGSAAMAEFLADIALCPLEATRIR-LVSQPQFANGLVGGFSRILKEEGIGSFYSGFTPIL 177

Query: 179 CRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPAD 238
            +QIPY + KF  FER  E  Y      K ++S+     ++ + G  AG+  AIVS PAD
Sbjct: 178 FKQIPYNIAKFLVFERASE-FYYGFAGPKEKLSSTSTTLLNLLSGLTAGLAAAIVSQPAD 236

Query: 239 VMVSKINNERKVNESMNVA-LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKA 297
            ++SK+N  +K      V  L ++  ++GF G + GLP R++M+GTLTS Q+ IY S K+
Sbjct: 237 TLLSKVNKTKKAPGQSTVGLLAQLAKQLGFFGSFAGLPTRLVMVGTLTSLQFGIYGSLKS 296

Query: 298 YVGLP 302
            +G P
Sbjct: 297 TLGCP 301

>CAGL0F00231g 29705..30628 highly similar to sp|P23641 Saccharomyces
           cerevisiae YJR077c MIR1, hypothetical start
          Length = 307

 Score =  240 bits (612), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 121/292 (41%), Positives = 180/292 (61%), Gaps = 6/292 (2%)

Query: 11  YTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII-QILKKEGLGK 69
           Y+   YA   L G + CG THSS+ P+D++K R+Q++PT+Y     G   +I+ +EG G 
Sbjct: 8   YSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLEPTVYNKGMVGSFRKIIAEEGAGA 67

Query: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129
           L TG G T +GYS+QGA K+GGYE+FK+ +   L  D  TA +Y+ S+Y+ S+A AEF A
Sbjct: 68  LLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLGYD--TAARYKNSVYIGSAAAAEFLA 125

Query: 130 DIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKF 189
           DI LCP EA +++   + P + N ++ G+ ++  +EG+  FY G TP+  +QIPY + KF
Sbjct: 126 DIALCPLEATRIR-LVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKF 184

Query: 190 TSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERK 249
             FER  E +Y  L   K  +S     +++ + G  AG+  AIVS PAD ++SK+N   K
Sbjct: 185 LVFERASE-LYFSLAPPKDTLSQTSLTAINLLSGLTAGLAAAIVSQPADTLLSKVNKTSK 243

Query: 250 VNESMNVALK-RIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVG 300
                 V L  ++  ++GFVG + GLP R++M+GTLTS Q+ IY   K  +G
Sbjct: 244 APGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGQLKKSLG 295

>KLLA0B14454g complement(1268709..1269626) highly similar to
           sp|P23641 Saccharomyces cerevisiae YJR077c MIR1
           phosphate transport protein, mitochondrial (MCF), start
           by similarity
          Length = 305

 Score =  232 bits (592), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 125/297 (42%), Positives = 181/297 (60%), Gaps = 6/297 (2%)

Query: 6   SPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLY-RSNTSGIIQILKK 64
           SP+  YT   YA   L G + CG THSS+ P+D++K R+Q++PT+Y +   S   QI+  
Sbjct: 3   SPVPEYTVSDYAKFALAGAIGCGITHSSMVPIDVVKTRIQLEPTVYNKGMVSSFKQIISS 62

Query: 65  EGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSAT 124
           EG G L TG G T +GYSLQG+ K+GGYELFK+L   ++  D A  YK   +IY+ S+A 
Sbjct: 63  EGAGALLTGFGPTLLGYSLQGSFKFGGYELFKKLAIDNMGYDNAVNYK--NTIYIGSAAI 120

Query: 125 AEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184
           AEFFADI LCP EA +++   + P + N +  G+ ++  +EG+  FY G TP+  +QIPY
Sbjct: 121 AEFFADIALCPLEATRIR-LVSQPTFANGLFGGFSRILKEEGVGSFYNGFTPILFKQIPY 179

Query: 185 TMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI 244
            + KF  FE    A Y  L   K  MS     +++   G  AG+  A+VS PAD ++SK+
Sbjct: 180 NIAKFFVFEHAANA-YFGLAGPKETMSETTHTAINLAAGLTAGLAAAVVSQPADTLLSKV 238

Query: 245 NNERKVNESMNVA-LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVG 300
           N  +K      +  L ++  ++GFVG + GLP R++M+GTLTS Q+ IY + K  +G
Sbjct: 239 NKTKKAPGQSTIGLLAQLAKQLGFVGSFTGLPTRLVMVGTLTSLQFGIYGTLKKSLG 295

>Scas_673.17
          Length = 314

 Score =  230 bits (586), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 117/292 (40%), Positives = 177/292 (60%), Gaps = 6/292 (2%)

Query: 11  YTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ-ILKKEGLGK 69
           Y    Y    L G + CG THSS+ P+D++K R+Q++PT+Y     G  + I+  EG G 
Sbjct: 15  YAASDYFKFALAGAIGCGTTHSSLVPVDVVKTRIQLEPTVYNKGMVGSFKKIIADEGAGA 74

Query: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129
           L TG G T +GYS+QGA K+GGYE+FK+L S   +  E  A  Y+ S+Y+ S+A AEF A
Sbjct: 75  LLTGFGPTLLGYSVQGAFKFGGYEVFKKL-SIDTIGYE-NAVHYKNSVYMGSAAVAEFLA 132

Query: 130 DIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKF 189
           DI LCP EA +++   + P + N ++ G+ ++  +EG+  FY G TP+  +QIPY + KF
Sbjct: 133 DIALCPLEATRIR-LVSQPTFANGLVGGFSRILKEEGVGSFYSGFTPILFKQIPYNIAKF 191

Query: 190 TSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERK 249
             FER  E  Y  +  K++ +S +    ++ + G  AG   A VS PAD ++SK+N  +K
Sbjct: 192 LVFERASEVYYGIVGAKET-LSDMTNTGINLLSGLTAGFAAAFVSQPADTLLSKVNKTKK 250

Query: 250 V-NESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVG 300
              +S    L ++  ++G +G + GLP R++M+GTLTS Q+ IY S K  +G
Sbjct: 251 APGQSTIGLLAQLAKQLGVIGSFAGLPTRLIMVGTLTSLQFAIYGSLKNTLG 302

>AER450C [2950] [Homologous to ScYJR077C (MIR1) - SH]
           (1500683..1501609) [927 bp, 308 aa]
          Length = 308

 Score =  219 bits (557), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 118/292 (40%), Positives = 178/292 (60%), Gaps = 6/292 (2%)

Query: 11  YTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII-QILKKEGLGK 69
           Y+   YA   L G + CG THS++ P+D++K R+Q++P  Y S   G   +I+ +EG   
Sbjct: 10  YSLSDYAKFALAGAIGCGATHSAMVPIDVVKTRIQLEPLKYSSGMVGSFRKIVGEEGAAA 69

Query: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129
           L TG G T +GYS+QGA K+GGYE+FK+ +   L  +  TA +YRT IY+ S+A AEFFA
Sbjct: 70  LLTGFGPTLLGYSMQGAFKFGGYEVFKKAFVDALGYE--TACQYRTPIYIGSAAIAEFFA 127

Query: 130 DIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKF 189
           DI LCP EA +++   + P + N ++ G+ ++  +EG+  FY G TP+  +QIPY + KF
Sbjct: 128 DIALCPLEATRIR-LVSQPTFANGLVGGFARILKEEGIGSFYNGFTPILFKQIPYNIAKF 186

Query: 190 TSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERK 249
             FE    A Y  L   K  +S      ++ + G  AG+  A++S PAD ++SK+N  +K
Sbjct: 187 VVFEHAANA-YFGLAGSKENLSTTAATGINLLAGLTAGLAAAVISQPADTLLSKVNKTKK 245

Query: 250 V-NESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVG 300
              +S    L ++  ++GFVG + GLP R++M+GTLTS Q+ IY   K  +G
Sbjct: 246 APGQSTFGLLMQLAKQLGFVGSFAGLPTRLVMVGTLTSLQFGIYGKLKQSLG 297

>Kwal_26.8669
          Length = 296

 Score = 81.3 bits (199), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 122/259 (47%), Gaps = 26/259 (10%)

Query: 36  PLDLIKCRLQVDPT-----LYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYG 90
           PLD++K R+Q+  +      Y+     I QI+ KEG  +L+ G+ +  +  + + A K+ 
Sbjct: 29  PLDVVKTRMQLQVSGGLGPQYKGVVDCIKQIVAKEGASRLYKGISSPVLMEAPKRATKFA 88

Query: 91  GYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPW 150
             + F+++Y     K E    K   S+ +LS A+A      ++ PFE +K++ Q     +
Sbjct: 89  CNDEFQKIY-----KREFGVEKLTQSLSILSGASAGCCEAFVVVPFELVKIRLQDVSSSY 143

Query: 151 CNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEM 210
               I+  +K+ A+EG+   Y G+     R   +    F     I+  + A LP  KS+ 
Sbjct: 144 -KGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG----IIFQVRALLPEAKSKS 198

Query: 211 SALQQISVSFVGGYMAGILCAIVSHPADVMVSKINN-------ERKVNESMNVALKRIYS 263
              QQ     + G + G + +++S P DV+ S+I N        RK N S   ++  IY 
Sbjct: 199 ---QQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGARKYNWSWP-SIFTIYK 254

Query: 264 RIGFVGLWNGLPVRILMIG 282
             GF  L+ G   ++L +G
Sbjct: 255 EEGFRALYKGFVPKVLRLG 273

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 66/155 (42%), Gaps = 11/155 (7%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           V P +L+K RLQ   + Y+     + +I+ +EG+  ++ G+ +T   + +  AG +G   
Sbjct: 126 VVPFELVKIRLQDVSSSYKGPIDVVRKIIAQEGVLAMYNGLESTLWRHGVWNAGYFG--- 182

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNN 153
               ++    +  EA +   +T   L++ +       +M  PF+ +K + Q T       
Sbjct: 183 ---IIFQVRALLPEAKSKSQQTRNDLIAGSIGGTIGSLMSTPFDVVKSRIQNTAVVAGGA 239

Query: 154 VIEGWK-----KMYAKEGLNGFYKGITPLWCRQIP 183
               W       +Y +EG    YKG  P   R  P
Sbjct: 240 RKYNWSWPSIFTIYKEEGFRALYKGFVPKVLRLGP 274

>CAGL0L05742g complement(630844..631761) similar to sp|P10566
           Saccharomyces cerevisiae YJL133w MRS3 or sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4, start by
           similarity
          Length = 305

 Score = 80.5 bits (197), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 122/302 (40%), Gaps = 45/302 (14%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSG-----------IIQILKKEGLGK 69
           + G  A    HS + PLD +K RLQ    ++  +T+G           +  I  +EG   
Sbjct: 23  MAGAFAGIAEHSVIFPLDALKTRLQA---MHAISTTGGQPIPSTMLRQLSSISAQEGSMV 79

Query: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129
           L+ GV +  +G     A  +  YE+ K      L+ +  +  KY       S ATA   A
Sbjct: 80  LWKGVQSVLLGAGPAHAVYFATYEMVKSF----LIDEATSTSKYHFFKTAFSGATATIAA 135

Query: 130 DIMLCPFEAIKVKQQTTMPPWCNNVIEGW---KKMYAKEGLNGFYKGITPLWCRQIPYTM 186
           D ++ PF+ IK + Q       N  I  W   K++Y+KEG   FY          IP+  
Sbjct: 136 DALMNPFDVIKQRIQ------LNTNISVWDTAKRIYSKEGFQAFYSSYPTTLAINIPFAA 189

Query: 187 CKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINN 246
             F  ++           T+    S +    +  + G ++G  CA ++ P D + + +  
Sbjct: 190 FNFGIYDT---------ATRYFNPSGVYNPFIHCLCGGISGAACAGLTTPLDCIKTALQV 240

Query: 247 ERKVNESMNV---------ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKA 297
                 SM V         A + IY   G+ G W+G+  RIL     T+  W  Y+  K 
Sbjct: 241 RGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATAISWTAYEFAKH 300

Query: 298 YV 299
           ++
Sbjct: 301 FL 302

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 37/190 (19%), Positives = 74/190 (38%), Gaps = 18/190 (9%)

Query: 12  TKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLF 71
           +K ++      G  A     + + P D+IK R+Q++  +   +T+   +I  KEG    +
Sbjct: 117 SKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTNISVWDTAK--RIYSKEGFQAFY 174

Query: 72  TGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADI 131
           +    T        A  +G Y+   R ++   V        Y   I+ L    +      
Sbjct: 175 SSYPTTLAINIPFAAFNFGIYDTATRYFNPSGV--------YNPFIHCLCGGISGAACAG 226

Query: 132 MLCPFEAIKV------KQQTTMPPW--CNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183
           +  P + IK        ++ +M  +   +   +  + +Y   G  GF+ G+ P     +P
Sbjct: 227 LTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMP 286

Query: 184 YTMCKFTSFE 193
            T   +T++E
Sbjct: 287 ATAISWTAYE 296

>YPR021C (AGC1) [5455] chr16 complement(600644..603352) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [2709 bp, 902 aa]
          Length = 902

 Score = 80.9 bits (198), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 137/297 (46%), Gaps = 24/297 (8%)

Query: 20  TLGGIVAC-GPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLGKLFTGVGA 76
           +LG I  C G T   V P+D IK R+Q   +L  Y+++   +++I+ +EG+  L++G+G 
Sbjct: 535 SLGSIAGCIGAT--VVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGP 592

Query: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIY--LLSSATAEFFADIMLC 134
             IG + + A K         L     +++  T    + S++  ++S A+A     I   
Sbjct: 593 QLIGVAPEKAIK---------LTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTN 643

Query: 135 PFEAIKVKQQTTMPPWCNNVIEGWK---KMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
           P E +K++ Q        N+ +  +   ++  K GL G Y G+     R +P++   F +
Sbjct: 644 PLEIVKIRLQVQSDYVGENIQQANETATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPT 703

Query: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKIN-NERKV 250
           +  + + ++   P  K++ + L+   +    G +AG+  A ++ P DV+ +++  + RK 
Sbjct: 704 YAHLKKDLFDFDPNDKTKRNRLKTWEL-LTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKG 762

Query: 251 NESMN---VALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLPTS 304
               N    A++ I     F   + G   R+L       F    Y+ FK ++  P +
Sbjct: 763 ETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELFKGFIPSPDN 819

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 219 SFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVA--LKRIYSRIGFVGLWNGLPV 276
           +F  G +AG + A V +P D + +++  +R + +  N    L +I SR G  GL++GL  
Sbjct: 533 NFSLGSIAGCIGATVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSGLGP 592

Query: 277 RILMIGTLTSFQWLIYD 293
           +++ +    + +  + D
Sbjct: 593 QLIGVAPEKAIKLTVND 609

>Sklu_1149.2 YBR291C, Contig c1149 2019-2909 reverse complement
          Length = 296

 Score = 73.6 bits (179), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 66/284 (23%), Positives = 128/284 (45%), Gaps = 36/284 (12%)

Query: 12  TKEYYAACTLGGIVACGPTHSSVT-PLDLIKCRLQVDPTLYRSNTSGIIQI---LKKEGL 67
           +K + A C  G +       +SVT P +  K RLQ+     +++ + ++ I    K +G+
Sbjct: 10  SKSFIAGCLAGAV------EASVTYPFEFAKTRLQLLDKASKASRNPLVLIYNTAKTQGI 63

Query: 68  GKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATA--YKYRTSIYLLSSATA 125
           G ++ G  A  +G + +   ++ G++  K     +L++D  T      R  I  L +   
Sbjct: 64  GSVYVGCPAFIVGNTAKAGVRFLGFDTIK-----NLLRDPKTGELSGPRGVIAGLGAGLL 118

Query: 126 EFFADIMLCPFEAIKV----KQQTTMPPWCNN---VIEGWKKMYAKEGLNGFYKGITPLW 178
           E  + + + PFEAIK      +Q+  P + NN   ++  +  +  K+GL+G Y+G+ P+ 
Sbjct: 119 E--SVVAVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVS 176

Query: 179 CRQIPYTMCKFTSFERIVEAI--YARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHP 236
            RQ      +   + +I   +  Y   P  K   S L     +FV G  +GI+    + P
Sbjct: 177 MRQAANQAVRLGCYNKIKVMVQDYTNAPKDKPLSSGL-----TFVVGAFSGIVTVYTTMP 231

Query: 237 ADVMVSKIN--NERKVNESMNVALKRIYSRIGFVGLWNGLPVRI 278
            D + +++   + ++ + ++N     I+   G    W G   R+
Sbjct: 232 IDTVKTRMQSLDSKRYSSTIN-CFTTIFKEEGLKAFWKGATPRL 274

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 78/178 (43%), Gaps = 16/178 (8%)

Query: 33  SVTPLDLIKCRL----QVDPTLYRSNTSGIIQ----ILKKEGLGKLFTGVGATCIGYSLQ 84
           +VTP + IK  L    Q     Y +N  G+++    +++K+GL  L+ GV    +  +  
Sbjct: 123 AVTPFEAIKTALIDDKQSATPKYHNNGKGMLRNYTALVRKQGLSGLYRGVLPVSMRQAAN 182

Query: 85  GAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIML---CPFEAIKV 141
            A + G Y   K      +V+D   A K +     L+     F   + +    P + +K 
Sbjct: 183 QAVRLGCYNKIK-----VMVQDYTNAPKDKPLSSGLTFVVGAFSGIVTVYTTMPIDTVKT 237

Query: 142 KQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
           + Q+      ++ I  +  ++ +EGL  F+KG TP   R        FT +E+++  +
Sbjct: 238 RMQSLDSKRYSSTINCFTTIFKEEGLKAFWKGATPRLGRLFLSGGIVFTVYEKVLTVL 295

>KLLA0D07073g 606857..607750 similar to sp|Q03028 Saccharomyces
           cerevisiae YPL134c ODC1, start by similarity
          Length = 297

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 117/259 (45%), Gaps = 26/259 (10%)

Query: 36  PLDLIKCRLQVDPT-----LYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYG 90
           PLD++K  +Q+  +      Y+     + QI  KEG  +L+ G+ +  +  + + A K+ 
Sbjct: 29  PLDMVKTVMQLQVSGGSGPQYKGVFDCLKQIAAKEGPSRLYKGISSPILMEAPKRATKFA 88

Query: 91  GYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPW 150
             + F+++Y     KD   A K    + +LS A+A      ++ PFE +K++ Q     +
Sbjct: 89  CNDEFQKIY-----KDLFGAEKLTQPLSILSGASAGICESFVVVPFELVKIRLQDVSSKF 143

Query: 151 CNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEM 210
            +  I   K +  KEG+   Y G+     R   +    F     I+  + A LP   ++ 
Sbjct: 144 TSP-IAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG----IIFQVRALLPKASTKS 198

Query: 211 SALQQISVSFVGGYMAGILCAIVSHPADVMVSKINN-------ERKVNESMNVALKRIYS 263
              +Q     + G + G L +++S P DV+ S++ N        RK N S   AL  IY 
Sbjct: 199 ---EQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVPRKYNWSWP-ALATIYK 254

Query: 264 RIGFVGLWNGLPVRILMIG 282
             GF  L+ G   ++L +G
Sbjct: 255 EEGFKALYKGFVPKVLRLG 273

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 69/155 (44%), Gaps = 11/155 (7%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           V P +L+K RLQ   + + S  + +  I++KEG+  ++ G+ +T   + +  AG +G   
Sbjct: 126 VVPFELVKIRLQDVSSKFTSPIAVVKNIVEKEGILAMYNGLESTMWRHGIWNAGYFG--- 182

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT-----MP 148
               ++    +  +A+    +T   LL+       + ++  PF+ +K + Q T     +P
Sbjct: 183 ---IIFQVRALLPKASTKSEQTRNDLLAGTVGGTLSSLLSTPFDVVKSRVQNTAVIPGVP 239

Query: 149 PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183
              N        +Y +EG    YKG  P   R  P
Sbjct: 240 RKYNWSWPALATIYKEEGFKALYKGFVPKVLRLGP 274

>YJL133W (MRS3) [2785] chr10 (160537..161481) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses mitochondrial
           splicing defects [945 bp, 314 aa]
          Length = 314

 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 123/283 (43%), Gaps = 33/283 (11%)

Query: 31  HSSVTPLDLIKCRLQVD--PTLYRSNT-SGIIQILKKEGLGKLFTGVGATCIGYSLQGAG 87
           HS + P+D +K R+Q     +L   N  S I  I   EG   L+ GV +  +G     A 
Sbjct: 48  HSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKGVQSVILGAGPAHAV 107

Query: 88  KYGGYELFKRLYSTHLVK--DEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQT 145
            +G YE  K+    +L+   D  T + ++T+I   S A A   +D ++ PF+ IK + Q 
Sbjct: 108 YFGTYEFCKK----NLIDSSDTQTHHPFKTAI---SGACATTASDALMNPFDTIKQRIQL 160

Query: 146 TMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPT 205
                  +V +  K++Y  EGL  FY          IP+    F  +E   + +      
Sbjct: 161 NT---SASVWQTTKQIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFL-----N 212

Query: 206 KKSEMSALQQISVSFVGGYMAGILCAIVSHPADVM--VSKINNERKVN-------ESMNV 256
             +E + L    +  + G ++G  CA ++ P D +  V +I   + V+       ++ + 
Sbjct: 213 PSNEYNPL----IHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSK 268

Query: 257 ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           A   IY   G+ G W G   RI+     T+  W  Y+  K ++
Sbjct: 269 AASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHFL 311

>Scas_379.2
          Length = 301

 Score = 72.8 bits (177), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/289 (24%), Positives = 114/289 (39%), Gaps = 27/289 (9%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT-SGIIQILKKEGLGKLFTGVGATCI 79
           L G  A    HS + P+D +K R+Q       SN  S + +I   EG   L+ GV +  +
Sbjct: 28  LAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQSVIL 87

Query: 80  GYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAI 139
           G     A  +  YE     Y+   + DE     ++     LS   A   AD ++ PF+ +
Sbjct: 88  GAGPAHAVYFATYE-----YTKKYLIDEKDMQTHQPLKTALSGTVATIAADALMNPFDTL 142

Query: 140 KVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
           K + Q        NV    K++Y  EG + FY          IP+    F  +E      
Sbjct: 143 KQRMQLNTNTTVWNVT---KQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYESAT--- 196

Query: 200 YARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNV--- 256
             +     ++ + L    V  + G ++G  CA ++ P D + + +      + S+ V   
Sbjct: 197 --KFFNPTNDYNPL----VHCLSGGLSGATCAAITTPLDCIKTVLQVRGSESVSLQVMKE 250

Query: 257 ------ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
                 A K IY   G  G W GL  R+      T+  W  Y+  K ++
Sbjct: 251 ANTFQKATKAIYQVHGAKGFWRGLQPRVFANMPATAIAWTAYECAKHFL 299

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 76/176 (43%), Gaps = 8/176 (4%)

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLW 178
           LL+ A A      ++ P +A+K + Q+T     +N++    K+   EG    +KG+  + 
Sbjct: 27  LLAGAFAGIMEHSVMFPIDALKTRIQSTSAKSTSNMLSQMAKISTAEGSLALWKGVQSVI 86

Query: 179 CRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPAD 238
               P     F ++E   + +       + +M   Q +  + + G +A I    + +P D
Sbjct: 87  LGAGPAHAVYFATYEYTKKYL-----IDEKDMQTHQPLKTA-LSGTVATIAADALMNPFD 140

Query: 239 VMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDS 294
            +  ++  +   N ++    K+IY   GF   +   P  + M     +F ++IY+S
Sbjct: 141 TLKQRM--QLNTNTTVWNVTKQIYKNEGFSAFYYSYPTTLAMNIPFAAFNFMIYES 194

>CAGL0K02365g 212702..215461 highly similar to tr|Q12482
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 919

 Score = 73.9 bits (180), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 76/311 (24%), Positives = 134/311 (43%), Gaps = 29/311 (9%)

Query: 10  LYTKEYYAAC-------TLGGIVAC-GPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGII 59
           LYT  Y+          +LG +  C G T   V P+D +K R+Q   +L  Y+++    +
Sbjct: 531 LYTNYYFYPIFDSLYNFSLGSVAGCIGAT--IVYPIDFVKTRMQAQRSLSQYKNSIDCFL 588

Query: 60  QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYL 119
           +IL +EG+  +++G+G   IG + + A K     L    Y  + +KD+       + I  
Sbjct: 589 KILSREGIRGVYSGLGPQLIGVAPEKAIK-----LTVNDYMRNKLKDKNGKLGLLSEI-- 641

Query: 120 LSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWK----KMYAKEGLNGFYKGIT 175
           +S A+A     I   P E +K++ Q        N  E  K    ++  + GL G YKG  
Sbjct: 642 ISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENA-ENAKLTALQIIKRLGLPGLYKGAA 700

Query: 176 PLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSH 235
               R +P++   F ++  +   ++   P  K++ S L    +    G +AG+  A ++ 
Sbjct: 701 ACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWEL-LSAGALAGMPAAYLTT 759

Query: 236 PADVMVSKINNERKVNESMNV----ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLI 291
           P DV+ +++  + K  E++      A + I     F   + G   R+L       F    
Sbjct: 760 PFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQFGFTLAA 819

Query: 292 YDSFKAYVGLP 302
           Y+ F     LP
Sbjct: 820 YELFHNIFPLP 830

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 33/102 (32%), Positives = 45/102 (44%), Gaps = 8/102 (7%)

Query: 10  LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDP----TLYRSNTSGIIQILKKE 65
           L T E  +A  L G+    P     TP D+IK RLQ+DP    T+Y+        IL++E
Sbjct: 738 LNTWELLSAGALAGM----PAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREE 793

Query: 66  GLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDE 107
                F G  A  +  S Q       YELF  ++     KD+
Sbjct: 794 SFKSFFKGGAARVLRSSPQFGFTLAAYELFHNIFPLPNDKDK 835

>Scas_640.25
          Length = 306

 Score = 70.5 bits (171), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 64/265 (24%), Positives = 116/265 (43%), Gaps = 33/265 (12%)

Query: 36  PLDLIKCRLQVD---------PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86
           PLD++K R+Q+           T Y+     + QI+KKEG   ++ G+ +  +  + + A
Sbjct: 33  PLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHMYKGISSPMLMEAPKRA 92

Query: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146
            K+   + F +L+ +     + T       I +LS A+A     +++ PFE +K++ Q  
Sbjct: 93  VKFASNDEFIKLWKSVFGTKQLT-----QQISVLSGASAGITEALVIVPFELVKIRLQDV 147

Query: 147 MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK 206
              +   V E  K +  ++GL G Y G+     R   +    F    ++ E     LP  
Sbjct: 148 NSKFKGPV-EVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIFQVREL----LPVA 202

Query: 207 KSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALK------- 259
           KS+    +        G++ G    + + P DV+ S+I ++   NE +N   K       
Sbjct: 203 KSKQEKTRN---DLCAGFVGGTFGVMFNTPFDVVKSRIQSDG--NEIINGVRKYNWTWPS 257

Query: 260 --RIYSRIGFVGLWNGLPVRILMIG 282
             +IY   GF  L+ G   ++L +G
Sbjct: 258 VMKIYHEEGFRALYKGFVPKVLRLG 282

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 68/160 (42%), Gaps = 20/160 (12%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           + P +L+K RLQ   + ++     +  I+K++GL  L++GV +T    ++  AG +G   
Sbjct: 134 IVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGVESTVWRNAVWNAGYFGVIF 193

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNN 153
             + L      K E      +T   L +      F  +   PF+ +K + Q+      N 
Sbjct: 194 QVRELLPVAKSKQE------KTRNDLCAGFVGGTFGVMFNTPFDVVKSRIQSD----GNE 243

Query: 154 VIEGWK----------KMYAKEGLNGFYKGITPLWCRQIP 183
           +I G +          K+Y +EG    YKG  P   R  P
Sbjct: 244 IINGVRKYNWTWPSVMKIYHEEGFRALYKGFVPKVLRLGP 283

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 71/164 (43%), Gaps = 14/164 (8%)

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWC--------NNVIEGWKKMYAKEGLNGF 170
            ++ A A     +++ P + +K + Q  +              VI+   ++  KEG    
Sbjct: 17  FMAGAIAGISELMVMYPLDVVKTRMQLQVSTGAAGASATHYKGVIDCLSQIVKKEGPMHM 76

Query: 171 YKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILC 230
           YKGI+     + P    KF S +  ++   +   TK+      QQISV  + G  AGI  
Sbjct: 77  YKGISSPMLMEAPKRAVKFASNDEFIKLWKSVFGTKQ----LTQQISV--LSGASAGITE 130

Query: 231 AIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
           A+V  P +++  ++ +     +     LK I  + G  GL++G+
Sbjct: 131 ALVIVPFELVKIRLQDVNSKFKGPVEVLKHIIKQDGLKGLYSGV 174

>KLLA0E13453g complement(1184806..1187526) similar to sgd|S0006225
           Saccharomyces cerevisiae YPR021c, start by similarity
          Length = 906

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/296 (23%), Positives = 131/296 (44%), Gaps = 27/296 (9%)

Query: 20  TLGGIVAC-GPTHSSVTPLDLIKCRLQV--DPTLYRSNTSGIIQILKKEGLGKLFTGVGA 76
           TLG I  C G T   V P+DL+K R+Q   +   Y+++   +++I + +G+  L++G+G 
Sbjct: 509 TLGSIAGCIGAT--VVYPIDLVKTRMQAQRNSVQYKNSIDCVVKIFQTKGIRGLYSGLGP 566

Query: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPF 136
             IG + + A K    +  ++ +      +++   K+   I  LS ATA     +   P 
Sbjct: 567 QLIGVAPEKAIKLTVNDFMRQYF-----MNKSRTIKWYQEI--LSGATAGACQVVFTNPL 619

Query: 137 EAIKVKQQTTMPPWCNNVIE--GWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194
           E +K++ Q        N     G   +  + GL G YKG      R +P++   F ++  
Sbjct: 620 EIVKIRLQMRSDYVGENARPQLGAVGIIRQLGLRGLYKGAAACLLRDVPFSAIYFPTYAH 679

Query: 195 IVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESM 254
           + + ++   P  K++ + L+   +   GG +AG+  A ++ P DV+ +++  + +  E+ 
Sbjct: 680 LKKDVFNFDPNDKNKRNKLKTWELLLAGG-IAGMPAAYLTTPFDVIKTRLQIDPRKGETT 738

Query: 255 NV----ALKRIYSRIGFVGLWNGLPVRIL--------MIGTLTSFQWLIYDSFKAY 298
                 A + I         + G P R+L         +     FQ L    FK +
Sbjct: 739 YTGVIHAARTILKEESIKSFFKGGPARVLRSSPQFGFTLAAFEMFQGLFPSHFKNH 794

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 44/92 (47%), Gaps = 4/92 (4%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ----ILKKEGLGKLFTGVGA 76
           L G +A  P     TP D+IK RLQ+DP    +  +G+I     ILK+E +   F G  A
Sbjct: 705 LAGGIAGMPAAYLTTPFDVIKTRLQIDPRKGETTYTGVIHAARTILKEESIKSFFKGGPA 764

Query: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLVKDEA 108
             +  S Q       +E+F+ L+ +H    E 
Sbjct: 765 RVLRSSPQFGFTLAAFEMFQGLFPSHFKNHET 796

 Score = 28.9 bits (63), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 219 SFVGGYMAGILCAIVSHPADVMVSKINNER---KVNESMNVALKRIYSRIGFVGLWNGLP 275
           +F  G +AG + A V +P D++ +++  +R   +   S++  +K I+   G  GL++GL 
Sbjct: 507 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRNSVQYKNSIDCVVK-IFQTKGIRGLYSGLG 565

Query: 276 VRILMIGTLTSFQWLIYDSFKAY 298
            +++ +    + +  + D  + Y
Sbjct: 566 PQLIGVAPEKAIKLTVNDFMRQY 588

>Scas_602.8
          Length = 885

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 129/288 (44%), Gaps = 22/288 (7%)

Query: 20  TLGGIVAC-GPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLGKLFTGVGA 76
           +LG +  C G T   V P+D IK R+Q   +L  Y+++   +++I  KEG+  L++G+G 
Sbjct: 503 SLGSVAGCIGAT--LVYPIDFIKTRMQAQRSLTKYKNSIDCLVKIFGKEGIRGLYSGLGP 560

Query: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPF 136
             IG + + A K    +  ++     LV  +      +    +LS ATA     +   P 
Sbjct: 561 QLIGVAPEKAIKLTVNDFMRK----SLVDKKGNL---QLGAEVLSGATAGACQVVFTNPL 613

Query: 137 EAIKVKQQTTMPPWCNNVIEGWK----KMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSF 192
           E +K++ Q     + N +I   +    ++  +  L G YKG+     R +P++   F ++
Sbjct: 614 EIVKIRLQVK-SEYTNAMIPKSQLTAFQIIKELKLIGLYKGVGACLLRDVPFSAIYFPTY 672

Query: 193 ERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNE 252
             + + ++   P  K +   L+   +    G +AG+  A ++ P DV+ +++  E  V E
Sbjct: 673 AHLKKNVFQFDPNDKDKRDRLKTWEL-LTAGALAGVPAAFLTTPFDVIKTRLQIEPGVGE 731

Query: 253 SMNV----ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296
           +       A++ I     F   + G   R++       F    Y+ FK
Sbjct: 732 TRYTGILHAVRTILKEESFRSFFKGGAARVMRSSPQFGFTLAAYELFK 779

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 48/104 (46%), Gaps = 8/104 (7%)

Query: 22  GGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ----ILKKEGLGKLFTGVGAT 77
            G +A  P     TP D+IK RLQ++P +  +  +GI+     ILK+E     F G  A 
Sbjct: 701 AGALAGVPAAFLTTPFDVIKTRLQIEPGVGETRYTGILHAVRTILKEESFRSFFKGGAAR 760

Query: 78  CIGYSLQGAGKYGGYELFKRLYS----THLVKDEATAYKYRTSI 117
            +  S Q       YELFK +++        K+E +   Y  S+
Sbjct: 761 VMRSSPQFGFTLAAYELFKNMFNISDDKQPTKNEKSTEDYNDSV 804

>Sklu_2432.5 YLR348C, Contig c2432 10310-11176 reverse complement
          Length = 288

 Score = 69.7 bits (169), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/235 (24%), Positives = 98/235 (41%), Gaps = 23/235 (9%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIG 80
            GGIVAC  TH    PLDL K RLQ  P    +      QIL+ EG+  L++G+ A  + 
Sbjct: 17  FGGIVACVATH----PLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILR 72

Query: 81  YSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIK 140
                  ++G Y+  K  Y   + K+   +  Y     + S A      +    P + + 
Sbjct: 73  QCTYTTARFGVYDFVKERY---IPKEYLNSMLYLLPCSMFSGAVGGLIGN----PADVVN 125

Query: 141 VKQQ--TTMPPWCN----NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194
           ++ Q  +++P        N  +G  K+ + EG+   + G  P   R I  T  +  +++ 
Sbjct: 126 IRMQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDI 185

Query: 195 IVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERK 249
               +   +   K         S  F    +AG++   V  PADV+ +++ N  K
Sbjct: 186 AKNYLVQNVGLDKDNK------STHFASSLLAGLVATTVCSPADVIKTRVMNAHK 234

 Score = 47.0 bits (110), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 80/183 (43%), Gaps = 20/183 (10%)

Query: 128 FADIMLC----PFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183
           F  I+ C    P +  KV+ QT   P    ++    ++   EG+ G Y G+T    RQ  
Sbjct: 17  FGGIVACVATHPLDLAKVRLQTAPAP-KPTLVRMASQILRNEGVPGLYSGLTAAILRQCT 75

Query: 184 YTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSK 243
           YT  +F  ++ + E    R   K+   S L  +  S   G + G    ++ +PADV+  +
Sbjct: 76  YTTARFGVYDFVKE----RYIPKEYLNSMLYLLPCSMFSGAVGG----LIGNPADVVNIR 127

Query: 244 INNE-------RKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296
           + N+       R+  ++    L +I S  G   L+ G    ++    +TS Q + YD  K
Sbjct: 128 MQNDSSLPAELRRNYKNAADGLYKICSGEGVAKLFTGWQPNLVRGILMTSSQVVTYDIAK 187

Query: 297 AYV 299
            Y+
Sbjct: 188 NYL 190

 Score = 32.0 bits (71), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 222 GGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMI 281
           GG+  GI+  + +HP D+   ++        ++     +I    G  GL++GL   IL  
Sbjct: 15  GGF-GGIVACVATHPLDLAKVRLQTAPAPKPTLVRMASQILRNEGVPGLYSGLTAAILRQ 73

Query: 282 GTLTSFQWLIYDSFK 296
            T T+ ++ +YD  K
Sbjct: 74  CTYTTARFGVYDFVK 88

>CAGL0L02079g 243467..244360 highly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, hypothetical start
          Length = 297

 Score = 68.2 bits (165), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 66/293 (22%), Positives = 124/293 (42%), Gaps = 33/293 (11%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVT-PLDLIKCRLQVDPTLYRSNTSGII 59
           MSK    ++  TK + A    G +       +S+T P +  K RLQ+     +++ + ++
Sbjct: 1   MSKDSKKVDP-TKSFVAGALAGAV------EASITYPFEFAKTRLQLIDKSSKASRNPLV 53

Query: 60  QI---LKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTS 116
            I    K +G+G ++ G  A  +G + + A ++ GY+  +     +L+KD+ T       
Sbjct: 54  LIYNTAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIR-----NLLKDKKTGELSGPR 108

Query: 117 IYLLSSATAEFFADIMLCPFEAIKV----KQQTTMPPWCNN---VIEGWKKMYAKEGLNG 169
             L         + + + PFEAIK      +Q+  P + NN   +   +  +   EG  G
Sbjct: 109 GVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRG 168

Query: 170 FYKGITPLWCRQIPYTMCKFTSFERIVEAI--YARLPTKKSEMSALQQISVSFVGGYMAG 227
            Y G+ P+  RQ      +   + +I   +  Y   P  K   S L     +F+ G  +G
Sbjct: 169 LYGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGL-----TFIVGAFSG 223

Query: 228 ILCAIVSHPADVMVSKINN--ERKVNESMNVALKRIYSRIGFVGLWNGLPVRI 278
           ++    + P D + +++ +    K + ++N     IY   G    W G   R+
Sbjct: 224 VVTVYATMPIDTVKTRMQSLTASKYSSTLN-CFTTIYKEEGLKTFWKGATPRL 275

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 71/175 (40%), Gaps = 16/175 (9%)

Query: 33  SVTPLDLIKCRLQVDPTLYR--------SNTSGIIQILKKEGLGKLFTGVGATCIGYSLQ 84
           +VTP + IK  L  D    R        S     I ++K EG   L+ GV    +  +  
Sbjct: 124 AVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISLVKDEGFRGLYGGVLPVSMRQAAN 183

Query: 85  GAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIML---CPFEAIKV 141
            A + G Y   K      LV+D   A K +     L+     F   + +    P + +K 
Sbjct: 184 QAVRLGCYNKIK-----VLVQDYTGAPKDKPLTSGLTFIVGAFSGVVTVYATMPIDTVKT 238

Query: 142 KQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIV 196
           + Q+      ++ +  +  +Y +EGL  F+KG TP   R I      FT +E ++
Sbjct: 239 RMQSLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLGRLILSGGIVFTIYENVL 293

>CAGL0J09790g complement(957759..958661) highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1, start by
           similarity
          Length = 300

 Score = 68.2 bits (165), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 113/282 (40%), Gaps = 23/282 (8%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSN---TSGIIQILKKEGLGK----LFTGVG 75
           GI+  G  H    P+D I  RL  + T   S     S I +    E  GK    LF G+G
Sbjct: 21  GILEIGVFH----PVDTISKRLMSNHTKITSGAQLNSVIFRDHAAEAFGKRVFTLFPGLG 76

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF--FADIML 133
              +   LQ   KYGG        + H  KD  +A+  +T   L S+         +I+L
Sbjct: 77  YAAVYKILQRVYKYGGQPFANEFLNKHFKKDFDSAFGDKTGKALRSATAGSLIGIGEIVL 136

Query: 134 CPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
            P + +K+K+QT    +      G+ K+   EG+   Y+G      R  P +   F    
Sbjct: 137 LPLDVLKIKRQTNPEAFKG---RGFLKILKDEGIFNLYRGWGWTAARNAPGSFALFGGNA 193

Query: 194 RIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN-E 252
              E I   L  +    +   Q  +S + G  A +   IVS P DV+ ++I N    N E
Sbjct: 194 FAKEYI---LGLQDYSQATWSQNFISSIVGASASL---IVSAPLDVIKTRIQNRNFDNPE 247

Query: 253 SMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDS 294
           S    +K      GF   + GL  ++L  G    F + +  S
Sbjct: 248 SGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFALAQS 289

>ADL049W [1692] [Homologous to ScYPR021C - SH]
           complement(598135..600873) [2739 bp, 912 aa]
          Length = 912

 Score = 69.3 bits (168), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 126/295 (42%), Gaps = 25/295 (8%)

Query: 20  TLGGIVACGPTHSSVTPLDLIKCRLQV--DPTLYRSNTSGIIQILKKEGLGKLFTGVGAT 77
           TLG +  C      V P+D++K R+Q   D + Y+++   +++IL KEG+  L++G+G  
Sbjct: 529 TLGSVAGCIGA-MVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGPQ 587

Query: 78  CIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFE 137
            IG + + A K     +   + +T   +D     K      ++S ATA     +   P E
Sbjct: 588 LIGVAPEKAIKLT---VNDHMRATLAGRDG----KLSLPCEIISGATAGACQVVFTNPLE 640

Query: 138 AIKVKQQTTMPPWCN------NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
            +K++ Q       +      N I   K +    GL G Y+G      R IP++   F +
Sbjct: 641 IVKIRLQVKSDYVADAARNSVNAISVIKNL----GLIGLYRGAGACLLRDIPFSAIYFPT 696

Query: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN 251
           +  I   ++   P    + + L    +   GG +AG+  A ++ P DV+ +++  + K  
Sbjct: 697 YAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGG-LAGMPAAFLTTPFDVIKTRLQIDPKKG 755

Query: 252 ESMN----VALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLP 302
           ES+      A + I    G    + G P R+L       F    Y+ F      P
Sbjct: 756 ESVYNGIWDAARTILKEEGIKSFFKGGPARVLRSSPQFGFTLAAYEIFHNLFPAP 810

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 50/117 (42%), Gaps = 7/117 (5%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ----ILKKEGLGKLFTGVGA 76
           + G +A  P     TP D+IK RLQ+DP    S  +GI      ILK+EG+   F G  A
Sbjct: 725 VSGGLAGMPAAFLTTPFDVIKTRLQIDPKKGESVYNGIWDAARTILKEEGIKSFFKGGPA 784

Query: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL---SSATAEFFAD 130
             +  S Q       YE+F  L+      D  T    R  +  L   +   + FF D
Sbjct: 785 RVLRSSPQFGFTLAAYEIFHNLFPAPRYDDSTTHRPTREPVGALAPINKTVSAFFPD 841

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 219 SFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNV--ALKRIYSRIGFVGLWNGLPV 276
           +F  G +AG + A+V +P D++ +++  +R  ++  N    L +I S+ G  GL++GL  
Sbjct: 527 NFTLGSVAGCIGAMVVYPIDMVKTRMQAQRDFSKYKNSIDCLLKILSKEGVRGLYSGLGP 586

Query: 277 RILMIGTLTSFQWLIYDSFKA 297
           +++ +    + +  + D  +A
Sbjct: 587 QLIGVAPEKAIKLTVNDHMRA 607

>YKR052C (MRS4) [3303] chr11 complement(532192..533106) Member of
           the mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses defects in
           splicing of mitochondrial introns [915 bp, 304 aa]
          Length = 304

 Score = 67.4 bits (163), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 126/295 (42%), Gaps = 37/295 (12%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK----EGLGKLFTGVGA 76
           L G  A    HS + P+D +K R+Q    L ++ ++G+I  + K    EG   L+ GV +
Sbjct: 28  LAGAFAGIMEHSLMFPIDALKTRVQA-AGLNKAASTGMISQISKISTMEGSMALWKGVQS 86

Query: 77  TCIGYSLQGAGKYGGYELFK-RLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
             +G     A  +G YE  K RL S    +D  T    +T+   LS   A   AD ++ P
Sbjct: 87  VILGAGPAHAVYFGTYEFCKARLISP---EDMQTHQPMKTA---LSGTIATIAADALMNP 140

Query: 136 FEAIKVKQQ--TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
           F+ +K + Q  T +  W  NV    K++Y  EG   FY          IP+    F  +E
Sbjct: 141 FDTVKQRLQLDTNLRVW--NVT---KQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYE 195

Query: 194 RIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVM--VSKINNERKVN 251
                  ++    ++  + L    +  + G ++G  CA ++ P D +  V ++     V+
Sbjct: 196 SA-----SKFFNPQNSYNPL----IHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVS 246

Query: 252 -------ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
                   +   A + I    G+ G W GL  RI+     T+  W  Y+  K ++
Sbjct: 247 IEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFL 301

>YBR291C (CTP1) [469] chr2 complement(783631..784530) Mitochondrial
           inner membrane citrate transport protein, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [900 bp, 299 aa]
          Length = 299

 Score = 67.0 bits (162), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/259 (23%), Positives = 112/259 (43%), Gaps = 29/259 (11%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQI---LKKEGLGKLFTGVGATCIGYSLQGAGKYGGY 92
           P +  K RLQ+     +++ + ++ I    K +G+G ++ G  A  IG + +   ++ G+
Sbjct: 32  PFEFAKTRLQLIDKASKASRNPLVLIYKTAKTQGIGSIYVGCPAFIIGNTAKAGIRFLGF 91

Query: 93  ELFKRLYSTHLVKDEATA--YKYRTSIYLLSSATAEFFADIMLCPFEAIKV----KQQTT 146
           +  K      +++D  T      R  I  L +   E  A +   PFEAIK      +Q+ 
Sbjct: 92  DTIK-----DMLRDSETGELSGTRGVIAGLGAGLLESVAAV--TPFEAIKTALIDDKQSA 144

Query: 147 MPPWCNN---VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI--YA 201
            P + NN   V+  +  +   +G +G Y+G+ P+  RQ      +   + +I   I  Y 
Sbjct: 145 TPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAANQAVRLGCYNKIKTLIQDYT 204

Query: 202 RLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKIN--NERKVNESMNVALK 259
             P  K   S L     +F+ G  +GI+    + P D + +++   +  K + +MN    
Sbjct: 205 DSPKDKPLSSGL-----TFLVGAFSGIVTVYSTMPLDTVKTRMQSLDSTKYSSTMN-CFA 258

Query: 260 RIYSRIGFVGLWNGLPVRI 278
            I+   G    W G   R+
Sbjct: 259 TIFKEEGLKTFWKGATPRL 277

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 10/173 (5%)

Query: 32  SSVTPLDLIKCRLQVDPTL----YRSNTSGIIQ----ILKKEGLGKLFTGVGATCIGYSL 83
           ++VTP + IK  L  D       Y +N  G+++    +++ +G   L+ GV    +  + 
Sbjct: 125 AAVTPFEAIKTALIDDKQSATPKYHNNGRGVVRNYSSLVRDKGFSGLYRGVLPVSMRQAA 184

Query: 84  QGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQ 143
             A + G Y   K L   +   D        + +  L  A +         P + +K + 
Sbjct: 185 NQAVRLGCYNKIKTLIQDY--TDSPKDKPLSSGLTFLVGAFSGIVTVYSTMPLDTVKTRM 242

Query: 144 QTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIV 196
           Q+      ++ +  +  ++ +EGL  F+KG TP   R +      FT +E+++
Sbjct: 243 QSLDSTKYSSTMNCFATIFKEEGLKTFWKGATPRLGRLVLSGGIVFTIYEKVL 295

>Kwal_47.17321
          Length = 881

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 128/297 (43%), Gaps = 27/297 (9%)

Query: 21  LGGIVAC-GPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLGKLFTGVGAT 77
           LG +  C G T  +V P+DL+K R+Q       Y+++    ++I  +EG+  +++G+G  
Sbjct: 506 LGSVAGCIGAT--AVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGLGPQ 563

Query: 78  CIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFE 137
            +G + + A K    +     Y   L+ DE    +    + ++S A A     I   P E
Sbjct: 564 LVGVAPEKAIKLTVND-----YVRKLLMDENN--RLTLPLEIISGAAAGACQVIFTNPLE 616

Query: 138 AIKVKQQ------TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
            +K++ Q       ++P      +   K +    GL G YKG+     R +P++   F +
Sbjct: 617 IVKIRLQVRSEYADSLPKSQLTALGVVKSL----GLRGLYKGLVACLMRDVPFSAIYFPT 672

Query: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN 251
           +  +   I+   P  K++ + L    +   GG +AG+  A ++ P DV+ +++  + +  
Sbjct: 673 YAHLKRDIFNYDPQDKNKRARLHTWELLTAGG-LAGMPAAYLTTPFDVIKTRLQIDPRKG 731

Query: 252 ESMNV----ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLPTS 304
           E+       A + I     F   + G   R+L       F    Y+ F+    L  S
Sbjct: 732 ETRYTGILHAARTILKEERFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNMFPLQHS 788

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 8/94 (8%)

Query: 10  LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ----ILKKE 65
           L+T E   A  L G+ A   T    TP D+IK RLQ+DP    +  +GI+     ILK+E
Sbjct: 694 LHTWELLTAGGLAGMPAAYLT----TPFDVIKTRLQIDPRKGETRYTGILHAARTILKEE 749

Query: 66  GLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLY 99
                F G GA  +  S Q       YE+F+ ++
Sbjct: 750 RFKSFFKGGGARVLRSSPQFGFTLAAYEIFQNMF 783

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 219 SFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNV--ALKRIYSRIGFVGLWNGL 274
           +F+ G +AG + A   +P D++ +++  +R  ++  N      +I+SR G  G+++GL
Sbjct: 503 NFLLGSVAGCIGATAVYPIDLVKTRMQAQRNFSQYKNSIDCFVKIFSREGIRGIYSGL 560

>Sklu_2359.6 YPR021C, Contig c2359 14617-17325
          Length = 902

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/288 (22%), Positives = 127/288 (44%), Gaps = 23/288 (7%)

Query: 20  TLGGIVAC-GPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLGKLFTGVGA 76
           TLG I  C G T   V P+DL+K R+Q   +   Y+++     +I  +EG+  +++G+G 
Sbjct: 523 TLGSIAGCIGAT--VVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGLGP 580

Query: 77  TCIGYSLQGAGKYGGYELFK-RLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
             IG + + A K    +  + RL   H           +    +LS A A     +   P
Sbjct: 581 QLIGVAPEKAIKLTVNDYMRGRLMDKHA--------NLKWYFEILSGACAGACQVVFTNP 632

Query: 136 FEAIKVKQQTTMPPWCNNVIEGWKK---MYAKEGLNGFYKGITPLWCRQIPYTMCKFTSF 192
            E +K++ Q     +  +V++       +  + G+ G YKGI     R +P++   F ++
Sbjct: 633 LEVVKIRLQVR-SEYAGDVLKSQVTALGVIKQLGIKGLYKGIAACLMRDVPFSAIYFPTY 691

Query: 193 ERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNE 252
             + + ++   P  K + + L+   +   GG +AG+  A ++ P DV+ +++  + +  E
Sbjct: 692 AHLKKDVFKYDPKDKKQRNKLKTWELLVAGG-LAGMPAAYLTTPFDVIKTRLQIDPRKGE 750

Query: 253 S----MNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296
           +    +  A + I     F   + G   R+L       F    Y+ F+
Sbjct: 751 TRYEGIFHAARTILKEESFKSFFKGGSARVLRSSPQFGFTLAAYEIFQ 798

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 52/111 (46%), Gaps = 7/111 (6%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ----ILKKEGLGKLFTGVGA 76
           + G +A  P     TP D+IK RLQ+DP    +   GI      ILK+E     F G  A
Sbjct: 719 VAGGLAGMPAAYLTTPFDVIKTRLQIDPRKGETRYEGIFHAARTILKEESFKSFFKGGSA 778

Query: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF 127
             +  S Q       YE+F+ ++   L ++E+T  K  T   + SS TA F
Sbjct: 779 RVLRSSPQFGFTLAAYEIFQNMFP--LKREESTFTKDDTPA-VTSSFTAFF 826

 Score = 32.0 bits (71), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 219 SFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNV--ALKRIYSRIGFVGLWNGL 274
           +F  G +AG + A V +P D++ +++  +R  ++  N      +I+SR G  G+++GL
Sbjct: 521 NFTLGSIAGCIGATVVYPIDLVKTRMQAQRSFSQYKNSIDCFAKIFSREGIRGIYSGL 578

>Scas_582.7
          Length = 329

 Score = 67.0 bits (162), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 120/296 (40%), Gaps = 35/296 (11%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPT--LYRSNTSGIIQILK---KEGLGKLFTGVG 75
           L G  A    HS++ P+D +K R+Q   T    +++TS I QI K    EG   L+ GV 
Sbjct: 41  LAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGVQ 100

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
           +  +G     A  +  YE  K     HL+ D          +  +S ATA   +D  + P
Sbjct: 101 SVILGAGPAHAVYFATYEFTK----AHLIPDSQRETHQPIKV-AVSGATATVASDFFMNP 155

Query: 136 FEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE-- 193
           F+ IK + Q +       V    KK+Y  EGL+ FY          IP+    F  +E  
Sbjct: 156 FDTIKQRMQIS-DLKKEKVYNVAKKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYESA 214

Query: 194 -RIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNE 252
            +    ++   P             +  + G ++G + A V+ P D + + I        
Sbjct: 215 SKFFNPLHHYNPL------------IHCLCGGISGAIAAAVTTPLDCIKTVIQIRGSSVV 262

Query: 253 SMNV-----ALKRIYSRI----GFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           S+ V       K+  S I    G+ G W GL  RIL     T+  W  Y+  K ++
Sbjct: 263 SLEVMKKANTFKKATSAILMVYGWKGFWRGLQPRILANMPATAISWTAYECAKHFL 318

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 77/181 (42%), Gaps = 12/181 (6%)

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTM----PPWCNNVIEGWKKMYAKEGLNGFYKGI 174
           LL+ A A       + P +A+K + Q+T          ++I+   K+   EG    +KG+
Sbjct: 40  LLAGAFAGIMEHSTMFPIDALKTRIQSTTTKGTEQTSTSIIKQISKISTMEGSLALWKGV 99

Query: 175 TPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVS 234
             +     P     F ++E     +   +P  + E    Q I V+ V G  A +      
Sbjct: 100 QSVILGAGPAHAVYFATYEFTKAHL---IPDSQRETH--QPIKVA-VSGATATVASDFFM 153

Query: 235 HPADVMVSKIN-NERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293
           +P D +  ++  ++ K  +  NVA K+IY+  G    +   P  I M     +F ++IY+
Sbjct: 154 NPFDTIKQRMQISDLKKEKVYNVA-KKIYNLEGLSAFYYSYPTTIAMNIPFAAFNFMIYE 212

Query: 294 S 294
           S
Sbjct: 213 S 213

>YOR222W (ODC2) [5014] chr15 (758330..759253) 2-Oxodicarboxylate
           transporter, specific for 2-oxoadipate and
           2-oxoglutarate, member of the mitochondrial carrier
           family (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 66.6 bits (161), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 125/290 (43%), Gaps = 31/290 (10%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTL------------YRSNTSGIIQILKKEGLG 68
           + G VA     + + PLD++K R Q++ T             Y      + +I+KKEG  
Sbjct: 17  ISGAVAGISELTVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFS 76

Query: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFF 128
           +L+ G+ +  +  + + A K+   + +++++      +E T       I + + A+A   
Sbjct: 77  RLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETT-----QKISIAAGASAGMT 131

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
              ++ PFE IK++ Q     +    ++  KK    EG+ G YKGI     R   +    
Sbjct: 132 EAAVIVPFELIKIRMQDVKSSYLGP-MDCLKKTIKNEGIMGLYKGIESTMWRNALWNGGY 190

Query: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248
           F     ++  +   +P  K++    Q+     + G + G +  +++ P DV+ S+I +  
Sbjct: 191 FG----VIYQVRNSMPVAKTKG---QKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVD 243

Query: 249 KVNESMNV------ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIY 292
            V+ ++        +L  IY   GF  L+ G   ++  +    S   +++
Sbjct: 244 AVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCRLAPGGSLMLVVF 293

 Score = 47.4 bits (111), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 72/181 (39%), Gaps = 18/181 (9%)

Query: 12  TKEYYAACTLGGIVACGPTHSSV-TPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKL 70
           T E     ++    + G T ++V  P +LIK R+Q   + Y      + + +K EG+  L
Sbjct: 113 TNETTQKISIAAGASAGMTEAAVIVPFELIKIRMQDVKSSYLGPMDCLKKTIKNEGIMGL 172

Query: 71  FTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFAD 130
           + G+ +T    +L   G +G       +Y        A     +T   L++ A       
Sbjct: 173 YKGIESTMWRNALWNGGYFG------VIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGT 226

Query: 131 IMLCPFEAIKVKQQTTMP--------PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQI 182
           ++  PF+ +K + Q+            WC   +     +Y +EG    YKG  P  CR  
Sbjct: 227 MLNTPFDVVKSRIQSVDAVSSAVKKYNWC---LPSLLVIYREEGFRALYKGFVPKVCRLA 283

Query: 183 P 183
           P
Sbjct: 284 P 284

>ACR109W [1156] [Homologous to ScYOR222W (ODC2) - SH; ScYPL134C
           (ODC1) - SH] complement(546745..547644) [900 bp, 299 aa]
          Length = 299

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 119/259 (45%), Gaps = 26/259 (10%)

Query: 36  PLDLIKCRLQVDPTLYRS-NTSGIIQILKK----EGLGKLFTGVGATCIGYSLQGAGKYG 90
           PLD++K R+Q+        + +G++  LKK    EG+G+L+ G+ +  +  + + A K+ 
Sbjct: 31  PLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGISSPILMEAPKRATKFA 90

Query: 91  GYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPW 150
             + F++LY     K      K    + +L+ A+A      ++ PFE +K++ Q     +
Sbjct: 91  CNDEFQKLY-----KQAFGVEKLSQPLSMLAGASAGCVEAFVVVPFELVKIRLQDASSSY 145

Query: 151 CNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEM 210
               ++  +K+ A+EG+   Y G+     R   +    F     I+    A LP   ++ 
Sbjct: 146 -KGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFG----IIFQARALLPAAHNKT 200

Query: 211 SALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNE-------RKVNESMNVALKRIYS 263
              Q I+   +   +   +  ++S P DV+ S+I N        RK N S+  +L  IY 
Sbjct: 201 ---QCITNDLISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVVRKYNWSLP-SLLTIYR 256

Query: 264 RIGFVGLWNGLPVRILMIG 282
             GF  L+ G   ++L +G
Sbjct: 257 EEGFRALYKGFVPKVLRLG 275

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/160 (21%), Positives = 71/160 (44%), Gaps = 10/160 (6%)

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMP----PWCNNVIEGWKKMYAKEGLNGFYKGI 174
             + A A     +++ P + +K + Q  +     P    V++  KK+ A EG+   YKGI
Sbjct: 15  FFAGAVAGVSEILVMYPLDVVKTRMQLQVQGGAGPHYTGVVDCLKKIVAGEGVGRLYKGI 74

Query: 175 TPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVS 234
           +     + P    KF   +      + +L  +   +  L Q  +S + G  AG + A V 
Sbjct: 75  SSPILMEAPKRATKFACNDE-----FQKLYKQAFGVEKLSQ-PLSMLAGASAGCVEAFVV 128

Query: 235 HPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
            P +++  ++ +     +     +++I +R G + ++NGL
Sbjct: 129 VPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGL 168

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 65/155 (41%), Gaps = 11/155 (7%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           V P +L+K RLQ   + Y+     + +I+ +EG+  ++ G+ +T   ++L   G +G   
Sbjct: 128 VVPFELVKIRLQDASSSYKGPVDVVRKIVAREGVLAMYNGLESTLWRHALWNGGYFGIIF 187

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVK-QQTTMPPWC- 151
             + L      K +           L+S +       ++  PF+ +K + Q T + P   
Sbjct: 188 QARALLPAAHNKTQCITND------LISDSIGCSIGCMLSTPFDVVKSRIQNTAVIPGVV 241

Query: 152 ---NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183
              N  +     +Y +EG    YKG  P   R  P
Sbjct: 242 RKYNWSLPSLLTIYREEGFRALYKGFVPKVLRLGP 276

>YJR095W (SFC1) [2987] chr10 (609690..610658) Mitochondrial membrane
           succinate-fumarate transporter, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [969 bp, 322 aa]
          Length = 322

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/290 (21%), Positives = 122/290 (42%), Gaps = 41/290 (14%)

Query: 36  PLDLIKCRLQVDPTLYRS-------NTSGIIQ----ILKKEGLGKLFTGVGATCIGYSLQ 84
           PLD IK R+Q+    YR           G I+    I +KEG   L+ G+GA  IG   +
Sbjct: 30  PLDTIKVRMQI----YRRVAGIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPK 85

Query: 85  GAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ 144
            A ++  YE ++ L      K+        T +  + +   E  A +++ P E +K++ Q
Sbjct: 86  MAIRFSSYEFYRTLLVN---KESGIVSTGNTFVAGVGAGITE--AVLVVNPMEVVKIRLQ 140

Query: 145 T--------TMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIV 196
                       P  NN I     +  +EG++  Y+G++    RQ       FT + ++ 
Sbjct: 141 AQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATNQGANFTVYSKLK 200

Query: 197 EAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNV 256
           E +         +M  L     S + G ++G +    + P D + +++  ++ ++     
Sbjct: 201 EFL-----QNYHQMDVLPSWETSCI-GLISGAIGPFSNAPLDTIKTRLQKDKSISLEKQS 254

Query: 257 ALKRIYS-------RIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
            +K+I +         GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 255 GMKKIITIGAQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEYVREHL 304

 Score = 34.7 bits (78), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 9/56 (16%)

Query: 26  ACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGI-------IQILKKEGLGKLFTGV 74
           A GP   S  PLD IK RLQ D ++     SG+        Q+LK+EG   L+ G+
Sbjct: 226 AIGPF--SNAPLDTIKTRLQKDKSISLEKQSGMKKIITIGAQLLKEEGFRALYKGI 279

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/87 (21%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 217 SVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVAL-------KRIYSRIGFVG 269
           +++ + G  AG+  A+  HP D +  ++   R+V    +V         + IY + GF+ 
Sbjct: 11  AINLMAGGTAGLFEALCCHPLDTIKVRMQIYRRVAGIEHVKPPGFIKTGRTIYQKEGFLA 70

Query: 270 LWNGLPVRILMIGTLTSFQWLIYDSFK 296
           L+ GL   ++ I    + ++  Y+ ++
Sbjct: 71  LYKGLGAVVIGIIPKMAIRFSSYEFYR 97

>CAGL0K08250g complement(820185..821078) highly similar to sp|P23500
           Saccharomyces cerevisiae YKR052c Mitochondrial RNA
           splicing protein, hypothetical start
          Length = 297

 Score = 65.1 bits (157), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 120/294 (40%), Gaps = 36/294 (12%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK----EGLGKLFTGVGA 76
           L G  A    HS + P+D IK R+Q   +   + T G+I+ + K    EG   L+ GV +
Sbjct: 21  LAGAFAGIMEHSVLFPVDAIKTRIQSSSS--GAATQGLIKQISKITTAEGSLALWKGVQS 78

Query: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLV--KDEATAYKYRTSIYLLSSATAEFFADIMLC 134
             +G     A  +  YE  K    + L+  +D  T    +T+I  +++ T    AD ++ 
Sbjct: 79  VILGAGPAHAVYFATYEFSK----SKLIDPQDMHTHQPIKTAISGMAATTV---ADALMN 131

Query: 135 PFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194
           PF+ IK + Q        +V    K +Y KEG   FY          IP+    F  +E 
Sbjct: 132 PFDVIKQRMQLNTR---ESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYES 188

Query: 195 IVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS--------KINN 246
                     TK    S      +  + G ++G  CA ++ P D + +         ++N
Sbjct: 189 A---------TKFMNPSNEYNPFIHCISGGLSGATCAAITTPLDCIKTVLQVRGSETVSN 239

Query: 247 E-RKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           E  K   +   A   IY   G+ G   GL  R++     T+  W  Y+  K ++
Sbjct: 240 EIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAISWTSYECAKHFL 293

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/177 (22%), Positives = 73/177 (41%), Gaps = 9/177 (5%)

Query: 119 LLSSATAEFFADIMLCPFEAIKVK-QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPL 177
           LL+ A A      +L P +AIK + Q ++       +I+   K+   EG    +KG+  +
Sbjct: 20  LLAGAFAGIMEHSVLFPVDAIKTRIQSSSSGAATQGLIKQISKITTAEGSLALWKGVQSV 79

Query: 178 WCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237
                P     F ++E     +         +M   Q I  + + G  A  +   + +P 
Sbjct: 80  ILGAGPAHAVYFATYEFSKSKL-----IDPQDMHTHQPIKTA-ISGMAATTVADALMNPF 133

Query: 238 DVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDS 294
           DV+  ++  +    ES+    K IY + GF   +   P  ++M     +F + IY+S
Sbjct: 134 DVIKQRM--QLNTRESVWHVTKNIYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYES 188

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 41/201 (20%), Positives = 75/201 (37%), Gaps = 21/201 (10%)

Query: 2   SKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ- 60
           SK   P +++T +      + G+ A     + + P D+IK R+Q++    R +   + + 
Sbjct: 99  SKLIDPQDMHTHQPIKTA-ISGMAATTVADALMNPFDVIKQRMQLNT---RESVWHVTKN 154

Query: 61  ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL 120
           I  KEG    +     T +      A  +  YE   +  +         + +Y   I+ +
Sbjct: 155 IYHKEGFAAFYYSYPTTLVMNIPFAAFNFAIYESATKFMNP--------SNEYNPFIHCI 206

Query: 121 SSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVI--------EGWKKMYAKEGLNGFYK 172
           S   +      +  P + IK   Q       +N I             +Y   G  GF +
Sbjct: 207 SGGLSGATCAAITTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLR 266

Query: 173 GITPLWCRQIPYTMCKFTSFE 193
           G+ P     +P T   +TS+E
Sbjct: 267 GLKPRVIANMPATAISWTSYE 287

>Kwal_23.4731
          Length = 314

 Score = 64.7 bits (156), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 132/306 (43%), Gaps = 36/306 (11%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQ--VDPTL---YRSNTSGIIQILKKEG--LGKLFTG 73
           + G+ A   T  +  PLDL+K RLQ  V+ T    Y+     II+  K +     + + G
Sbjct: 18  IAGLAAGTLTTIATHPLDLVKLRLQLLVNTTHSHGYKEVIKTIIRDSKADSNVFREAYRG 77

Query: 74  VGATCIGYSLQGAGKYGGYELFKRLY------------STHLVKDEATAYKYRTSIYLLS 121
           +G   IG S+     +G Y   K +              +   KD+A       S+YL S
Sbjct: 78  LGVNLIGNSIAWGLYFGLYRFTKDMVYRYGVAQMKTPTQSSFQKDKAMG----PSLYLAS 133

Query: 122 SATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGW---KKMYAKEGLNGFYKGITPLW 178
           +A +     I+  P   IK +  +T           W   +K+YA EG +GF++G+ P  
Sbjct: 134 AALSGLGTAILTNPIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGFWRGLVPS- 192

Query: 179 CRQIPYTMCKFTSFERIVEAIYARLP-TKKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237
              +      FT ++ +    +AR   T+  +M  L+ I+++ V    + +L     +P 
Sbjct: 193 LFGVAQGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAITSV----SKMLSVTAVYPF 248

Query: 238 DVMVSKINN----ERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293
            ++ S + +    E++ +      +K I+ + G  GL+ GL   +L     T   + IY+
Sbjct: 249 QLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPSTCITFCIYE 308

Query: 294 SFKAYV 299
           + + ++
Sbjct: 309 NLRHWL 314

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 81/190 (42%), Gaps = 18/190 (9%)

Query: 15  YYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPT----LYRSNTSGIIQILKKEGLGKL 70
           Y A+  L G+     T+    P+ +IK R+    +     Y++   GI ++   EG    
Sbjct: 130 YLASAALSGLGTAILTN----PIWVIKTRIMSTSSQASERYKTTWDGIRKVYAHEGFSGF 185

Query: 71  FTGVGATCIGYSLQGAGKYGGYELFKRLYSTH--LVKDEATAYKYRTSIYLLSSATAEFF 128
           + G+  +  G + QGA  +  Y+  +  Y     + +DE        +I    ++ ++  
Sbjct: 186 WRGLVPSLFGVA-QGAIYFTIYDSLRHQYFARRGITEDEKMGNLENIAI----TSVSKML 240

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCNNVIEGW---KKMYAKEGLNGFYKGITPLWCRQIPYT 185
           +   + PF+ +K   Q+       +    W   K ++ KEGL G YKG++    R IP T
Sbjct: 241 SVTAVYPFQLLKSNLQSFAAVEKRDSYRFWNLVKSIHQKEGLQGLYKGLSANLLRAIPST 300

Query: 186 MCKFTSFERI 195
              F  +E +
Sbjct: 301 CITFCIYENL 310

>Scas_489.4
          Length = 297

 Score = 63.9 bits (154), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 66/316 (20%), Positives = 133/316 (42%), Gaps = 35/316 (11%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQ-VDPTLYRSNTSGII 59
           MS+ K P++      + A  L G +    T+    P +  K RLQ +D T   S    ++
Sbjct: 1   MSQEKKPVDPL--HSFIAGALAGAIEASITY----PFEFAKTRLQLIDKTSTASRNPLVL 54

Query: 60  --QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATA--YKYRT 115
                K +G G ++ G  A  +G + +   ++ G++  K     ++++D  T      R 
Sbjct: 55  IYNTAKTQGTGAIYVGCPAFIVGNTAKAGIRFLGFDTIK-----NMLRDPVTGELSGPRG 109

Query: 116 SIYLLSSATAEFFADIMLCPFEAIKV----KQQTTMPPWCNN---VIEGWKKMYAKEGLN 168
            +  L +   E  + + + PFEAIK      +Q   P + NN   ++  +  +   +G+ 
Sbjct: 110 VVAGLGAGLLE--SVVAVTPFEAIKTALIDDKQALKPKYQNNGRGMLRNYGSLVRDQGIM 167

Query: 169 GFYKGITPLWCRQIPYTMCKFTSFERIVEAI--YARLPTKKSEMSALQQISVSFVGGYMA 226
           G Y+G+ P+  RQ      +   + +I   +  Y   P  +   S L     +F+ G  +
Sbjct: 168 GLYRGVLPVSMRQAANQAVRLGCYNKIKTMVQDYTNAPKDRPLSSGL-----TFIVGAFS 222

Query: 227 GILCAIVSHPADVMVSKIN--NERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTL 284
           G++    + P D + +++   +  K   ++N    +I+   G    W G   R+  +   
Sbjct: 223 GVVTVYTTMPIDTVKTRMQSLDATKYTSTVN-CFAKIFKEEGLKTFWKGATPRLGRLILS 281

Query: 285 TSFQWLIYDSFKAYVG 300
               + IY++   ++G
Sbjct: 282 GGIVFTIYENVLVFLG 297

>KLLA0B11319g 988293..989360 similar to sgd|S0006332 Saccharomyces
           cerevisiae YPR128c, start by similarity
          Length = 355

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 105/230 (45%), Gaps = 11/230 (4%)

Query: 51  YRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLY-STHLVKDEAT 109
           Y+     I+++ + EG G L+ G+ A+ +G  +Q    +  Y L +R Y     VK EA 
Sbjct: 87  YKHALDVIVKVYRNEGFGGLYHGLSASLLGTFIQSFSYFFWYTLIRRHYFRVKKVKGEAA 146

Query: 110 AYKYRTSIYL--LSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEG-WKKMYAKEG 166
            +     + L  L++AT++ F +    P   +  KQQT      +N  +   K++Y ++G
Sbjct: 147 RFSTIEELLLSMLAAATSQLFTN----PINIVSTKQQTRRGLEGDNSFKAIAKEVYDEDG 202

Query: 167 LNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIY-ARLPTKKSEMSALQ-QISVSFVGGY 224
           + GF+K +       I  ++  + S E++ + +Y      K    S+LQ +   +F+ G 
Sbjct: 203 ITGFWKSLKVSLVLTINPSIT-YASAEKLKDILYHVEWNAKDLNDSSLQLKPGQNFLIGV 261

Query: 225 MAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
           ++ I+   ++HP  V  + +        S    L  +Y   G   LW GL
Sbjct: 262 LSKIISTCLTHPLIVAKASLQRSSSKFTSFQEVLTYLYRHEGAHALWKGL 311

>Sklu_2334.2 YJR095W, Contig c2334 6303-7262 reverse complement
          Length = 319

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/285 (21%), Positives = 119/285 (41%), Gaps = 35/285 (12%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGII---------QILKKEGLGKLFTGVGATCIGYSLQGA 86
           PLD IK R+Q+     RS   GI           I  +EGL  L+ G+GA  IG   + A
Sbjct: 30  PLDTIKVRMQI---YRRSALEGIKPPGFIKTGRNIYTEEGLLALYKGLGAVVIGIIPKMA 86

Query: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ-- 144
            ++  YE ++   +     D+ T      + +L         A +++ P E +K++ Q  
Sbjct: 87  IRFSSYEFYRSALA-----DKQTGSVSTGNTFLAGVGAGTTEAVLVVNPMEVVKIRLQAQ 141

Query: 145 -----TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
                T   P   N ++    +  +EG+   Y+G++    RQ       FT + ++ E +
Sbjct: 142 HLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQGANFTVYSKLKEFL 201

Query: 200 YARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNE----SMN 255
                T      AL     S + G ++G +    + P D + +++  ++        S  
Sbjct: 202 QEHHKT-----DALPSWETSCI-GLISGAIGPFSNAPLDTIKTRLQKDKSTANMSGWSRI 255

Query: 256 VAL-KRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           V + K++    GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 256 VTIGKQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHL 300

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 73/179 (40%), Gaps = 19/179 (10%)

Query: 34  VTPLDLIKCRLQVD--------PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQG 85
           V P++++K RLQ             YR+       I+K+EG+G L+ GV  T    +   
Sbjct: 128 VNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGVSLTAARQATNQ 187

Query: 86  AGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ- 144
              +  Y   K     H   D   +++  + I L+S A   F       P + IK + Q 
Sbjct: 188 GANFTVYSKLKEFLQEHHKTDALPSWET-SCIGLISGAIGPFSN----APLDTIKTRLQK 242

Query: 145 ----TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
                 M  W   V  G K++  +EG    YKGITP   R  P     FT +E + E +
Sbjct: 243 DKSTANMSGWSRIVTIG-KQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVREHL 300

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 83/205 (40%), Gaps = 35/205 (17%)

Query: 116 SIYLLSSATAEFFADIMLCPFEAIKVKQQT--------TMPPWCNNVIEGWKKMYAKEGL 167
           ++ L++  TA  F  +   P + IKV+ Q           PP     I+  + +Y +EGL
Sbjct: 11  AVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRSALEGIKPP---GFIKTGRNIYTEEGL 67

Query: 168 NGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVS----FVGG 223
              YKG+  +    IP    +F+S+E      Y      +S ++  Q  SVS    F+ G
Sbjct: 68  LALYKGLGAVVIGIIPKMAIRFSSYE-----FY------RSALADKQTGSVSTGNTFLAG 116

Query: 224 YMAGILCAI-VSHPADVM-----VSKINNERKVNESMNVALKRIY---SRIGFVGLWNGL 274
             AG   A+ V +P +V+        ++ E   +     AL+  Y      G   L+ G+
Sbjct: 117 VGAGTTEAVLVVNPMEVVKIRLQAQHLHPETAASPRYRNALQACYLIVKEEGIGALYRGV 176

Query: 275 PVRILMIGTLTSFQWLIYDSFKAYV 299
            +      T     + +Y   K ++
Sbjct: 177 SLTAARQATNQGANFTVYSKLKEFL 201

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 11/56 (19%)

Query: 26  ACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSG---II----QILKKEGLGKLFTGV 74
           A GP   S  PLD IK RLQ D +   +N SG   I+    Q++K+EG   L+ G+
Sbjct: 224 AIGPF--SNAPLDTIKTRLQKDKST--ANMSGWSRIVTIGKQLIKEEGFRALYKGI 275

>Kwal_23.2913
          Length = 320

 Score = 63.2 bits (152), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 70/278 (25%), Positives = 124/278 (44%), Gaps = 34/278 (12%)

Query: 14  EYYAACTLGGIVACGPTHSSVTPLDLIKCRLQ----------VDPTLYRSNT-SGIIQIL 62
           E  AA  +GG+ A    H    P DL+K R Q          +   L+ + + SG + + 
Sbjct: 30  ESLAAGGVGGVCAVLTGH----PFDLLKVRCQSNQASGTLDAISRVLHEAKSKSGPLPLN 85

Query: 63  KKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRL--YSTHLVKDEATAYKYRTSIYLL 120
           + +G    + GV    +G +   A  + GY++ KRL  + ++ V D A +    T +   
Sbjct: 86  QIKGF---YRGVIPPLLGVTPIFAVSFWGYDVGKRLVTWGSNPVTDIAGSSSKLTPLTTS 142

Query: 121 SSATAEFFADI----MLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITP 176
             A A FF+ I    +  P E +KV  QT+      + +   + +  + G+   ++G   
Sbjct: 143 QLALAGFFSAIPTTLITAPTERVKVVLQTSE---SGSFLGAARTLIREGGVRSLFQGTLA 199

Query: 177 LWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHP 236
              R  P +   F S+E     +  R  ++  +  AL  +S+   GG +AG+   I   P
Sbjct: 200 TLARDGPGSALYFASYE-----VSKRFLSRNQDTDALSVVSICVAGG-VAGMSMWIGVFP 253

Query: 237 ADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
            D + +K+ +  + ++SM  A + IY+R G  G + GL
Sbjct: 254 IDTIKTKLQSSSR-SQSMVQAAREIYTRAGLRGFFPGL 290

>Kwal_26.7967
          Length = 297

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 126/291 (43%), Gaps = 30/291 (10%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQV---DPTLYRSNTSG 57
           MS+ K    L++   + A +L G V    T+    P +  K RLQ+     T  R+  + 
Sbjct: 1   MSQKKQVDPLHS---FLAGSLAGAVEASITY----PFEFAKTRLQLVDKSSTASRNPLTL 53

Query: 58  IIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSI 117
           I +  K +GLG ++ G  A  +G + +   ++ G++  K     ++++D  T        
Sbjct: 54  IYRTAKVQGLGAVYVGCPAFIVGNTAKAGVRFLGFDAIK-----NILRDPTTGELSGPRG 108

Query: 118 YLLSSATAEFFADIMLCPFEAIKV----KQQTTMPPWCNN---VIEGWKKMYAKEGLNGF 170
            +         + + + PFEAIK      +Q+  P + NN   ++  +  +   +G +G 
Sbjct: 109 IVAGLGAGLLESVVAVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGL 168

Query: 171 YKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSE-MSALQQISVSFVGGYMAGIL 229
           Y+G+ P+  RQ      +   + +I   I     + K + +S+     ++FV G  +GI+
Sbjct: 169 YRGVLPVSMRQAANQAVRLGCYNKIKTMIQDYTNSAKDKPLSS----GMTFVVGAFSGIV 224

Query: 230 CAIVSHPADVMVSKIN--NERKVNESMNVALKRIYSRIGFVGLWNGLPVRI 278
               + P D + +++   +  K + ++N     ++   G    W G   R+
Sbjct: 225 TVYTTMPIDTVKTRMQSLDSSKYSSTIN-CFATVFREEGLKTFWKGATPRL 274

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 75/174 (43%), Gaps = 14/174 (8%)

Query: 33  SVTPLDLIKCRL----QVDPTLYRSNTSGIIQ----ILKKEGLGKLFTGVGATCIGYSLQ 84
           +VTP + IK  L    Q     Y +N  G+++    ++  +G   L+ GV    +  +  
Sbjct: 123 AVTPFEAIKTALIDDKQSASPKYHNNGRGMLRNYSSLVYDKGFSGLYRGVLPVSMRQAAN 182

Query: 85  GAGKYGGYELFKRLYS--THLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVK 142
            A + G Y   K +    T+  KD+  +    + +  +  A +         P + +K +
Sbjct: 183 QAVRLGCYNKIKTMIQDYTNSAKDKPLS----SGMTFVVGAFSGIVTVYTTMPIDTVKTR 238

Query: 143 QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIV 196
            Q+      ++ I  +  ++ +EGL  F+KG TP   R I      FT +E+++
Sbjct: 239 MQSLDSSKYSSTINCFATVFREEGLKTFWKGATPRLGRLILSGGIVFTIYEKVL 292

>CAGL0G01166g complement(111298..112185) highly similar to tr|Q06143
           Saccharomyces cerevisiae YLR348c DIC1, hypothetical
           start
          Length = 295

 Score = 62.4 bits (150), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 104/240 (43%), Gaps = 34/240 (14%)

Query: 22  GGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGY 81
            GI A   TH    PLDL K RLQ  P    +    +  ILK EG+  L+ G+ A+ +  
Sbjct: 16  AGIFAVMNTH----PLDLTKVRLQAAPIPKPTIVQMLRSILKNEGIVGLYAGLSASLLRQ 71

Query: 82  SLQGAGKYGGYELFKRLYSTHLV-KDEATAYKYRTSIYLLSSA---TAEFFADIMLCPFE 137
                 ++G Y+  K     H++ +D+ T   Y     ++S A    A  FAD++     
Sbjct: 72  CTYTTARFGMYDALKE----HVIPRDKLTNMWYLLGASMVSGALGGLAGNFADLI----- 122

Query: 138 AIKVKQQTTMP----PWCNNVIEGWKKMYAKEGLNG-FYKGITPLWCRQIPYTMCK---F 189
            I+++  + +P        N I+G  K+Y  EG    F  G  P   R +  T  +   +
Sbjct: 123 NIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLFLTGWKPNMVRGVLMTASQVVTY 182

Query: 190 TSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERK 249
             F+  +   Y   P K S       ++ S + G++A  +C+    PADV+ + + N  K
Sbjct: 183 DMFKNFLVTKYNMDPKKNS-----THLTSSLLAGFVATTVCS----PADVIKTIVMNAHK 233

>Scas_562.12
          Length = 300

 Score = 61.6 bits (148), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 114/284 (40%), Gaps = 27/284 (9%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEG----LGK----LFTGV 74
           GI+  G  H    P+D I  RL  + T    N+  + +++ +E     LGK    LF G+
Sbjct: 21  GILEIGVFH----PVDTISKRLMSNHTKI-GNSHELNRVIFREHFSEPLGKRLFTLFPGL 75

Query: 75  GATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF--FADIM 132
           G       LQ   KYGG        + H  KD  +A+  +T   + S+         +I+
Sbjct: 76  GYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDSAFGEKTGKAMRSATAGSLIGIGEIV 135

Query: 133 LCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSF 192
           L P + +K+K+QT    +      G+ K+   EG+   Y+G      R  P +   F   
Sbjct: 136 LLPLDVLKIKRQTNPEAFKG---RGFVKILKDEGIFNLYRGWGWTAARNAPGSFALFGGN 192

Query: 193 ERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCA-IVSHPADVMVSKINNERKVN 251
               E I        S+ S  Q    S VG       C+ IVS P DV+ ++I N    N
Sbjct: 193 AFAKEYILGL--EDYSQASWSQNFISSIVGAS-----CSLIVSAPLDVIKTRIQNRSFDN 245

Query: 252 ESMNVAL-KRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDS 294
               + + K  +   G    + GL  ++L  G    F + +  S
Sbjct: 246 PETGLTIVKNTFKNEGITAFFKGLTPKLLTTGPKLVFSFALAQS 289

>Kwal_23.3965
          Length = 307

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 87/174 (50%), Gaps = 14/174 (8%)

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCN--NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTM 186
           A I+  P + +K++ Q  +        ++  +K++  +EG+   +KG  P     I Y  
Sbjct: 28  ARIVTAPLDTLKIRLQLQLANEAQYGGILVTFKRLVRQEGVRALWKGNVPAMAMYILYGS 87

Query: 187 CKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI-- 244
            +FTS+     AI  +L + KS++ A  QI    VG  ++G   AI S+P DV+ ++   
Sbjct: 88  TQFTSY-----AILNKLLS-KSQLPA--QIHTGMVGA-LSGTCSAIASYPCDVLRTRFIA 138

Query: 245 NNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAY 298
           N+ R+++  ++ A + I+   GF G + G+   I+ I   TS     Y+S K +
Sbjct: 139 NHSRELSTMLSTA-QEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIF 191

 Score = 34.3 bits (77), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 42/214 (19%), Positives = 81/214 (37%), Gaps = 34/214 (15%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVT--PLDLIKCRLQVDPTLYRSNTSGI 58
           +SK++ P +++T         G + A   T S++   P D+++ R   + +   S     
Sbjct: 100 LSKSQLPAQIHT---------GMVGALSGTCSAIASYPCDVLRTRFIANHSRELSTMLST 150

Query: 59  IQ-ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSI 117
            Q I + EG    F GV ++ +  ++  +     YE  K        +D +      +S 
Sbjct: 151 AQEIWRHEGFRGFFKGVSSSIVSIAVATSSILATYESVKIFCEQRPDRDSSVIQLLESS- 209

Query: 118 YLLSSATAEFFADIMLCPFEAIKVK------QQTTMPPWCNNVIEGWKK----------- 160
              +S  A   +  ++ P + ++ +      QQ   P   N   + +K            
Sbjct: 210 ---ASVIAGIVSKTIVFPIDTVRKRYQVIDWQQLGHPGHTNKAYKAYKSYTSTNFLRLAL 266

Query: 161 -MYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
            +  KEGL   Y G T    + +P T+     +E
Sbjct: 267 MIVEKEGLLALYHGYTLGIAKSVPSTVVSLGVYE 300

>KLLA0F13464g 1246646..1247548 highly similar to sp|P38988
           Saccharomyces cerevisiae YDL198c YHM1 member of the
           mitochondrial carrier family (MCF), start by similarity
          Length = 300

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 111/279 (39%), Gaps = 24/279 (8%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT---SGIIQILKKEGLGK----LFTGVG 75
           GI+  G  H    P+D I  RL  + T   S +   S I +    E LG+    LF G+G
Sbjct: 21  GILEIGVFH----PVDTISKRLMSNHTKIASTSQLNSVIFRDFASEPLGRRLLSLFPGLG 76

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA--DIML 133
                  LQ   KYGG        + +   D   A+  +T   L S+         +I+L
Sbjct: 77  YAAAYKILQRVYKYGGQPFANEFLNKNFKGDFDQAFGEKTGKALRSATAGSLIGIGEIVL 136

Query: 134 CPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
            P + +K+K+QT    +      G+ K+   EG  G Y+G      R  P +   F    
Sbjct: 137 LPLDVLKIKRQTNPESFKG---RGFLKIIKDEGF-GLYRGWGWTAARNAPGSFALFGGNA 192

Query: 194 RIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN-E 252
              E I   L  K    +   Q  VS + G  A +   IVS P DV+ ++I N    N E
Sbjct: 193 FAKEYI---LGLKDYGQATWSQNFVSSIVGASASL---IVSAPLDVIKTRIQNRNFDNPE 246

Query: 253 SMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLI 291
           S    +K      GF   + GL  ++L  G    F + +
Sbjct: 247 SGFKIIKNTLKNEGFTAFFKGLTPKLLTTGPKLVFSFAL 285

>Sklu_2127.5 YOR130C, Contig c2127 7354-8190 reverse complement
          Length = 278

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 80/168 (47%), Gaps = 16/168 (9%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSG------IIQILKKEGLGKLFTGVGATCIGYSLQGAG 87
           +TP++LIKC+LQV   L  + TS       I  +L + G   L+ G   T I  S  GA 
Sbjct: 118 LTPVELIKCKLQVS-NLSTTKTSHTKILPTIKSVLSERGFLGLWQGQSGTFIRESGGGAA 176

Query: 88  KYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTM 147
            +  YE+ K   ++    ++ T ++      L S A+A    +  + P + IK   QT  
Sbjct: 177 WFTTYEVVKNYLASRRQAEQNTTWEL-----LASGASAGLAFNASIFPADTIKSTMQTDH 231

Query: 148 PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
                ++    +K+YA++G+ GFY+G+     R +P     F ++E +
Sbjct: 232 I----DLSSATRKIYARQGIAGFYRGLGITLIRAVPANAAIFYTYETL 275

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 65/146 (44%), Gaps = 16/146 (10%)

Query: 135 PFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGL-NGFYKGI-TPLWCRQIPYTMCKFTSF 192
           PF+ +KV+ QT             K  Y  EGL  GFY+GI +PL    +   +  F SF
Sbjct: 26  PFDTVKVRLQTQPAHMFPTTWSCIKFTYDNEGLWRGFYQGIGSPLAGAALENAVL-FVSF 84

Query: 193 ERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVM-----VSKINNE 247
            +       RL   +S +S L   S +   G  AG   + V  P +++     VS ++  
Sbjct: 85  NQA-----KRLLDVESLLSPL---SKTVWAGAFAGACASFVLTPVELIKCKLQVSNLSTT 136

Query: 248 RKVNESMNVALKRIYSRIGFVGLWNG 273
           +  +  +   +K + S  GF+GLW G
Sbjct: 137 KTSHTKILPTIKSVLSERGFLGLWQG 162

>Scas_702.10
          Length = 302

 Score = 60.8 bits (146), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 122/295 (41%), Gaps = 36/295 (12%)

Query: 22  GGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGY 81
            GI AC  TH    PLDL K RLQ  P    +    +  IL+ E +  L++G+ A  +  
Sbjct: 19  AGIFACVMTH----PLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGLYSGLSAAVLRQ 74

Query: 82  SLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF---FADIMLCPFEA 138
                 ++G Y+L K      + +       Y     + S A       FAD++      
Sbjct: 75  CTYTTVRFGAYDLMKE---NLIPQGHINDMVYLLPCSMFSGAIGGLVGNFADVV-----N 126

Query: 139 IKVKQQTTMPPWCN----NVIEGWKKMYAKEG-LNGFYKGITPLWCRQIPYTMCKFTSFE 193
           I+++  + + P       N I+G  K+Y  EG +     G  P   R +  T  +  +++
Sbjct: 127 IRMQNDSALKPELRRNYRNAIDGVYKIYMHEGGIKTLLTGWKPNMVRGVLMTASQVVTYD 186

Query: 194 RIVEAIYARL---PTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKV 250
                +  +L   P K S       +S S + G +A  +C+    PADV+ ++I N  K 
Sbjct: 187 VFKNYLVTKLSFDPKKNST-----HLSASLLAGLVATTICS----PADVIKTRIMNAHKT 237

Query: 251 -NESMNVALKRIYSRIGFVGLWNG-LPVRILMIGTLTSFQWLIYDSFKAY-VGLP 302
            +ES    L     + G   ++ G LP+    +G  T   +   +  K + VG+P
Sbjct: 238 ESESAIKILTSAIKKEGPSFMFRGWLPI-FTRLGPFTMLIFFAIEQLKKHRVGMP 291

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%)

Query: 211 SALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGL 270
           S  +QI   +  G  AGI   +++HP D+   ++        ++   L  I      +GL
Sbjct: 4   SPTKQIKYPWWYGGAAGIFACVMTHPLDLAKVRLQAAPLPKPTLGRMLTTILRNENVMGL 63

Query: 271 WNGLPVRILMIGTLTSFQWLIYDSFK 296
           ++GL   +L   T T+ ++  YD  K
Sbjct: 64  YSGLSAAVLRQCTYTTVRFGAYDLMK 89

>CAGL0K10362g complement(1009155..1010060) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11, start by
           similarity
          Length = 301

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 81/178 (45%), Gaps = 20/178 (11%)

Query: 34  VTPLDLIKCRLQVDP------------TLYRSNTSGI--IQ-ILKKEGLGKLFTGVGATC 78
           +TP++LIKC+LQV              T+   +T  I  IQ ++K  G   L+ G   T 
Sbjct: 125 LTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTF 184

Query: 79  IGYSLQGAGKYGGYELFKR-LYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFE 137
           I  S  G   +  YEL K+ L S H ++D +     +T   L S A+A    +  + P +
Sbjct: 185 IRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPAD 244

Query: 138 AIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
            +K   QT        +    KK++ ++GL GFY+G+     R IP     F  +E +
Sbjct: 245 TVKSMMQTEHLGLKTAI----KKIFVEKGLRGFYRGLGITLIRAIPANATVFYVYETL 298

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 100/260 (38%), Gaps = 26/260 (10%)

Query: 36  PLDLIKCRLQVDPTLYRSNT-SGIIQILKKEGLGK-LFTGVGATCIGYSLQGAGKYGGYE 93
           P D +K RLQ        +T S I    K EG+ K  F G+ +   G +++ A  +  Y 
Sbjct: 33  PFDTVKVRLQTQGRHVFPDTWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAALFLSYN 92

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ--------- 144
              +    +    + T         L+S A A   A  +L P E IK K Q         
Sbjct: 93  QCSKFLQHYTNVSDLTNI-------LISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPL 145

Query: 145 -----TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
                 T+      +I   + +    G  G ++G +  + R+    +  F ++E + + +
Sbjct: 146 GVAGGNTVTERHTRIIPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYL 205

Query: 200 YARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALK 259
            +R   +   +    +       G  AG+       PAD + S +  E   +  +  A+K
Sbjct: 206 KSRHNIEDPSLPNDNKTWELLASGASAGLAFNASIFPADTVKSMMQTE---HLGLKTAIK 262

Query: 260 RIYSRIGFVGLWNGLPVRIL 279
           +I+   G  G + GL + ++
Sbjct: 263 KIFVEKGLRGFYRGLGITLI 282

>YOR130C (ORT1) [4932] chr15 complement(569929..570807) Ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF) of membrane transporters [879 bp, 292 aa]
          Length = 292

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 79/187 (42%), Gaps = 16/187 (8%)

Query: 21  LGGIVACGPTHSS-----VTPLDLIKCRLQVD-------PTLYRSNTSGIIQILKKEGLG 68
           LG I+  G    S     +TP++L+KC+LQV         T +      I  I+ + GL 
Sbjct: 107 LGQILISGGVAGSCASLVLTPVELVKCKLQVANLQVASAKTKHTKVLPTIKAIITERGLA 166

Query: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFF 128
            L+ G   T I  S  G   +  YE+ K+        D+    + +    L+S  +A   
Sbjct: 167 GLWQGQSGTFIRESFGGVAWFATYEIVKKSLKDRHSLDDPKRDESKIWELLISGGSAGLA 226

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
            +  + P + +K   QT      N V    KK++ K GL GFY+G+     R +P     
Sbjct: 227 FNASIFPADTVKSVMQTEHISLTNAV----KKIFGKFGLKGFYRGLGITLFRAVPANAAV 282

Query: 189 FTSFERI 195
           F  FE +
Sbjct: 283 FYIFETL 289

>ACR260W [1307] [Homologous to ScYJL133W (MRS3) - SH; ScYKR052C
           (MRS4) - SH] complement(823895..824830) [936 bp, 311 aa]
          Length = 311

 Score = 60.1 bits (144), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 120/295 (40%), Gaps = 40/295 (13%)

Query: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVDPT--------LYRSNTSGIIQILKKEGLG 68
           AA    GI+     HS + P+D IK R+Q   T        L  +  + I +I   EG  
Sbjct: 22  AAGAFAGIM----EHSIMFPIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSL 77

Query: 69  KLFTGVGATCIGYSLQGAGKYGGYELFK-RLYSTHLVKDEATAYKYRTSIYLLSSATAEF 127
            L+ GV +  +G     A  +  YE+ K RL      +D  T    +T+   LS   A  
Sbjct: 78  ALWKGVQSVVLGAGPAHAVYFATYEMCKSRLIDP---EDRQTHQPLKTA---LSGTLATV 131

Query: 128 FADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187
            AD ++ PF+ IK  Q+  + P  +++ +   +MY +EG+  F+          IP+   
Sbjct: 132 AADALMNPFDTIK--QRLQLHP-SDSMTKCAVRMYQREGIAAFFYSYPTTIAMNIPFAAL 188

Query: 188 KFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVM--VSKIN 245
            F  +E           TK    S      +  + G ++G  CA ++ P D +  V +I 
Sbjct: 189 NFVIYES---------STKIFNPSNNYNPWIHCLCGGISGATCAAITTPLDCVKTVLQIR 239

Query: 246 NERKVN-------ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293
               V        ++   A   I+   G+ G + GL  RI+     T+  W  Y+
Sbjct: 240 GADSVQSQLFKEADTFRKAASAIHKTYGWSGFFRGLKPRIISNMPATAISWTSYE 294

>Scas_721.27
          Length = 374

 Score = 60.1 bits (144), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 91/185 (49%), Gaps = 20/185 (10%)

Query: 30  THSSVTPLDLIKCRLQVDPT----LYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQG 85
           T ++  P+ +IK R+Q+D       Y+++   +  +LK EG+  L+ G+ A+ +G S++G
Sbjct: 188 TSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLG-SIEG 246

Query: 86  AGKYGGYELFKRLYSTHLVK---DEATAYKYRTSIYLL------SSATAEFFADIMLCPF 136
             ++  YE  K L     ++    E    K RT           S+  A+F A I+  P 
Sbjct: 247 ILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPH 306

Query: 137 EAIKVKQQTTMP-----PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
           E ++ + +  MP     P    +++ ++ +  +EGL   Y G+TP   R +P ++  F +
Sbjct: 307 EVVRTRLRQ-MPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGT 365

Query: 192 FERIV 196
           +E ++
Sbjct: 366 WELVI 370

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 112/299 (37%), Gaps = 56/299 (18%)

Query: 36  PLDLIKCRLQVD--PTLYRS-------------------------NTSGII-QILKKEGL 67
           P DL+K RLQ D   ++Y+S                          T GI+  + K+EG 
Sbjct: 72  PFDLVKTRLQSDIYQSVYKSKAATVTAAHNSKIANSLVQAGTHFKETFGILGNVYKREGF 131

Query: 68  GKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF 127
             LF G+G   +G     +  +  Y   K +YS      + T       I+L+S+ATA +
Sbjct: 132 RSLFKGLGPNLVGVIPARSINFFTYGTTKEIYSKAFNNGQETPL-----IHLMSAATAGW 186

Query: 128 FADIMLCPFEAIKVKQQTTMPPWCNNVIEGW---KKMYAKEGLNGFYKGITPLWCRQIP- 183
                  P   IK + Q             W   K +   EG+ G Y+G++  +   I  
Sbjct: 187 ATSTATNPIWMIKTRVQLDKAGTTRKYKNSWDCLKTVLKSEGIYGLYRGLSASYLGSIEG 246

Query: 184 ------YTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237
                 Y   K    +R +E         KS    +++         +A  + +IV++P 
Sbjct: 247 ILQWLLYEQMKHLIKQRSIEKFGHEGQLTKSRTEKIKEWCQRSGSAGVAKFIASIVTYPH 306

Query: 238 DVMVSKI-----NNERKVNESMNVALKRIYSRIGFVGLWNGL--------PVRILMIGT 283
           +V+ +++      N +     +  + + I    G   +++GL        P  I+M GT
Sbjct: 307 EVVRTRLRQMPMENGKPKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGT 365

>YLR348C (DIC1) [3731] chr12 complement(826976..827872)
           Mitochondrial dicarboxylate transport protein, member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [897 bp, 298 aa]
          Length = 298

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 100/233 (42%), Gaps = 26/233 (11%)

Query: 22  GGIVACGPTHSSVTPLDLIKCRLQV----DPTLYRSNTSGIIQILKKEGLGKLFTGVGAT 77
            GI A   TH    PLDL K RLQ      PTL+R   S    IL  EG+  L++G+ A 
Sbjct: 23  AGIFATMVTH----PLDLAKVRLQAAPMPKPTLFRMLES----ILANEGVVGLYSGLSAA 74

Query: 78  CIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSAT---AEFFADIMLC 134
            +        ++G Y+L K      + +++ T   Y     + S A    A  FAD++  
Sbjct: 75  VLRQCTYTTVRFGAYDLLK---ENVIPREQLTNMAYLLPCSMFSGAIGGLAGNFADVVNI 131

Query: 135 PFEAIKVKQQTTMPPWCNNVIEGWKKMYAKE-GLNGFYKGITPLWCRQIPYTMCKFTSFE 193
             +     +      +  N I+G  K+Y  E GL   + G  P   R I  T  +  +++
Sbjct: 132 RMQNDSALEAAKRRNY-KNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVVTYD 190

Query: 194 RIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINN 246
                +  +L    S+      ++ S + G +A  +C+    PADVM ++I N
Sbjct: 191 VFKNYLVTKLDFDASK--NYTHLTASLLAGLVATTVCS----PADVMKTRIMN 237

 Score = 43.9 bits (102), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 71/168 (42%), Gaps = 18/168 (10%)

Query: 38  DLIKCRLQVDPTL-------YRSNTSGIIQILKKEG-LGKLFTGVGATCIGYSLQGAGKY 89
           D++  R+Q D  L       Y++   G+ +I + EG L  LFTG     +   L  A + 
Sbjct: 127 DVVNIRMQNDSALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQV 186

Query: 90  GGYELFKRLYSTHLVKDEATAYKYRTSIYL--LSSATAEFFADIMLCPFEAIKVKQQTTM 147
             Y++FK    T L  D +  Y + T+  L  L + T    AD+M           Q  +
Sbjct: 187 VTYDVFKNYLVTKLDFDASKNYTHLTASLLAGLVATTVCSPADVMKTRIMNGSGDHQPAL 246

Query: 148 PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
               + V         KEG +  ++G  P + R  P+TM  F + E++
Sbjct: 247 KILADAV--------RKEGPSFMFRGWLPSFTRLGPFTMLIFFAIEQL 286

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 83/189 (43%), Gaps = 29/189 (15%)

Query: 125 AEFFADIMLCPFEAIKVK-QQTTMP-PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQI 182
           A  FA ++  P +  KV+ Q   MP P    ++E    + A EG+ G Y G++    RQ 
Sbjct: 23  AGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLE---SILANEGVVGLYSGLSAAVLRQC 79

Query: 183 PYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242
            YT  +F +++ + E +  R   + + M+ L   S+       +G +  +  + ADV+  
Sbjct: 80  TYTTVRFGAYDLLKENVIPR--EQLTNMAYLLPCSM------FSGAIGGLAGNFADVVNI 131

Query: 243 KINNERKVNESMNVALKRIYSRI------------GFVGLWNGLPVRILMIGTLTSFQWL 290
           ++ N+     ++  A +R Y               G   L+ G    ++    +T+ Q +
Sbjct: 132 RMQND----SALEAAKRRNYKNAIDGVYKIYRYEGGLKTLFTGWKPNMVRGILMTASQVV 187

Query: 291 IYDSFKAYV 299
            YD FK Y+
Sbjct: 188 TYDVFKNYL 196

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 46/95 (48%)

Query: 205 TKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSR 264
           +  ++ SA + I   +  G  AGI   +V+HP D+   ++        ++   L+ I + 
Sbjct: 2   STNAKESAGKNIKYPWWYGGAAGIFATMVTHPLDLAKVRLQAAPMPKPTLFRMLESILAN 61

Query: 265 IGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
            G VGL++GL   +L   T T+ ++  YD  K  V
Sbjct: 62  EGVVGLYSGLSAAVLRQCTYTTVRFGAYDLLKENV 96

>Sklu_2037.2 YIL134W, Contig c2037 1645-2577 reverse complement
          Length = 310

 Score = 59.7 bits (143), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 132/308 (42%), Gaps = 39/308 (12%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQV-----DPTLYRSNTSGIIQILKKEGLGK-LFTGV 74
           + G+ A   T  S  PLDL+K RLQ+      P  Y      I++  K+    +  + G+
Sbjct: 13  ISGLTAGTITTVSTHPLDLVKVRLQLLATNKKPQGYYDVVKRIVKDSKQHSFFRETYRGL 72

Query: 75  GATCIGYSLQGAGKYGGYEL------------FKRLYSTHLVKDEATAYKYRTSIYLLSS 122
           G   +G S+     +G Y               KR  +T     E T+      +YLL++
Sbjct: 73  GVNLLGNSVAWGLYFGLYRASKDWVFQWCNTDVKRFNNTMNNDKEMTSL-----MYLLAA 127

Query: 123 ATAEFFADIMLCPFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWC 179
           A +     ++  P   IK +  +T         + ++G KK+Y  EGL GF++G+ P   
Sbjct: 128 AMSGVATSVLTNPIWVIKTRIMSTSFVDSRSYRSTVDGIKKLYRIEGLAGFWRGLVPS-L 186

Query: 180 RQIPYTMCKFTSFERIVEAIY-ARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPAD 238
             +      FT ++ +    + A+   KK ++S L+ I+++     ++ ++     +P  
Sbjct: 187 FGVSQGAIYFTVYDTLKYHYFAAKHVDKKKKLSNLEYITIT----SLSKMVSVTAVYPLQ 242

Query: 239 VMVSKINN-------ERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLI 291
           ++ S + +         K +  +   +  IY R G  GL+ GL   ++     T   + +
Sbjct: 243 LLKSNLQSFEVSTVINPKTSHRVWKLITTIYVRDGVTGLYKGLLANLIRAVPSTCITFCV 302

Query: 292 YDSFKAYV 299
           Y++F+ ++
Sbjct: 303 YENFRHWL 310

>AGL311C [4001] [Homologous to ScYJR095W (SFC1) - SH]
           (119645..120733) [1089 bp, 362 aa]
          Length = 362

 Score = 59.7 bits (143), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 57/287 (19%), Positives = 113/287 (39%), Gaps = 41/287 (14%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGI---------IQILKKEGLGKLFTGVGATCIGYSLQGA 86
           PLD IK R+Q+    YR    G            I   EGL   + G+GA  IG   + A
Sbjct: 77  PLDTIKVRMQI----YRRANEGTKPPGFLRTGANIYSGEGLLAFYKGLGAVVIGIIPKMA 132

Query: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146
            ++  YE ++ L +     D  T      + +L         A +++ P E +K++ Q  
Sbjct: 133 IRFSSYEFYRTLLA-----DRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQ 187

Query: 147 MPPWC------NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIY 200
                       N I+    +  +EG+   Y+G++    RQ       FT        +Y
Sbjct: 188 HLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQGANFT--------VY 239

Query: 201 ARLPTKKSEMSALQQI---SVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMN-- 255
           ++L  +  E    Q +     S + G ++G +    + P D + +++  ++      N  
Sbjct: 240 SKLMERLQEYHGSQNLPSWETSLI-GLVSGAIGPFSNAPLDTIKTRLQKDKSTRNLSNWV 298

Query: 256 ---VALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
                 +++    GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 299 RITTIGRQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHL 345

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 75/173 (43%), Gaps = 20/173 (11%)

Query: 34  VTPLDLIKCRLQV-------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86
           V P++++K RLQ        +   YR+       I+K+EG+G L+ GV  T    +    
Sbjct: 174 VNPMEVVKIRLQAQHLHGAAEQQKYRNAIQAAYLIVKEEGIGALYRGVSLTAARQATNQG 233

Query: 87  GKYGGY-ELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQT 145
             +  Y +L +RL   H  ++  +   + TS+  L S     F++    P + IK + Q 
Sbjct: 234 ANFTVYSKLMERLQEYHGSQNLPS---WETSLIGLVSGAIGPFSN---APLDTIKTRLQK 287

Query: 146 -----TMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
                 +  W      G +++  +EG    YKGITP   R  P     FT +E
Sbjct: 288 DKSTRNLSNWVRITTIG-RQLVQEEGFRALYKGITPRVMRVAPGQAVTFTVYE 339

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 18/133 (13%)

Query: 116 SIYLLSSATAEFFADIMLCPFEAIKVKQQT-------TMPPWCNNVIEGWKKMYAKEGLN 168
           ++ L++  TA  F  +   P + IKV+ Q        T PP     +     +Y+ EGL 
Sbjct: 58  AVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPP---GFLRTGANIYSGEGLL 114

Query: 169 GFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGI 228
            FYKG+  +    IP    +F+S+E      Y  L   +   + +     +F+ G  AG+
Sbjct: 115 AFYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADR--QTGVVSTGNTFLAGVGAGV 167

Query: 229 LCAI-VSHPADVM 240
             A+ V +P +V+
Sbjct: 168 TEAVLVVNPMEVV 180

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query: 204 PTKKSEMSALQQI--SVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNV----- 256
           P   + MS+ +    +V+ V G  AG+  A+  HP D +  ++   R+ NE         
Sbjct: 43  PYPDNHMSSKKSTNPAVNLVAGGTAGLFEALCCHPLDTIKVRMQIYRRANEGTKPPGFLR 102

Query: 257 ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296
               IYS  G +  + GL   ++ I    + ++  Y+ ++
Sbjct: 103 TGANIYSGEGLLAFYKGLGAVVIGIIPKMAIRFSSYEFYR 142

>Sklu_2430.10 YKL120W, Contig c2430 18856-19830
          Length = 324

 Score = 59.3 bits (142), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 93/208 (44%), Gaps = 15/208 (7%)

Query: 106 DEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ------TTMPPWCNNVIEGWK 159
           +++ A K       ++   A   A  +  PFE +K + Q       T      N  +   
Sbjct: 14  EKSAAQKVSKVGSFIAGGLAACIAVTVTNPFELVKTRMQLQGEMSATNQRIYRNPFQALG 73

Query: 160 KMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVS 219
            ++  EG+ G  +G+   +  QI     +   +E I   +  +    +S+   LQ ++V+
Sbjct: 74  VIFKNEGVKGLQRGLVSAYVYQIGLNGSRLGFYEPI-RTVLNKTFFPESDPHKLQNVAVN 132

Query: 220 FVGGYMAGILCAIVSHPADVMVSKI---NNERKVNE-----SMNVALKRIYSRIGFVGLW 271
              G  +GI+ AIV  P  ++ +++   +N  K+ E     SM+  L  I+ + G +GL+
Sbjct: 133 VTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLF 192

Query: 272 NGLPVRILMIGTLTSFQWLIYDSFKAYV 299
            G+   IL  G  +S Q  IY++ K ++
Sbjct: 193 RGVDAAILRTGAGSSVQLPIYNTTKNFL 220

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 76/175 (43%), Gaps = 14/175 (8%)

Query: 35  TPLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86
           +PL L+K R+Q         + T Y S ++G+  I KKEG+  LF GV A  +     GA
Sbjct: 148 SPLFLVKTRMQSYSNAIKIGEQTHYTSMSNGLATIFKKEGVLGLFRGVDAAIL---RTGA 204

Query: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146
           G      ++    +  L  D     K  T+++LLSS        I++ P++ +  +    
Sbjct: 205 GSSVQLPIYNTTKNFLLQND---IMKEGTALHLLSSTVTGLGVGIVMNPWDVVLTRVYNQ 261

Query: 147 MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA 201
                   I+   K    EG+   YKG      R  P+T+   T  E+ ++ +YA
Sbjct: 262 KGNTYKGPIDCMFKTIKIEGIGALYKGFGAQLFRIAPHTILCLTFMEQTMKLVYA 316

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 109/275 (39%), Gaps = 40/275 (14%)

Query: 1   MSKTKSPIELYTKEYYAACTL--------GGIVACGPTHSSVTPLDLIKCRLQV------ 46
           MS    P+     E  AA  +        GG+ AC    +   P +L+K R+Q+      
Sbjct: 1   MSSENKPVATKEHEKSAAQKVSKVGSFIAGGLAACIAV-TVTNPFELVKTRMQLQGEMSA 59

Query: 47  -DPTLYRSNTSGIIQILKKEGLGKLFTG-VGATCIGYSLQGAGKYGGYELFKRLYSTHLV 104
            +  +YR+    +  I K EG+  L  G V A      L G+ + G YE  + + +    
Sbjct: 60  TNQRIYRNPFQALGVIFKNEGVKGLQRGLVSAYVYQIGLNGS-RLGFYEPIRTVLNKTFF 118

Query: 105 KDEATAYKYRTSIYLLSSATAEFFADIMLCPF-----------EAIKVKQQTTMPPWCNN 153
            +         ++ + + AT+     I+  P             AIK+ +QT      N 
Sbjct: 119 PESDPHKLQNVAVNVTAGATSGIIGAIVGSPLFLVKTRMQSYSNAIKIGEQTHYTSMSN- 177

Query: 154 VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSAL 213
              G   ++ KEG+ G ++G+     R    +  +   +      +      K  E +AL
Sbjct: 178 ---GLATIFKKEGVLGLFRGVDAAILRTGAGSSVQLPIYNTTKNFLLQNDIMK--EGTAL 232

Query: 214 QQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248
             +S +     + G+   IV +P DV+++++ N++
Sbjct: 233 HLLSST-----VTGLGVGIVMNPWDVVLTRVYNQK 262

>KLLA0E23705g complement(2099965..2101071) highly similar to
           sp|P38127 Saccharomyces cerevisiae YBR192w RIM2
           mitochondrial carrier protein (MCF), start by similarity
          Length = 368

 Score = 59.3 bits (142), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/197 (25%), Positives = 98/197 (49%), Gaps = 21/197 (10%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPT---LYRSNTSGIIQILKKEGLGKLFTGVGAT 77
           L    A   T +   P+ L+K RLQ+D      Y+++   I  ++K EG+  L+ G+ A+
Sbjct: 174 LAAATAGWATSTVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSAS 233

Query: 78  CIGYSLQGAGKYGGYELFKRLYST-------HLVKD-EATAYKYRTSIYLLSSA-TAEFF 128
            +G S++G  ++  YE  KR+          H+ +D ++T+ K +       SA  A+F 
Sbjct: 234 YLG-SVEGILQWILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFV 292

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCNN------VIEGWKKMYAKEGLNGFYKGITPLWCRQI 182
           A I+  P E ++ + +    P  N       +++ ++ +  +EGL   Y G+TP   R +
Sbjct: 293 ASIVTYPHEVVRTRLR--QAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTV 350

Query: 183 PYTMCKFTSFERIVEAI 199
           P ++  F ++E +++ +
Sbjct: 351 PNSIIMFGTWELVIKLL 367

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 67/295 (22%), Positives = 116/295 (39%), Gaps = 52/295 (17%)

Query: 36  PLDLIKCRLQVD--PTLYRS----------------------NTSGII-QILKKEGLGKL 70
           P D++K RLQ D   T Y+S                       T GII  + ++EG   L
Sbjct: 70  PFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRSL 129

Query: 71  FTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFAD 130
           F G+G   +G     +  +  Y   K +YS  L   +   +     I+LL++ATA +   
Sbjct: 130 FKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPW-----IHLLAAATAGWATS 184

Query: 131 IMLCPFEAIKVKQQTTMP--PWCNNVIEGWKKMYAKEGLNGFYKGITPLW-------CRQ 181
            +  P   +K + Q          N ++  K +   EG+ G YKG++  +        + 
Sbjct: 185 TVTNPIWLVKTRLQLDKAGTKTYKNSLDCIKSVVKNEGVLGLYKGLSASYLGSVEGILQW 244

Query: 182 IPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMV 241
           I Y   K    ER +E         KS    +++         +A  + +IV++P +V+ 
Sbjct: 245 ILYEQMKRIIKERSIEKFGHIHEDAKSTSDKVKEWCQRSGSAGLAKFVASIVTYPHEVVR 304

Query: 242 SKINNERKVNESMNV-----ALKRIYSRIGFVGLWNGL--------PVRILMIGT 283
           +++      N  +       + + I    G V +++GL        P  I+M GT
Sbjct: 305 TRLRQAPTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSIIMFGT 359

>Sklu_2117.2 YDL198C, Contig c2117 3737-4633
          Length = 298

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 112/279 (40%), Gaps = 24/279 (8%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT---SGIIQILKKEGLGK----LFTGVG 75
           GI+  G  H    P+D I  RL  + T   S++   S I +    E L K    LF G+G
Sbjct: 20  GILEIGVFH----PVDTISKRLMSNHTKIGSSSQLNSVIFREHAAEPLSKRVFTLFPGLG 75

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA--DIML 133
                  LQ   KYGG        + +   D    +  +T   L S+         +I+L
Sbjct: 76  YAATYKILQRVYKYGGQPFANEFLNRNFKADFDNTFGEKTGKALRSATAGSMIGIGEIVL 135

Query: 134 CPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
            P + +K+K+QT    +      G+ K+   EGL G Y+G      R  P +   F    
Sbjct: 136 LPLDVLKIKRQTNPEAFKG---RGFVKILKDEGL-GLYRGWGWTAARNAPGSFALFGGNA 191

Query: 194 RIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN-E 252
              E I   L  K    +   Q  VS + G  A +   I+S P DV+ ++I N+   N E
Sbjct: 192 FAKEYI---LGLKDYSQATWSQNFVSSIVGASASL---IISAPLDVIKTRIQNKNFENPE 245

Query: 253 SMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLI 291
           S    +K      GF   + GL  ++L  G    F + +
Sbjct: 246 SGFTIVKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSFAL 284

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 75/172 (43%), Gaps = 10/172 (5%)

Query: 18  ACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGAT 77
           + T G ++  G     + PLD++K + Q +P  ++    G ++ILK EGLG L+ G G T
Sbjct: 121 SATAGSMIGIGEI--VLLPLDVLKIKRQTNPEAFKGR--GFVKILKDEGLG-LYRGWGWT 175

Query: 78  CIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFE 137
               +      +GG   F + Y   L KD + A   +  +  +  A+A     I+  P +
Sbjct: 176 AARNAPGSFALFGG-NAFAKEYILGL-KDYSQATWSQNFVSSIVGASASL---IISAPLD 230

Query: 138 AIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKF 189
            IK + Q        +     K     EG + F+KG+TP      P  +  F
Sbjct: 231 VIKTRIQNKNFENPESGFTIVKNTLKNEGFSAFFKGLTPKLLTTGPKLVFSF 282

>ADL009W [1733] [Homologous to ScYIL006W - SH; ScYEL006W - SH]
           complement(693078..694217) [1140 bp, 379 aa]
          Length = 379

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 58/275 (21%), Positives = 119/275 (43%), Gaps = 27/275 (9%)

Query: 34  VTPLDLIKCRLQVD-----PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGK 88
           V PLD+ K RLQ          YR     +  IL+ EG+  L+ G+    +GY       
Sbjct: 102 VCPLDVAKTRLQAQGAGSGERYYRGIVGTLSAILRDEGVAGLYKGLAPIVLGYFPTWMLY 161

Query: 89  YGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQ--QTT 146
           +  YE  K+ Y ++L     +        +  S+ TA   +  +  P   +K +   Q+ 
Sbjct: 162 FSVYEKCKQRYPSYLPGGFVS--------HAASALTAGAISTALTNPIWVVKTRLMIQSD 213

Query: 147 MPPWCNN---VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARL 203
           +     N    ++ ++KMY  EGL  FY G+ P     + +    F  +E++   ++   
Sbjct: 214 VSRDSTNYRSTLDAFRKMYRSEGLKVFYSGLVPSLF-GLFHVAIHFPVYEKLKIWLHRNT 272

Query: 204 PTKKSEMSALQQISVS--FVGGYMAGILCAIVSHPADVMVSKIN-NERKVNESMNVALKR 260
           P    +     ++ +    V   ++ ++ +++++P +++ +++      V  S+   L R
Sbjct: 273 PAADGQRLDHNKLQLDRLIVASCLSKVVASVITYPHEILRTRMQVRHSGVPPSLLNLLGR 332

Query: 261 IYSRIGFVGLWNGLPVRILM-----IGTLTSFQWL 290
           I +  G+VG ++G    ++      + TL SF++ 
Sbjct: 333 IRASEGYVGFYSGFATNLVRTVPASVITLVSFEYF 367

>YGR096W (TPC1) [2056] chr7 (676623..677567) Mitochondrial thiamine
           pyrophosphate transporter, controls import of thiamine
           pyrophosphate during growth on fermentative carbon
           sources, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 58.9 bits (141), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 86/185 (46%), Gaps = 14/185 (7%)

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTT----MPPWCNNVIEGWKKMYAKEGLNGFYKGI 174
           LL+ A +   A  +  P + IK++ Q T    + P+ + V+E  + M   EG+  F+KG 
Sbjct: 20  LLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGN 79

Query: 175 TPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVS 234
            P     + Y   +F+S+     +++ R  T     + L     S V G  AGI  +IVS
Sbjct: 80  IPGSLLYVTYGSAQFSSY-----SLFNRYLTPFGLEARLH----SLVVGAFAGITSSIVS 130

Query: 235 HPADVMVSK-INNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293
           +P DV+ ++ + N +  + S+   ++ I+   G  G + G    +  I    S  +  Y+
Sbjct: 131 YPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYE 190

Query: 294 SFKAY 298
           + + Y
Sbjct: 191 TIRIY 195

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/234 (20%), Positives = 93/234 (39%), Gaps = 22/234 (9%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTL-YRSNTSGIIQI----LKKEGLGKLFTGVG 75
           L G V+     S   P+D IK RLQ+ P    +   S ++++    +K EG+   + G  
Sbjct: 21  LAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNI 80

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
              + Y   G+ ++  Y LF R  +   ++    +        L+  A A   + I+  P
Sbjct: 81  PGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHS--------LVVGAFAGITSSIVSYP 132

Query: 136 FEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
           F+ ++ +          ++    + ++  EGL GF+KG               F ++E I
Sbjct: 133 FDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETI 192

Query: 196 V----EAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKIN 245
                E        KK E++ L         G + G++  I++ P + +  ++ 
Sbjct: 193 RIYCDENEKTTAAHKKWELATLNH-----SAGTIGGVIAKIITFPLETIRRRMQ 241

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 77/189 (40%), Gaps = 19/189 (10%)

Query: 27  CGPTHSSVT-PLDLIKCRLQVDPTLYR-SNTSGIIQILKKEGLGKLFTGVGATCIGYSLQ 84
            G T S V+ P D+++ RL  +  ++  S T  +  I K EGL   F G  A+    +L 
Sbjct: 122 AGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLT 181

Query: 85  GAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSAT-AEFFADIMLCPFEAIKVKQ 143
            +  +G YE   R+Y     K  A   K+  +    S+ T     A I+  P E I+ + 
Sbjct: 182 ASIMFGTYETI-RIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRM 240

Query: 144 QTTMPPWC-----NNVIEGWKKMYA----------KEGLNGFYKGITPLWCRQIPYTMCK 188
           Q            ++ + G  K Y           +EG++  Y+GI     + IP T   
Sbjct: 241 QFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVS 300

Query: 189 FTSFERIVE 197
           F  +E  + 
Sbjct: 301 FWGYETAIH 309

>Kwal_27.12081
          Length = 369

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 96/189 (50%), Gaps = 22/189 (11%)

Query: 30  THSSVTPLDLIKCRLQVDPT----LYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQG 85
           T ++  P+ LIK RLQ+D       Y+++   +  I++KEG   L+ G+ A+ +G S++G
Sbjct: 181 TSTATNPIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLG-SVEG 239

Query: 86  AGKYGGYELFKRLYSTHLVK--------DEATAYKYRTSIYLLSSA-TAEFFADIMLCPF 136
             ++  YE  K++     ++        ++ T+ K +       SA  A+F A I+  P 
Sbjct: 240 ILQWLLYEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPH 299

Query: 137 EAIKVKQQTTMPPWCNN------VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFT 190
           E ++ + +    P  N+      +I+ ++ +  +EGL   Y G+TP   R +P ++  F 
Sbjct: 300 EVVRTRLRQA--PLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFG 357

Query: 191 SFERIVEAI 199
           ++E +++ +
Sbjct: 358 TWELVIKLL 366

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 62/293 (21%), Positives = 115/293 (39%), Gaps = 51/293 (17%)

Query: 36  PLDLIKCRLQVD------PTLYRSNTSGII---------------QILKKEGLGKLFTGV 74
           P D++K RLQ D        L  + +S ++                + K EG   LF G+
Sbjct: 72  PFDVVKTRLQSDVFQSTYANLSHNKSSNVVSSGIRHFRETFGIISNLYKLEGFRSLFKGL 131

Query: 75  GATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLC 134
           G   +G     +  +  Y   K++YS      E   +     I+L+S+ATA +       
Sbjct: 132 GPNLVGVIPARSINFFTYGTTKQIYSRAFNNGEEAPW-----IHLISAATAGWATSTATN 186

Query: 135 PFEAIKVKQQTTMPPWCNNVIEGW---KKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
           P   IK + Q             W   K +  KEG  G YKG++  +   +   + ++  
Sbjct: 187 PIWLIKTRLQLDKAGHTRQYKNSWDCLKHIIQKEGFFGLYKGLSASYLGSVE-GILQWLL 245

Query: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGY--------MAGILCAIVSHPADVMVSK 243
           +E++ + I  R   K   +S  ++ +   +  +        +A  L +IV++P +V+ ++
Sbjct: 246 YEQMKQMIKMRSIEKFGHISEGEKNTSEKIKEWCQRSGSAGLAKFLASIVTYPHEVVRTR 305

Query: 244 INNERKVNESMNV-----ALKRIYSRIGFVGLWNGL--------PVRILMIGT 283
           +      N+ +       + + I    G   ++ GL        P  I+M GT
Sbjct: 306 LRQAPLENDKLKYTGLIQSFRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGT 358

>YMR166C (YMR166C) [4121] chr13 complement(593366..594472) Member of
           the mitochondrial carrier (MCF) protein family of
           membrane transporters [1107 bp, 368 aa]
          Length = 368

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/311 (20%), Positives = 132/311 (42%), Gaps = 49/311 (15%)

Query: 19  CTLGGIVACGPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLGK-LFTGVG 75
           C + G +      S++  LD +K R Q  P +  YR+  S    I  +EG+ + L+ G  
Sbjct: 56  CVVSGGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYM 115

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSA-TAEFFADIMLC 134
           A  +G     A  +G YE  KR     +++D    ++   +I  LS+    +F +  +  
Sbjct: 116 AAMLGSFPSAAIFFGTYEYTKRT----MIED----WQINDTITHLSAGFLGDFISSFVYV 167

Query: 135 PFEAIKVKQQTT---MPPWC------NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYT 185
           P E +K + Q       P+       +N+    K +  +EG    + G      R +P++
Sbjct: 168 PSEVLKTRLQLQGRFNNPFFQSGYNYSNLRNAIKTVIKEEGFRSLFFGYKATLARDLPFS 227

Query: 186 MCKFTSFERIVEAIY--ARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSK 243
             +F  +E+  +  +   +   +  E+S   +I    + G  AG L  I++ P DV+ ++
Sbjct: 228 ALQFAFYEKFRQLAFKIEQKDGRDGELSIPNEI----LTGACAGGLAGIITTPMDVVKTR 283

Query: 244 INNER----------------------KVNESMNVALKRIYSRIGFVGLWNGLPVRILMI 281
           +  ++                       ++ S++++L+ +Y   G +G ++G+  R +  
Sbjct: 284 VQTQQPPSQSNKSYSVTHPHVTNGRPAALSNSISLSLRTVYQSEGVLGFFSGVGPRFVWT 343

Query: 282 GTLTSFQWLIY 292
              +S   L+Y
Sbjct: 344 SVQSSIMLLLY 354

>Scas_691.4
          Length = 334

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/296 (20%), Positives = 115/296 (38%), Gaps = 45/296 (15%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGII----QILKKEGLGKLFTGVGATCIGYSLQGAGKYGG 91
           PLD IK R+Q+          G I     I   EG   L+ G+GA  IG   + A ++  
Sbjct: 33  PLDTIKVRMQIAKRTEGMRPHGFITTGRNIYSHEGFLALYKGLGAVVIGIIPKMAIRFSS 92

Query: 92  YELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ------- 144
           YE ++     + + D+ T      + +L         A +++ P E +K++ Q       
Sbjct: 93  YEFYR-----NALTDKETRTITTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHLNDL 147

Query: 145 --------------TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFT 190
                         T   P   N I     +  +EG    Y+G++    RQ       FT
Sbjct: 148 IPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALYRGVSLTAARQATNQGANFT 207

Query: 191 SFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKV 250
            +  + + +      K     +L     S + G ++G +    + P D + +++  ++ +
Sbjct: 208 VYSYLKDYL-----QKYHNRESLPSWETSCI-GLISGAIGPFSNAPLDTIKTRLQKDKSI 261

Query: 251 NESMNVALKRIY-------SRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
             S N A K+IY          GF  L+ G+  R++ +    +  + +Y+  + ++
Sbjct: 262 --SSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRKHL 315

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 70/189 (37%), Gaps = 37/189 (19%)

Query: 34  VTPLDLIKCRLQ----------------------VDPTLYRSNTSGIIQILKKEGLGKLF 71
           V P++++K RLQ                      V    Y +       I+K+EG G L+
Sbjct: 129 VNPMEVVKIRLQAQHLNDLIPQPAGVSAAGTAATVTKPKYANAIHAAYTIVKEEGAGALY 188

Query: 72  TGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADI 131
            GV  T    +      +  Y   K     +  ++   +++  + I L+S A   F    
Sbjct: 189 RGVSLTAARQATNQGANFTVYSYLKDYLQKYHNRESLPSWE-TSCIGLISGAIGPFSN-- 245

Query: 132 MLCPFEAIKVKQQTTMPPWCNNVIEGWKKMY-------AKEGLNGFYKGITPLWCRQIPY 184
              P + IK + Q       N+    WKK+Y        +EG    YKGITP   R  P 
Sbjct: 246 --APLDTIKTRLQKDKSISSNSA---WKKIYIIGTQLIKEEGFRALYKGITPRVMRVAPG 300

Query: 185 TMCKFTSFE 193
               FT +E
Sbjct: 301 QAVTFTVYE 309

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 57/130 (43%), Gaps = 15/130 (11%)

Query: 117 IYLLSSATAEFFADIMLCPFEAIKVKQQTT-----MPPWCNNVIEGWKKMYAKEGLNGFY 171
           I L++  TA  F  +   P + IKV+ Q       M P  +  I   + +Y+ EG    Y
Sbjct: 15  INLVAGGTAGLFEALCCHPLDTIKVRMQIAKRTEGMRP--HGFITTGRNIYSHEGFLALY 72

Query: 172 KGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCA 231
           KG+  +    IP    +F+S+E      Y    T K   +       +F+ G  AGI  A
Sbjct: 73  KGLGAVVIGIIPKMAIRFSSYE-----FYRNALTDKETRTI--TTGNTFLAGVGAGITEA 125

Query: 232 I-VSHPADVM 240
           + V +P +V+
Sbjct: 126 VLVVNPMEVV 135

 Score = 30.8 bits (68), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 7/81 (8%)

Query: 26  ACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII-----QILKKEGLGKLFTGVGATCIG 80
           A GP   S  PLD IK RLQ D ++  ++    I     Q++K+EG   L+ G+    + 
Sbjct: 239 AIGPF--SNAPLDTIKTRLQKDKSISSNSAWKKIYIIGTQLIKEEGFRALYKGITPRVMR 296

Query: 81  YSLQGAGKYGGYELFKRLYST 101
            +   A  +  YE  ++   T
Sbjct: 297 VAPGQAVTFTVYEFVRKHLET 317

>YDL198C (GGC1) [676] chr4 complement(103650..104552) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, overexpression suppresses loss of Abf2p
           [903 bp, 300 aa]
          Length = 300

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 103/269 (38%), Gaps = 19/269 (7%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQILKK---EGLGK----LFTGVGATCIGYSLQGAGK 88
           P+D I  RL  + T   S       I +    E LGK    LF G+G       LQ   K
Sbjct: 30  PVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYK 89

Query: 89  YGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF--FADIMLCPFEAIKVKQQTT 146
           YGG        + H  KD    +  +T   + S+A        +I+L P + +K+K+QT 
Sbjct: 90  YGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGEIVLLPLDVLKIKRQTN 149

Query: 147 MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK 206
              +      G+ K+   EGL   Y+G      R  P +   F       E I   L  K
Sbjct: 150 PESFKG---RGFIKILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYI---LGLK 203

Query: 207 KSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN-ESMNVALKRIYSRI 265
               +   Q   +F+   +      IVS P DV+ ++I N    N ES    +K      
Sbjct: 204 DYSQATWSQ---NFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNE 260

Query: 266 GFVGLWNGLPVRILMIGTLTSFQWLIYDS 294
           G    + GL  ++L  G    F + +  S
Sbjct: 261 GVTAFFKGLTPKLLTTGPKLVFSFALAQS 289

>Kwal_27.11626
          Length = 299

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 111/282 (39%), Gaps = 24/282 (8%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSN---TSGIIQILKKEGLGK----LFTGVG 75
           GI+  G  H    P+D +  RL  + T   S+    S I +    E LGK    LF G+G
Sbjct: 20  GILEIGVFH----PVDTVSKRLMSNHTKISSSAQLNSVIFREHAGEALGKRLFTLFPGLG 75

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA--DIML 133
                  LQ   KYGG        + +   D   A+  +T   L S+         +I+L
Sbjct: 76  YAASYKILQRVYKYGGQPFANEFLNKNFKADFDNAFGEKTGKALRSATAGSLIGIGEIVL 135

Query: 134 CPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
            P + +K+K+QT    +      G+ K+   EG  G Y+G      R  P +   F    
Sbjct: 136 LPLDVLKIKRQTNPESFKG---RGFIKILKDEGF-GLYRGWGWTAARNAPGSFALFGGNA 191

Query: 194 RIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN-E 252
              E I   L  K    +   Q  VS + G  A +   IVS P DV+ ++I N    N E
Sbjct: 192 FAKEYI---LGLKDYSSATWSQNFVSSIVGASASL---IVSAPLDVIKTRIQNRHFDNPE 245

Query: 253 SMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDS 294
           S    ++      G    + GL  ++L  G    F + +  S
Sbjct: 246 SGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQS 287

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 84/192 (43%), Gaps = 16/192 (8%)

Query: 18  ACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGAT 77
           + T G ++  G     + PLD++K + Q +P  ++    G I+ILK EG G L+ G G T
Sbjct: 121 SATAGSLIGIGEI--VLLPLDVLKIKRQTNPESFKGR--GFIKILKDEGFG-LYRGWGWT 175

Query: 78  CIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFE 137
               +      +GG   F + Y   L KD ++A   +  +  +  A+A     I+  P +
Sbjct: 176 AARNAPGSFALFGG-NAFAKEYILGL-KDYSSATWSQNFVSSIVGASASL---IVSAPLD 230

Query: 138 AIKVKQQTTMPPWCNNVIEGWK---KMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194
            IK + Q       +N   G++        EG+  F+KG+TP      P  +  F   + 
Sbjct: 231 VIKTRIQNRH---FDNPESGFRIVQNTLKNEGITAFFKGLTPKLLTTGPKLVFSFALAQS 287

Query: 195 IVEAIYARLPTK 206
           ++ A    L  K
Sbjct: 288 LIPAFDKMLGQK 299

>YPL134C (ODC1) [5311] chr16 complement(298570..299502)
           2-Oxodicarboxylate transporter, has specificity for
           2-oxoadipate and 2-oxoglutarate, member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [933 bp, 310 aa]
          Length = 310

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/266 (22%), Positives = 111/266 (41%), Gaps = 31/266 (11%)

Query: 36  PLDLIKCRLQVDPTL---------------YRSNTSGIIQILKKEGLGKLFTGVGATCIG 80
           PLD++K R+Q+  T                Y      + +I+KKEG   L+ G+ +  + 
Sbjct: 31  PLDVVKTRMQLQVTTKGHPAVVAAKAAVDHYTGVMDCLTKIVKKEGFSHLYKGITSPILM 90

Query: 81  YSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIK 140
            + + A K+ G + F+  Y   +          + +IY  S A+A      ++ PFE +K
Sbjct: 91  EAPKRAIKFSGNDTFQTFYK-KIFPTPNGEMTQKIAIY--SGASAGAVEAFVVAPFELVK 147

Query: 141 VKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIY 200
           ++ Q     +    IE  K    K G+   + G+     R + +    F     I+  I 
Sbjct: 148 IRLQDVNSQF-KTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFG----IIFQIR 202

Query: 201 ARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNE----RKVNESMNV 256
             LP  K   ++ ++     + G + G +  +++ P DV+ S+I       RK N S+  
Sbjct: 203 KLLPAAK---TSTEKTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKYNWSLPS 259

Query: 257 ALKRIYSRIGFVGLWNGLPVRILMIG 282
            L  +Y   GF  L+ G   +++ + 
Sbjct: 260 VL-LVYREEGFKALYKGFAPKVMRLA 284

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 64/152 (42%), Gaps = 8/152 (5%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           V P +L+K RLQ   + +++    +   + K G+  LF G+ AT   + L  AG +G   
Sbjct: 140 VAPFELVKIRLQDVNSQFKTPIEVVKNSVVKGGVLSLFNGLEATIWRHVLWNAGYFGIIF 199

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPW--C 151
             ++L        E      +T   L++ A       ++  PF+ +K + Q +  P    
Sbjct: 200 QIRKLLPAAKTSTE------KTRNDLIAGAIGGTVGCLLNTPFDVVKSRIQRSSGPLRKY 253

Query: 152 NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183
           N  +     +Y +EG    YKG  P   R  P
Sbjct: 254 NWSLPSVLLVYREEGFKALYKGFAPKVMRLAP 285

>KLLA0B12826g 1121106..1122065 similar to sp|P32332 Saccharomyces
           cerevisiae YKL120w PMT, start by similarity
          Length = 319

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 86/201 (42%), Gaps = 19/201 (9%)

Query: 14  EYYAACTLGGIVACGPTHSSV-----TPLDLIKCRLQV--------DPTLYRSNTSGIIQ 60
           E +    +G  VA G T   V     +PL L+K R+Q           T Y S  +G+  
Sbjct: 119 ESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYSNAIHIGQQTHYTSAFNGLAT 178

Query: 61  ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL 120
           I + EG+  LF GV A  +   +  A +   Y + K     H + ++ T       ++LL
Sbjct: 179 IFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFLLKHDLMNDGTG------LHLL 232

Query: 121 SSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR 180
           SS  A F   + + P++ +  +         +  I+ + K    EGL+  YKG      R
Sbjct: 233 SSTIAGFGVGVAMNPWDVVLTRVYNQKGNLYSGPIDCFIKTVRNEGLSALYKGFGAQILR 292

Query: 181 QIPYTMCKFTSFERIVEAIYA 201
             P+T+   T  E+ ++ +Y+
Sbjct: 293 IGPHTVLCLTFMEQTLKLVYS 313

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 73/180 (40%), Gaps = 17/180 (9%)

Query: 135 PFEAIKVKQQTTMPPWCN------NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
           PF+ +K + Q       N      N I+ +  ++  EG+ G  KG+   +  QI     +
Sbjct: 40  PFDCVKTRMQLQGELHANAAKVYTNPIQAFGVIFKNEGIAGLQKGLASAYLYQIALNGSR 99

Query: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSK----- 243
              +E I   I   +     E   +Q I ++   G  +G++ A +  P  ++ ++     
Sbjct: 100 LGFYEPI-RGILNNVFYPNVESHKVQHIGINVAAGATSGVVGAFIGSPLFLVKTRMQSYS 158

Query: 244 ----INNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
               I  +     + N  L  I+   G  GL+ G+   +L  G  ++ Q  IY+  K ++
Sbjct: 159 NAIHIGQQTHYTSAFN-GLATIFRSEGIKGLFRGVDAAMLRTGIGSAVQLPIYNICKNFL 217

>CAGL0J01661g 154646..155629 highly similar to tr|Q12251
           Saccharomyces cerevisiae YPR011c, start by similarity
          Length = 327

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 69/323 (21%), Positives = 131/323 (40%), Gaps = 46/323 (14%)

Query: 3   KTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT---SGII 59
           + ++ ++ + K+      L G +A   + + V+P + +K  LQV  +    N      I 
Sbjct: 10  EEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIG 69

Query: 60  QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHL--VKDEATAYKYRTSI 117
           Q+ K+E +  LF G G  CI      A ++  +E  K+    H+  V  +    +     
Sbjct: 70  QVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEGCKK----HIFHVDTKGKGEQLNNWQ 125

Query: 118 YLLSSATAEFFADIMLCPFEAIKVK----------------QQTTMPPWCNNVIEGWK-- 159
            L S A     + +   P + ++ +                     PP        WK  
Sbjct: 126 RLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGV------WKLL 179

Query: 160 -KMYAKEG-LNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQIS 217
            K YA+EG + G Y+G+ P     +PY    F  +E++ E     +P+ ++  S+++   
Sbjct: 180 SKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEF----MPSDENGNSSMRDSL 235

Query: 218 VSFVGGYMAGILCAIVSHPADVMVSKIN------NERKVN-ESMNVALKRIYSRIGFVGL 270
                G ++G +   +++P D++  +        NE   +  S+  AL  I    GF G 
Sbjct: 236 YKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWDALVTIGKTEGFKGY 295

Query: 271 WNGLPVRILMIGTLTSFQWLIYD 293
           + GL   +  +   T+  WL+Y+
Sbjct: 296 YKGLTANLFKVVPSTAVSWLVYE 318

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 92/212 (43%), Gaps = 22/212 (10%)

Query: 112 KYRTSIYLLSSATAEFFADIMLCPFEAIKV--KQQTTMPPWCNNVIEGWKKMYAKEGLNG 169
           K  T++  L+   A   +  ++ PFE +K+  + Q++   +   + +   ++Y +E + G
Sbjct: 20  KQDTNVAFLAGGIAGAISRTVVSPFERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKG 79

Query: 170 FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGIL 229
            ++G      R  PY+  +F  FE   + I+      K E   L      F G    G  
Sbjct: 80  LFRGNGLNCIRVFPYSAVQFVVFEGCKKHIFHVDTKGKGEQ--LNNWQRLFSGALCGG-- 135

Query: 230 CAIV-SHPADVM----------VSKINNERKVNESMNVALKRIYSRI-----GFVGLWNG 273
           C++V ++P D++          +SK++  R  + +    + ++ S+      G +GL+ G
Sbjct: 136 CSVVATYPLDLVRTRLSVQTANLSKLSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRG 195

Query: 274 LPVRILMIGTLTSFQWLIYDSFKAYVGLPTSG 305
           +    L I    +  + +Y+  K ++    +G
Sbjct: 196 VWPTSLGIVPYVALNFAVYEQLKEFMPSDENG 227

>Scas_632.9
          Length = 292

 Score = 57.0 bits (136), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 80/172 (46%), Gaps = 21/172 (12%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQ----------ILKKEGLGKLFTGVGATCIGYSL 83
           +TP++LIKC+LQV     ++   G I+          +L+++G+  L+ G  +T I  SL
Sbjct: 129 LTPVELIKCKLQVSN--LQTAVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESL 186

Query: 84  QGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQ 143
            G   +  YE+ K+      +KD     + +T   L+S A+A    +  + P + +K   
Sbjct: 187 GGVAWFATYEVMKQG-----LKDRRKDTENKTWELLVSGASAGLAFNASIFPADTVKSMM 241

Query: 144 QTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
           QT      N V    KK+    G+ GFY+G+     R +P     F  +E +
Sbjct: 242 QTEHITLINAV----KKVLTTYGITGFYRGLGITLIRAVPANATVFYMYETL 289

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 110/256 (42%), Gaps = 31/256 (12%)

Query: 36  PLDLIKCRLQVDPT-LYRSNTSGIIQILKKEGLGK-LFTGVGATCIGYSLQGAGKYGGYE 93
           P D +K RLQ   + ++ +  S I      EG+ +  F G+G+   G +L+ A       
Sbjct: 37  PFDTVKVRLQTQGSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSPLFGAALENA------T 90

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNN 153
           LF        V ++ T     ++I LLS A A   A  +L P E IK K Q +       
Sbjct: 91  LFVSYNQCSNVLEKFTNVSPLSNI-LLSGAFAGSCASFVLTPVELIKCKLQVSN---LQT 146

Query: 154 VIEGWKK--------MYA--KEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARL 203
            +EG  K        MY   ++G+ G ++G +  + R+    +  F ++E + + +  R 
Sbjct: 147 AVEGQIKHTKIIPTLMYVLREKGILGLWQGQSSTFIRESLGGVAWFATYEVMKQGLKDRR 206

Query: 204 PTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYS 263
              +++   L       V G  AG+       PAD + S +  E     ++  A+K++ +
Sbjct: 207 KDTENKTWEL------LVSGASAGLAFNASIFPADTVKSMMQTEHI---TLINAVKKVLT 257

Query: 264 RIGFVGLWNGLPVRIL 279
             G  G + GL + ++
Sbjct: 258 TYGITGFYRGLGITLI 273

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 73/165 (44%), Gaps = 19/165 (11%)

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGL-NGFYKGI-TP 176
           +++ + A  F  I+  PF+ +KV+ QT             K  Y  EG+  GF++GI +P
Sbjct: 21  IVNGSIAGAFGKIIEYPFDTVKVRLQTQGSHIFPTTWSCIKYTYHNEGVWRGFFQGIGSP 80

Query: 177 LWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHP 236
           L+   +      F S+ +      + +  K + +S L  I +S   G  AG   + V  P
Sbjct: 81  LFGAALENATL-FVSYNQC-----SNVLEKFTNVSPLSNILLS---GAFAGSCASFVLTP 131

Query: 237 ADVMVSK--INN-----ERKVNESMNV-ALKRIYSRIGFVGLWNG 273
            +++  K  ++N     E ++  +  +  L  +    G +GLW G
Sbjct: 132 VELIKCKLQVSNLQTAVEGQIKHTKIIPTLMYVLREKGILGLWQG 176

>Scas_716.29
          Length = 316

 Score = 57.4 bits (137), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 91/205 (44%), Gaps = 19/205 (9%)

Query: 100 STHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWK 159
           + HL K E      + S  L++ + +   A  ++ P + +K++ Q   P +      G  
Sbjct: 11  TDHLRKGEDV----KVSQSLVAGSVSGLLARTVIAPLDTLKIRLQLR-PSYTGQAPSGLL 65

Query: 160 KMYA-----KEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQ 214
           KM       + GL  F+KG  P     + Y   +F+S+     + Y  L  + S+M+   
Sbjct: 66  KMMKGMILNEGGLRSFWKGNVPGTMMYVLYGGAQFSSY-----SFYNNLFGETSDMNGQL 120

Query: 215 QISVSFVGGYMAGILCAIVSHPADVMVSK-INNERKVNESMNVALKRIYSRIGFVGLWNG 273
           Q   S V G +AG+  + VS+P DV+ ++ I N+     S++   K I++  G  G + G
Sbjct: 121 Q---SLVVGALAGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRG 177

Query: 274 LPVRILMIGTLTSFQWLIYDSFKAY 298
               +  I    S  +  Y+S K Y
Sbjct: 178 CTASMFTITLSASILFGTYESIKIY 202

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 107/248 (43%), Gaps = 24/248 (9%)

Query: 18  ACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ-----ILKKEGLGKLFT 72
           A ++ G++A     + + PLD +K RLQ+ P+      SG+++     IL + GL   + 
Sbjct: 28  AGSVSGLLA----RTVIAPLDTLKIRLQLRPSYTGQAPSGLLKMMKGMILNEGGLRSFWK 83

Query: 73  GVGATCIGYSLQGAGKYGGYELFKRLY-STHLVKDEATAYKYRTSIYLLSSATAEFFADI 131
           G     + Y L G  ++  Y  +  L+  T  +  +  +        L+  A A   +  
Sbjct: 84  GNVPGTMMYVLYGGAQFSSYSFYNNLFGETSDMNGQLQS--------LVVGALAGMTSSF 135

Query: 132 MLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
           +  P + ++ +         +++  G K+++  EG+ GF++G T             F +
Sbjct: 136 VSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLSASILFGT 195

Query: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN 251
           +E I   IY    +K+S+ +   + S S +    +G+   +V++P D +  +I     V 
Sbjct: 196 YESI--KIYCDEYSKESDYTNYLRYSASSI----SGVTSKMVTYPLDTIRRRIQVRNSVY 249

Query: 252 ESMNVALK 259
              NV  K
Sbjct: 250 VQHNVENK 257

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 41/191 (21%), Positives = 80/191 (41%), Gaps = 25/191 (13%)

Query: 27  CGPTHSSVT-PLDLIKCRLQVDPTLYRSNTS-GIIQILKKEGLGKLFTGVGATCIGYSLQ 84
            G T S V+ P D+++ R   +  +  S+ S G  +I   EG+   F G  A+    +L 
Sbjct: 129 AGMTSSFVSYPTDVLRTRFIANQDVALSSLSHGCKEIWNMEGIPGFFRGCTASMFTITLS 188

Query: 85  GAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ 144
            +  +G YE  K +Y     K+       R S   +S  T++    ++  P + I+ + Q
Sbjct: 189 ASILFGTYESIK-IYCDEYSKESDYTNYLRYSASSISGVTSK----MVTYPLDTIRRRIQ 243

Query: 145 TTMPPWCNNVIEG---------WK---------KMYAKEGLNGFYKGITPLWCRQIPYTM 186
                +  + +E          +K          +  +EGL   Y+G++   C+ +P T+
Sbjct: 244 VRNSVYVQHNVENKIVTEIYQSYKGASFIRMGLNILRQEGLLSLYQGVSMSLCKTVPSTV 303

Query: 187 CKFTSFERIVE 197
               ++E ++ 
Sbjct: 304 VSLWAYETVMR 314

>Scas_589.10
          Length = 316

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 111/264 (42%), Gaps = 36/264 (13%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGII---------------QILKKEGLGKLFTGVGATCIG 80
           PLD++K R Q+        TS +                +ILK+EG   L+ G+    + 
Sbjct: 33  PLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKEEGFKNLYKGMSPPLLM 92

Query: 81  YSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIK 140
              + A K+   E F+++        E T     +++ LL+   A     +++ PFE +K
Sbjct: 93  EVPKRAVKFASNEQFQQIMMKKFKLKEVT-----STVTLLAGTFAGITESLIVVPFELVK 147

Query: 141 VKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIY 200
           ++ Q     +  + I   + +   +GL G Y G      R   +      S+  ++  + 
Sbjct: 148 IRLQDAQSDY-RSPIRCTRTIIENQGLFGIYAGFESTIWRNTIWN----ASYFGLIFQVK 202

Query: 201 ARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESM------ 254
             +P  KS  +  Q I   F+ G +AG +   +S P DV+ +++   +K +  M      
Sbjct: 203 KFIPRAKST-TKFQGIRNDFLVGAIAGCMSCFLSVPFDVVKTRMQGSKKTSSGMCYGWAW 261

Query: 255 -NVALKRIYSRIGFVGLWNG-LPV 276
            +V L  IY   G  G++ G LP+
Sbjct: 262 QSVFL--IYRTEGIKGIYKGILPI 283

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 76/177 (42%), Gaps = 11/177 (6%)

Query: 13  KEYYAACTLGGIVACGPTHS-SVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLF 71
           KE  +  TL      G T S  V P +L+K RLQ   + YRS       I++ +GL  ++
Sbjct: 118 KEVTSTVTLLAGTFAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIY 177

Query: 72  TGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADI 131
            G  +T    ++  A  +G     K+     + + ++T          L  A A   +  
Sbjct: 178 AGFESTIWRNTIWNASYFGLIFQVKKF----IPRAKSTTKFQGIRNDFLVGAIAGCMSCF 233

Query: 132 MLCPFEAIKVKQQTTMPPWCNNVIEGWK-----KMYAKEGLNGFYKGITPLWCRQIP 183
           +  PF+ +K + Q +     + +  GW       +Y  EG+ G YKGI P+ CR  P
Sbjct: 234 LSVPFDVVKTRMQGSKKT-SSGMCYGWAWQSVFLIYRTEGIKGIYKGILPIICRYGP 289

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 73/170 (42%), Gaps = 20/170 (11%)

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTM--------------PPWCNNVIEGWKKMYAK 164
            +S A A     IM+ P + +K + Q  +               P  ++++    K+  +
Sbjct: 17  FISGAVAGMSETIMMYPLDVVKTRFQLQINKKALATSSVAVPKQPEHSSILSCLSKILKE 76

Query: 165 EGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGY 224
           EG    YKG++P    ++P    KF S E+  + +  +   K  E+++    +V+ + G 
Sbjct: 77  EGFKNLYKGMSPPLLMEVPKRAVKFASNEQFQQIMMKKFKLK--EVTS----TVTLLAGT 130

Query: 225 MAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
            AGI  +++  P +++  ++ + +    S     + I    G  G++ G 
Sbjct: 131 FAGITESLIVVPFELVKIRLQDAQSDYRSPIRCTRTIIENQGLFGIYAGF 180

>Kwal_23.4354
          Length = 343

 Score = 56.6 bits (135), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 107/257 (41%), Gaps = 25/257 (9%)

Query: 43  RLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTH 102
           R +  P  Y S      +I K EG+  L+ G+  T +  +      + GYE    L    
Sbjct: 76  RCKTSPVRYNSTWDAFGKIAKIEGVQSLWRGLSITLLMAAPANMVYFIGYE---SLRDKS 132

Query: 103 LVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQT--------TMPPWCNNV 154
            ++D     KY T   L+  A A   A   + P E  + + Q+        T      ++
Sbjct: 133 RLQD-----KYPTLNPLMCGALARVLAATTVAPLELFRTRLQSIPRSSPKSTTAMMIKDL 187

Query: 155 IEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE--RIVEAIYARLPTKKSEMSA 212
           I+  +   +K G    ++G+     R +P++   +  +E  +   +I +      S  S 
Sbjct: 188 IKESRYEISKVGYKALFRGLEITLWRDVPFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSN 247

Query: 213 LQQISVSFVGGYMAGILCAIVSHPADV-----MVSKINN--ERKVNESMNVALKRIYSRI 265
                 SFVGG   G + A+++HP DV      ++ +N+  E+K +++M   L ++    
Sbjct: 248 WNHFVNSFVGGSFGGAVAAVLTHPFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSE 307

Query: 266 GFVGLWNGLPVRILMIG 282
           G   L+ GL  R++ I 
Sbjct: 308 GLAALYTGLVPRVIKIA 324

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 11/93 (11%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQV---DPTLYRSNTSGII----QILKKEGLG 68
           +   + GG VA   TH    P D+ K R+Q+   + TL +  +  +     Q+ K EGL 
Sbjct: 255 FVGGSFGGAVAAVLTH----PFDVGKTRMQITYLNSTLEKKPSKNMFKYLNQMRKSEGLA 310

Query: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYST 101
            L+TG+    I  +   A     YE+ KRL+ST
Sbjct: 311 ALYTGLVPRVIKIAPSCAIMISTYEVCKRLFST 343

 Score = 36.2 bits (82), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 74/183 (40%), Gaps = 24/183 (13%)

Query: 32  SSVTPLDLIKCRLQVDP-TLYRSNTSGIIQILKKE--------GLGKLFTGVGATCIGYS 82
           ++V PL+L + RLQ  P +  +S T+ +I+ L KE        G   LF G+  T     
Sbjct: 156 TTVAPLELFRTRLQSIPRSSPKSTTAMMIKDLIKESRYEISKVGYKALFRGLEITLWRDV 215

Query: 83  LQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF---FADIMLCPFEAI 139
              +  +G YE +K   S    K    +     + ++ S     F    A ++  PF+  
Sbjct: 216 PFSSIYWGCYEFYKSNVSIDSEKSIVNSSNSNWNHFVNSFVGGSFGGAVAAVLTHPFDVG 275

Query: 140 KVKQQTTMPPWCNNVIEG---------WKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFT 190
           K + Q T   + N+ +E            +M   EGL   Y G+ P   +  P      +
Sbjct: 276 KTRMQIT---YLNSTLEKKPSKNMFKYLNQMRKSEGLAALYTGLVPRVIKIAPSCAIMIS 332

Query: 191 SFE 193
           ++E
Sbjct: 333 TYE 335

>CAGL0G08910g complement(853693..854562) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1, hypothetical
           start
          Length = 289

 Score = 55.8 bits (133), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 129/293 (44%), Gaps = 30/293 (10%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLG-------KLFTG 73
           + G+ A   T   V PLDL K RLQ+   L  S T    + L  E +G       +L+ G
Sbjct: 13  ISGLTAGSVTTLIVHPLDLFKVRLQL---LITSTTKKGYRNLWSEIVGSDLSLTRELYRG 69

Query: 74  VGATCIGYSLQGAGKYGGYELFKR--LYSTHLVKDEATAYKYRTSIYLLSSATAEFFADI 131
           +    +G ++     +  Y + K   +   H ++++     +   +YL +SA++     +
Sbjct: 70  LTVNLVGNTIAWGLYFASYRVAKDYLINYNHRIRNDKDLSSW---MYLSASASSGMLTTV 126

Query: 132 MLCPFEAIKVKQQTTMPPWCNNVIEGWK---KMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
           +  P   IK    T M    N+ +   K    +   +G+ G +KG+ P     +      
Sbjct: 127 LTNPLWVIK----TRMMSKANSDLTSMKVLRDLIKNDGVQGLWKGLVPALV-GVSQGALH 181

Query: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINN-E 247
           FT ++ +   +  +      E++ L+ I+V+ V    + +L     +P  ++ S + + +
Sbjct: 182 FTCYDTLKHKLVLK-NRDSDEITNLETIAVTSV----SKMLSTSAVYPFQLLKSNLQSFQ 236

Query: 248 RKVNESMNVAL-KRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
              N+   + L K IYSR G +G + GL   +L     T   + IY++FK+++
Sbjct: 237 ASENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYENFKSFL 289

>YHR002W (LEU5) [2287] chr8 (108806..109879) Protein with similarity
           to Grave's disease protein, member of the mitochondrial
           carrier (MCF) family of membrane transporters [1074 bp,
           357 aa]
          Length = 357

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 70/143 (48%), Gaps = 17/143 (11%)

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCN------NVIEGWKKMYAKEGLNGFYKGITPLWCRQI 182
           A  ++ P + IK+  QT+ P +         ++E  K ++  +G+ GF++G +    R  
Sbjct: 47  AKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRIF 106

Query: 183 PYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242
           PY   KF ++E+I   +   +P+K+ E    + +S     G +AG+    +++P D++  
Sbjct: 107 PYAAVKFVAYEQIRNTL---IPSKEFESHWRRLVS-----GSLAGLCSVFITYPLDLVRV 158

Query: 243 KINNERKVNESMNVALKRIYSRI 265
           ++  E    E   V L RI  +I
Sbjct: 159 RLAYE---TEHKRVKLGRIIKKI 178

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 61/348 (17%), Positives = 132/348 (37%), Gaps = 63/348 (18%)

Query: 5   KSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILK- 63
           K+  +  + +Y     L G ++     + + PLD IK   Q     Y   T  +I +++ 
Sbjct: 22  KTSFDRNSFDYIVRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLIGLVEA 81

Query: 64  ------KEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSI 117
                  +G+   F G  AT +      A K+  YE   ++ +T +   E  ++  R   
Sbjct: 82  AKHIWINDGVRGFFQGHSATLLRIFPYAAVKFVAYE---QIRNTLIPSKEFESHWRR--- 135

Query: 118 YLLSSATAEFFADIMLCPFEAIKV---------------------KQQTTMPPWCNNVIE 156
            L+S + A   +  +  P + ++V                     K+  +     N+ I 
Sbjct: 136 -LVSGSLAGLCSVFITYPLDLVRVRLAYETEHKRVKLGRIIKKIYKEPASATLIKNDYIP 194

Query: 157 GWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI-------YARLP-TKKS 208
            W   +       FY+G  P     IPY    F + + + + +       Y+ L  ++  
Sbjct: 195 NWFCHWC-----NFYRGYVPTVLGMIPYAGVSFFAHDLLHDVLKSPFFAPYSVLELSEDD 249

Query: 209 EMSALQQIS-------VSFVGGYMAGILCAIVSHPADVM-----VSKINNERKVN---ES 253
           E+  +Q+            + G +AG+     ++P +++     VS ++ +   +   +S
Sbjct: 250 ELERVQKKQRRPLRTWAELISGGLAGMASQTAAYPFEIIRRRLQVSALSPKTMYDHKFQS 309

Query: 254 MNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGL 301
           ++     I+   G  G + GL +  + +  + +  + +Y+  K   G+
Sbjct: 310 ISEIAHIIFKERGVRGFFVGLSIGYIKVTPMVACSFFVYERMKWNFGI 357

>Kwal_33.14050
          Length = 314

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 72/304 (23%), Positives = 128/304 (42%), Gaps = 48/304 (15%)

Query: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQ-VDPTLYRSNT-----SGIIQILKK----EG 66
           AA    GI+     HS + P+D IK R+Q +  T+  +N      S I+Q + +    EG
Sbjct: 21  AAGAFAGIM----EHSIMFPIDAIKTRMQALSATIGSANAAAKLPSNIVQQIARISTTEG 76

Query: 67  LGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLV--KDEATAYKYRTSIYLLSSAT 124
              L+ GV +  +G     A  +  YE+ K    ++L+  +D  T    +T+   +++  
Sbjct: 77  SMALWKGVQSVILGAGPAHAVYFATYEMCK----SYLIDPQDFQTHQPLKTAASGIAATV 132

Query: 125 AEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWK---KMYAKEGLNGFYKGITPLWCRQ 181
           A   AD+++ PF+ IK + Q  +  +  + +  W    ++Y  EGL  F+          
Sbjct: 133 A---ADLLMNPFDTIKQRMQ--LRTFSKDRM--WSVASRIYRNEGLAAFFYSYPTTIAMN 185

Query: 182 IPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMV 241
           IP+    F  +E           TK           +  + G ++G  CA ++ P D + 
Sbjct: 186 IPFAAFNFAIYESA---------TKFFNPENTYNPLIHCLCGGISGATCAAITTPLDCIK 236

Query: 242 SKIN---NERKVN------ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIY 292
           + +    +E  V+      ++ + A   I    G+ G W GL  RI+     T+  W  Y
Sbjct: 237 TVLQVRGSESVVDPLFRQADTFSRAASAISKVYGWSGFWRGLKPRIISNMPATAISWTAY 296

Query: 293 DSFK 296
           +  K
Sbjct: 297 ECAK 300

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 40/203 (19%), Positives = 72/203 (35%), Gaps = 20/203 (9%)

Query: 106 DEATAYK-YRTSIYLLSSATAEFFADIM----LCPFEAIKVKQQ---------TTMPPWC 151
           DE   Y+   T+  L     A  FA IM    + P +AIK + Q                
Sbjct: 2   DEEIDYESLPTNAPLTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANAAAKLP 61

Query: 152 NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMS 211
           +N+++   ++   EG    +KG+  +     P     F ++E     +         +  
Sbjct: 62  SNIVQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYL-----IDPQDFQ 116

Query: 212 ALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLW 271
             Q +  +   G  A +   ++ +P D +  ++       + M     RIY   G    +
Sbjct: 117 THQPLKTA-ASGIAATVAADLLMNPFDTIKQRMQLRTFSKDRMWSVASRIYRNEGLAAFF 175

Query: 272 NGLPVRILMIGTLTSFQWLIYDS 294
              P  I M     +F + IY+S
Sbjct: 176 YSYPTTIAMNIPFAAFNFAIYES 198

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 44/116 (37%), Gaps = 17/116 (14%)

Query: 197 EAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNV 256
           E  Y  LPT          ++     G  AGI+   +  P D + +++        S N 
Sbjct: 4   EIDYESLPTNAP-------LTHQLAAGAFAGIMEHSIMFPIDAIKTRMQALSATIGSANA 56

Query: 257 ALK----------RIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLP 302
           A K          RI +  G + LW G+   IL  G   +  +  Y+  K+Y+  P
Sbjct: 57  AAKLPSNIVQQIARISTTEGSMALWKGVQSVILGAGPAHAVYFATYEMCKSYLIDP 112

>KLLA0F03212g 302915..303832 highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w ACR1 succinate-fumarate
           transporter, start by similarity
          Length = 305

 Score = 55.8 bits (133), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 56/275 (20%), Positives = 114/275 (41%), Gaps = 29/275 (10%)

Query: 36  PLDLIKCRLQVDPTLYRSNTS--GII----QILKKEGLGKLFTGVGATCIGYSLQGAGKY 89
           PLD IK R+Q+      S     G I    +I + EG    + G+GA  IG + + A ++
Sbjct: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGGEIYRNEGFLAFYKGLGAVVIGITPKMAIRF 89

Query: 90  GGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMP- 148
             YE ++ L +    K+        T I  + +   E    +       I+++ Q   P 
Sbjct: 90  SSYEFYRTLLAD---KETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQHLNPV 146

Query: 149 ---PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPT 205
              P   N ++    +  +EG +  Y+G++    RQ       FT + ++ E +      
Sbjct: 147 EGAPKYKNAVQACYTIVKEEGFSALYRGVSLTAARQATNQGANFTVYSKLKEFLQG---Y 203

Query: 206 KKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN-----ESMNVALKR 260
              EM  L     S + G ++G +    + P D + +++  ++        + + +  K+
Sbjct: 204 HNQEM--LPSWETSLI-GLISGAIGPFSNAPLDTIKTRLQKDKSTKNMSGLKRITIIGKQ 260

Query: 261 IYSRIGFVGLWNGLPVRILMIG-----TLTSFQWL 290
           +    GF  L+ G+  R++ +      T T+++++
Sbjct: 261 LIQEEGFRALYKGITPRVMRVAPGQAVTFTAYEFI 295

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 11/79 (13%)

Query: 26  ACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGI-------IQILKKEGLGKLFTGVGATC 78
           A GP  ++  PLD IK RLQ D +    N SG+        Q++++EG   L+ G+    
Sbjct: 223 AIGPFSNA--PLDTIKTRLQKDKST--KNMSGLKRITIIGKQLIQEEGFRALYKGITPRV 278

Query: 79  IGYSLQGAGKYGGYELFKR 97
           +  +   A  +  YE  ++
Sbjct: 279 MRVAPGQAVTFTAYEFIRK 297

>Kwal_23.3042
          Length = 542

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 60/249 (24%), Positives = 108/249 (43%), Gaps = 17/249 (6%)

Query: 61  ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL 120
           + ++ G+   + G G   +    + A K+G +EL KRL +  L   + TA   R S YL 
Sbjct: 292 LYRQGGIRAFYVGNGLNAMKVFPESAIKFGSFELAKRLMA-QLEGVQDTAGLSRFSTYL- 349

Query: 121 SSATAEFFADIMLCPFEAIKVKQQ----TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITP 176
           +       A + + P + +K + Q     T       +I   K MY + GL  FY+GIT 
Sbjct: 350 AGGLGGVMAQLSVYPIDTLKYRVQCAPLNTESKGRQLLISTAKDMYKEGGLRIFYRGITV 409

Query: 177 LWCRQIPYTMCKFTSFERIVE---AIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIV 233
                 PY      +F  + +   A  ARL     +   +  + V  +G + +G + A  
Sbjct: 410 GIMGIFPYAAMDLGTFSALKKWYIARQARLTGLPEDQVTMSNMFVLLMGAF-SGTVGATA 468

Query: 234 SHPADVMVSKINNE------RKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSF 287
            +P +++ +++  +       + N   +V LK +  R G+ GL+ GL   +  +    S 
Sbjct: 469 VYPVNLLRTRLQAQGTFAHPHRYNGFRDVLLKTV-QREGYQGLFKGLVPNLAKVCPAVSI 527

Query: 288 QWLIYDSFK 296
            +L Y++ K
Sbjct: 528 SYLCYENLK 536

>Kwal_14.2210
          Length = 315

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 128/307 (41%), Gaps = 42/307 (13%)

Query: 22  GGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTS---GIIQILKKEGLGKLFTGVGATC 78
            G +A   + + V+P + +K  LQV  + +  N      + Q+  +EG+  L  G G  C
Sbjct: 23  AGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGNGLNC 82

Query: 79  IGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEA 138
           I      A ++  YE  K+ +      D      +R    L+S A     + +   P + 
Sbjct: 83  IRIFPYSAVQFLVYEFCKKQWFQQ-NPDTVVLNWHR----LVSGALCGGCSVLATYPLDL 137

Query: 139 IKVK----------------QQTTMPPWCNNVIEGWKKMYAKEG-LNGFYKGITPLWCRQ 181
           ++ +                     PP    V E  +K Y +EG + G Y+G+ P     
Sbjct: 138 VRTRLSIQTANLARLHKAKAASAAKPP---GVWELLRKTYTQEGGIFGLYRGVWPTSIGV 194

Query: 182 IPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMV 241
           +PY    F  +E++ E I A      +   +L ++S+    G ++G +   +++P D++ 
Sbjct: 195 VPYVALNFAVYEQLREYIPASFDPASA---SLYKLSI----GAISGGVAQTITYPFDLLR 247

Query: 242 SKIN------NERKVN-ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDS 294
            +        +E   + +S+  AL  I    GF G + GL   +  +   T+  W++Y++
Sbjct: 248 RRFQVLAMGQSELGFHYKSVPDALITIGRTEGFKGYYKGLTANLFKVVPSTAVSWVVYET 307

Query: 295 FKAYVGL 301
            + Y+ L
Sbjct: 308 VRDYMQL 314

 Score = 32.7 bits (73), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 40/86 (46%), Gaps = 2/86 (2%)

Query: 110 AYKYRTSIYLLSSATAEFFADIMLCPFEAIKV--KQQTTMPPWCNNVIEGWKKMYAKEGL 167
           A K    I   +   A   +  ++ PFE +K+  + Q++   + + +    K++Y +EG+
Sbjct: 12  ALKSDAGIAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGV 71

Query: 168 NGFYKGITPLWCRQIPYTMCKFTSFE 193
            G  +G      R  PY+  +F  +E
Sbjct: 72  PGLLRGNGLNCIRIFPYSAVQFLVYE 97

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 39/79 (49%), Gaps = 3/79 (3%)

Query: 218 VSFVGGYMAGILCAIVSHPAD---VMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
           ++F  G +AG +   V  P +   +++   ++    N  +  A+K++Y   G  GL  G 
Sbjct: 19  IAFCAGGIAGAVSRTVVSPFERVKILLQVQSSTHAYNHGLFRAVKQVYLEEGVPGLLRGN 78

Query: 275 PVRILMIGTLTSFQWLIYD 293
            +  + I   ++ Q+L+Y+
Sbjct: 79  GLNCIRIFPYSAVQFLVYE 97

>Scas_721.129
          Length = 323

 Score = 54.7 bits (130), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 84/180 (46%), Gaps = 17/180 (9%)

Query: 135 PFEAIKVKQQ------TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
           P E +K++ Q              N I+G   ++  EG+ G  KG+   +  QI     +
Sbjct: 41  PIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIRGLQKGLVAAYIYQIGLNGSR 100

Query: 189 FTSFERIVEAIYARL-PTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI--- 244
              +E I  A+ +   P ++S    +Q++S++   G  +GI+ A++  P  ++ +++   
Sbjct: 101 LGFYEPIRNALNSTFYPNEESH--KIQKVSINVAAGASSGIIGAVIGSPLFLVKTRMQSY 158

Query: 245 NNERKVNESM---NV--ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           ++  K+ E     NV   L  I    GF GL+ G+   IL  G  +S Q  IY++ K ++
Sbjct: 159 SDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 218

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/251 (21%), Positives = 101/251 (40%), Gaps = 30/251 (11%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTL-------YRSNTSGIIQILKKEGLG 68
           + +   GG+ AC    +   P++L+K R+Q+   L       YR+   G+  I + EG+ 
Sbjct: 22  FGSFIAGGMAACIAV-TFTNPIELVKIRMQLQGELAAVGQKVYRNPIQGMGVIFRNEGIR 80

Query: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFF 128
            L  G+ A  I        + G YE  +   ++    +E +    + SI + + A++   
Sbjct: 81  GLQKGLVAAYIYQIGLNGSRLGFYEPIRNALNSTFYPNEESHKIQKVSINVAAGASSGII 140

Query: 129 ADIMLCPF-----------EAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPL 177
             ++  P            +AIK+ +QT       NV  G   +   EG  G ++GI   
Sbjct: 141 GAVIGSPLFLVKTRMQSYSDAIKIGEQT----HYRNVWNGLSTIARTEGFKGLFRGIDAA 196

Query: 178 WCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237
             R    +  +   +      +      K      L   ++S +G        A+V +P 
Sbjct: 197 ILRTGAGSSVQLPIYNTAKNFLLKNDLMKDGPGLHLTASTISGLG-------VAVVMNPW 249

Query: 238 DVMVSKINNER 248
           DV++++I N++
Sbjct: 250 DVILTRIYNQK 260

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 74/176 (42%), Gaps = 16/176 (9%)

Query: 35  TPLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86
           +PL L+K R+Q         + T YR+  +G+  I + EG   LF G+ A  +      +
Sbjct: 146 SPLFLVKTRMQSYSDAIKIGEQTHYRNVWNGLSTIARTEGFKGLFRGIDAAILRTGAGSS 205

Query: 87  GKYGGYELFKR-LYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQT 145
            +   Y   K  L    L+KD          ++L +S  +     +++ P++ I  +   
Sbjct: 206 VQLPIYNTAKNFLLKNDLMKDGP-------GLHLTASTISGLGVAVVMNPWDVILTRIYN 258

Query: 146 TMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA 201
                    ++ + K    EG++  YKG      R  P+T+   T  E+ ++ +Y+
Sbjct: 259 QKGNLYKGPVDCFVKTVRTEGISALYKGFQAQILRIAPHTIICLTFMEQTMKLVYS 314

>AEL253W [2253] [Homologous to ScYBR192W (RIM2) - SH]
           complement(164665..165762) [1098 bp, 365 aa]
          Length = 365

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 92/200 (46%), Gaps = 24/200 (12%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTL------YRSNTSGIIQILKKEGLGKLFTGV 74
           L G  A   T ++  P+ L+K RLQ+D         Y+++   +  +++ EG+  L+ G+
Sbjct: 168 LAGATAGWATSTATNPIWLVKTRLQLDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGL 227

Query: 75  GATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL---------SSATA 125
            A+ +G S++   ++  YE  K +     +++     +   + Y+          S+  A
Sbjct: 228 SASYLG-SVESILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAA 286

Query: 126 EFFADIMLCPFEAIKVKQQTTMPPWCNN------VIEGWKKMYAKEGLNGFYKGITPLWC 179
           + FA I+  P E ++ + +    P  N       + + +  +  +EG    Y G+TP   
Sbjct: 287 KLFASILTYPHEVVRTRLR--QAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLM 344

Query: 180 RQIPYTMCKFTSFERIVEAI 199
           R +P ++  F ++E +++ +
Sbjct: 345 RTVPNSIIMFGTWELVIKLL 364

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 119/300 (39%), Gaps = 64/300 (21%)

Query: 36  PLDLIKCRLQVD--------PTLYRSN-----------TSGIIQ-ILKKEGLGKLFTGVG 75
           P D++K RLQ D            R+N           T GIIQ +  +EG   LF G+G
Sbjct: 69  PFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGLG 128

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
              +G     +  +  Y + K   S  L   +   +     I+ L+ ATA +       P
Sbjct: 129 PNLVGVIPARSINFFTYGVTKDTASRLLNDGQEAPW-----IHFLAGATAGWATSTATNP 183

Query: 136 FEAIKVKQQTTMPPWCNNVIEGWKKMYA-----------KEGLNGFYKGITPLWCRQIPY 184
              +K + Q       +   +G  + Y             EG+ G YKG++  +   +  
Sbjct: 184 IWLVKTRLQ------LDKAADGRSRRYKNSWDCLKGVMRNEGILGLYKGLSASYLGSVE- 236

Query: 185 TMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGY--------MAGILCAIVSHP 236
           ++ ++  +E++   I  R   +  ++S   + +   V  +         A +  +I+++P
Sbjct: 237 SILQWVLYEQMKHIIRQRSIEEFGDISEENKTTYMKVKEWCQRSGSAGAAKLFASILTYP 296

Query: 237 ADVMVSKINNERKVNESMN-VALKRIYSRI----GFVGLWNGL--------PVRILMIGT 283
            +V+ +++    K N  +    L + +S I    GF  +++GL        P  I+M GT
Sbjct: 297 HEVVRTRLRQAPKENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSIIMFGT 356

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 77/193 (39%), Gaps = 36/193 (18%)

Query: 134 CPFEAIKVKQQ---------TTMPPWCNNVIEGW----------KKMYAKEGLNGFYKGI 174
           CPF+ +K + Q         T      N V +G           + +Y +EG    +KG+
Sbjct: 68  CPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGL 127

Query: 175 TPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVS 234
            P     IP     F ++  + +   +RL     E   +      F+ G  AG   +  +
Sbjct: 128 GPNLVGVIPARSINFFTYG-VTKDTASRLLNDGQEAPWIH-----FLAGATAGWATSTAT 181

Query: 235 HPADVMVSKIN-------NERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTS- 286
           +P  ++ +++          R+   S +  LK +    G +GL+ GL    L  G++ S 
Sbjct: 182 NPIWLVKTRLQLDKAADGRSRRYKNSWD-CLKGVMRNEGILGLYKGLSASYL--GSVESI 238

Query: 287 FQWLIYDSFKAYV 299
            QW++Y+  K  +
Sbjct: 239 LQWVLYEQMKHII 251

>KLLA0E02772g complement(261895..262749) similar to sp|Q12375
           Saccharomyces cerevisiae YOR130c ARG11 ornithine
           transport protein of mitochondria involved in arginine
           metabolism, member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 284

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/171 (26%), Positives = 80/171 (46%), Gaps = 18/171 (10%)

Query: 34  VTPLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQG 85
           +TP++L+KC+LQV          T + S    I  ++K++GL  L+ G  +T +   L G
Sbjct: 119 LTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGLLGLWQGQLSTFVRECLGG 178

Query: 86  AGKYGGYELFK-RLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ 144
           A  +  YE+ K +  S H  + E   ++      L+S A+A    +  + P + +K   Q
Sbjct: 179 AVWFTTYEIMKMKFASLHPAEKENHTWEL-----LVSGASAGVLFNASVFPADTVKSVCQ 233

Query: 145 TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
           T       +++   KK+    G+ GFY+G+     R  P     F ++E +
Sbjct: 234 TEHV----SIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETL 280

 Score = 30.0 bits (66), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 35/69 (50%), Gaps = 3/69 (4%)

Query: 31  HSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYG 90
           ++SV P D +K   Q +   + S  + + ++L+  G+   + G+G T I  +   A  + 
Sbjct: 219 NASVFPADTVKSVCQTE---HVSIVNALKKVLRTHGITGFYRGLGITLIRAAPANATVFY 275

Query: 91  GYELFKRLY 99
            YE  K+++
Sbjct: 276 TYETLKKMF 284

>CAGL0J02002g 198226..199311 similar to sp|P40556 Saccharomyces
           cerevisiae YIL006w or sp|P39953 Saccharomyces cerevisiae
           YEL006w, hypothetical start
          Length = 361

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 82/188 (43%), Gaps = 9/188 (4%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQV------DPTLYRSNTSGIIQILKKEGLGK 69
           + + +   I A   +     P+ ++K RL +      + T Y+       +I+ +EG+  
Sbjct: 168 FVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKA 227

Query: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129
           L+ G+  + +G  L  A  +  YE  K  +  +   + +   K      +L+S+ ++  A
Sbjct: 228 LYAGLVPSLLGL-LHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVA 286

Query: 130 DIMLCPFEAIKVKQQ--TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187
            ++  P E ++ + Q  + +P     +I   K  Y +EG+ GFY G      R +P +  
Sbjct: 287 SVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAI 346

Query: 188 KFTSFERI 195
              SFE +
Sbjct: 347 TLVSFEYV 354

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/296 (19%), Positives = 121/296 (40%), Gaps = 42/296 (14%)

Query: 18  ACTLGGIVACGPTHSSVTPLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGK 69
           A  L GIV C        PLD+ K RLQ         +   YR +   +  I++ EG+  
Sbjct: 78  AGLLSGIVVC--------PLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRG 129

Query: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129
           L+ G+    +GY       +  YE  K    T+       ++ +       S+ TA   +
Sbjct: 130 LYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNSSNWSFVSHSF-------SAITAGAVS 182

Query: 130 DIMLCPFEAIKVKQQTTMPPWCNN-----VIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184
            ++  P   +K +         N        + +KK+  +EG+   Y G+ P     + +
Sbjct: 183 TVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGLVPSLLGLL-H 241

Query: 185 TMCKFTSFERIVEAI--YARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242
               F  +ER+  +   Y R  +       L+++    +   ++ ++ +++S+P +++ +
Sbjct: 242 VAIHFPVYERLKVSFKCYQRDESSNESKINLKRL---ILASSVSKMVASVLSYPHEILRT 298

Query: 243 KIN--NERKVNESMNVALKRI-YSRIGFVGLWNGLPVRILMIG-----TLTSFQWL 290
           ++   ++   ++   + L +I Y + G  G ++G    +         TL SF+++
Sbjct: 299 RLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRTLPASAITLVSFEYV 354

 Score = 38.9 bits (89), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 72/171 (42%), Gaps = 21/171 (12%)

Query: 117 IYLLSSATAEFFADIMLCPFEAIKVKQQ-------TTMPPWCNNVIEGWKKMYAKEGLNG 169
           I  +S A A   + I++CP +  K + Q       TT   +    I     +   EG+ G
Sbjct: 70  INAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTRTTENLYYRGSIGTMTTIVRDEGVRG 129

Query: 170 FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGIL 229
            YKG+ P+     P  M  F+ +E   + +       ++  S    +S SF     AG +
Sbjct: 130 LYKGLVPIIMGYFPTWMIYFSVYEFCKDNL-------RTNSSNWSFVSHSF-SAITAGAV 181

Query: 230 CAIVSHPADVMVSKINNERKVNESMN------VALKRIYSRIGFVGLWNGL 274
             +V++P  V+ +++  +  +  +         A K+I ++ G   L+ GL
Sbjct: 182 STVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQEGVKALYAGL 232

>YPR011C (YPR011C) [5447] chr16 complement(583057..584037) Protein
           with similarity to human Grave's disease carrier protein
           and to bovine homolog of Grave's disease protein, member
           of the mitochondrial carrier family (MCF) of membrane
           transporters [981 bp, 326 aa]
          Length = 326

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/315 (22%), Positives = 124/315 (39%), Gaps = 36/315 (11%)

Query: 6   SPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT---SGIIQIL 62
           + I+ + K+      L G VA   + + V+P + +K  LQV  +    N    S I Q+ 
Sbjct: 12  NSIKDFLKQDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVY 71

Query: 63  KKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSS 122
            +EG   LF G G  CI      A ++  YE  K+      V       +   +  L S 
Sbjct: 72  HEEGTKGLFRGNGLNCIRIFPYSAVQFVVYEACKK--KLFHVNGNNGQEQLTNTQRLFSG 129

Query: 123 ATAEFFADIMLCPFEAIKVK----------------QQTTMPPWCNNVIEGWKKMYAKEG 166
           A     + +   P + IK +                +  + PP    + +   + Y  EG
Sbjct: 130 ALCGGCSVVATYPLDLIKTRLSIQTANLSSLNRSKAKSISKPP---GIWQLLSETYRLEG 186

Query: 167 -LNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYM 225
            L G Y+G+ P     +PY    F  +E++ E        + S  S L ++++    G +
Sbjct: 187 GLRGLYRGVWPTSLGVVPYVALNFAVYEQLREFGVNSSDAQPSWKSNLYKLTI----GAI 242

Query: 226 AGILCAIVSHPADVMVSKIN------NERKVN-ESMNVALKRIYSRIGFVGLWNGLPVRI 278
           +G +   +++P D++  +        NE      S+  AL  I    G  G + GL   +
Sbjct: 243 SGGVAQTITYPFDLLRRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANL 302

Query: 279 LMIGTLTSFQWLIYD 293
             +   T+  WL+Y+
Sbjct: 303 FKVVPSTAVSWLVYE 317

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 79/186 (42%), Gaps = 26/186 (13%)

Query: 36  PLDLIKCRLQVD----PTLYRSNTS------GIIQILKKE-----GLGKLFTGVGATCIG 80
           PLDLIK RL +      +L RS         GI Q+L +      GL  L+ GV  T +G
Sbjct: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLG 201

Query: 81  YSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLS-SATAEFFADIMLCPFEAI 139
                A  +  YE  +       V        +++++Y L+  A +   A  +  PF+ +
Sbjct: 202 VVPYVALNFAVYEQLREFG----VNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLL 257

Query: 140 KVKQQ------TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
           + + Q        +     +V +    +   EG++G+YKG+     + +P T   +  +E
Sbjct: 258 RRRFQVLAMGGNELGFRYTSVWDALVTIGRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317

Query: 194 RIVEAI 199
            + +++
Sbjct: 318 VVCDSV 323

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/86 (19%), Positives = 45/86 (52%), Gaps = 3/86 (3%)

Query: 214 QQISVSFVGGYMAGILCAIVSHPAD---VMVSKINNERKVNESMNVALKRIYSRIGFVGL 270
           Q  +++F+ G +AG +   V  P +   +++   ++    N  +  +++++Y   G  GL
Sbjct: 20  QDSNIAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGL 79

Query: 271 WNGLPVRILMIGTLTSFQWLIYDSFK 296
           + G  +  + I   ++ Q+++Y++ K
Sbjct: 80  FRGNGLNCIRIFPYSAVQFVVYEACK 105

>Kwal_33.15446
          Length = 305

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 80/190 (42%), Gaps = 19/190 (10%)

Query: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVD----PTLYRSNTSGIIQILKKEGLGKLFT 72
           + C L G++A         P++L K +LQV      T YR     I ++   +G+  ++ 
Sbjct: 117 SGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQTTRYRGPLDVIKKVYAADGIRGMYK 176

Query: 73  GVGATCIGYSLQGAGKYGGYELFKRLYSTHL-VKDEATAY---KYRTSIYLLSSA-TAEF 127
           G+ +T I +       +G YEL  R +  +  + D A  +    +  S    ++A  ++ 
Sbjct: 177 GLVSTLI-FRTHFVYWWGSYELLTRWFKANTNLSDTAINFWAGGFSASFGFWTTAYPSDV 235

Query: 128 FADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187
              ++LC       K   ++  W N   + W+      G+ GF+KG  P + R  P    
Sbjct: 236 IKQVILC-----NDKYDGSLRSWRNAASDIWRT----RGIRGFFKGFVPSFLRSFPANAA 286

Query: 188 KFTSFERIVE 197
              SFE ++ 
Sbjct: 287 ALASFEFVLR 296

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 72/167 (43%), Gaps = 16/167 (9%)

Query: 135 PFEAIKVKQQTTMPP-WCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
           PF+ IKV+ QT+         ++   +   ++G+ GFY G TP     I           
Sbjct: 38  PFDTIKVRLQTSQDTGRFKGPLDCVYQTMRQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 97

Query: 194 RIVEAIYARLPTKKSEMSALQQISVS--FVGGYMAGILCAIVSHPADVMVSKINNERKVN 251
                   R+  KK      +++ +S   + G +AG   + ++ P ++  +K+  +    
Sbjct: 98  NY------RMLLKKYVYQHEEKLPLSGCILSGVLAGWSVSFIAAPVELAKAKLQVQYDAQ 151

Query: 252 ES-----MNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293
            +     ++V +K++Y+  G  G++ GL V  L+  T   + W  Y+
Sbjct: 152 TTRYRGPLDV-IKKVYAADGIRGMYKGL-VSTLIFRTHFVYWWGSYE 196

>KLLA0D15015g 1267803..1268756 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, start by similarity
          Length = 317

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 93/225 (41%), Gaps = 19/225 (8%)

Query: 33  SVTPLDLIKCRLQVDPTL---YRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKY 89
           +  P+D +K R Q+ P     Y+   S +  I+K+EGL  L+ G       Y + GA ++
Sbjct: 35  ATAPMDTVKIRYQLQPVQEDKYKGIASTVRTIMKEEGLRALWKGNIPATAMYVVYGAVQF 94

Query: 90  GGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPP 149
           G Y  F  ++S    +             L   A A   + ++  P + ++ +       
Sbjct: 95  GSYSWFNNVWSAKFPRFSQQGQT------LTVGALAGMTSSVVSYPLDLLRTRLIANRTS 148

Query: 150 WCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSE 209
              +V E  ++M+  EG+ GF+ GI+         T   F ++E +       +  +  E
Sbjct: 149 HRTSVAEECRQMWLNEGVRGFFTGISTAMTTVTLSTAIMFLTYETV------NIVCENHE 202

Query: 210 MSALQQISVSFVGGYMAGILCAIVSHPADVMVSK---INNERKVN 251
                +  VS   G +AG +   +  P D +  +   +N++R V+
Sbjct: 203 KEFWSR-PVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVH 246

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/199 (22%), Positives = 85/199 (42%), Gaps = 33/199 (16%)

Query: 20  TLGGIVACGPTHSSVT-PLDLIKCRLQVDPTLYRSNTSG-IIQILKKEGLGKLFTGVGAT 77
           T+G +   G T S V+ PLDL++ RL  + T +R++ +    Q+   EG+   FTG+   
Sbjct: 119 TVGAL--AGMTSSVVSYPLDLLRTRLIANRTSHRTSVAEECRQMWLNEGVRGFFTGISTA 176

Query: 78  CIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFE 137
               +L  A  +  YE      + ++V +      +   +   S   A F +  M+ P +
Sbjct: 177 MTTVTLSTAIMFLTYE------TVNIVCENHEKEFWSRPVSASSGIIAGFVSKTMVFPID 230

Query: 138 AIKVKQQ----------TTMPPWCNNVIEGWK---------KMYAKEGLNGFYKGITPLW 178
            ++ + Q          T  P     V   ++         K+  +EG++  Y+G+T   
Sbjct: 231 TLRRRMQVMNSKRTVHFTKFPA----VYHEYRYKSSTAIIYKILRQEGVSALYRGLTMGL 286

Query: 179 CRQIPYTMCKFTSFERIVE 197
           C+ +P T      +ER ++
Sbjct: 287 CKSVPTTAISLFVYERTMD 305

 Score = 32.7 bits (73), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 18/84 (21%)

Query: 9   ELYTKEYYA--ACTLGGIVACGPTHSSVTPLDLIKCRLQV----------------DPTL 50
           E + KE+++       GI+A   + + V P+D ++ R+QV                    
Sbjct: 199 ENHEKEFWSRPVSASSGIIAGFVSKTMVFPIDTLRRRMQVMNSKRTVHFTKFPAVYHEYR 258

Query: 51  YRSNTSGIIQILKKEGLGKLFTGV 74
           Y+S+T+ I +IL++EG+  L+ G+
Sbjct: 259 YKSSTAIIYKILRQEGVSALYRGL 282

>AER366W [2867] [Homologous to ScYIL134W (FLX1) - SH]
           complement(1314627..1315508) [882 bp, 293 aa]
          Length = 293

 Score = 53.9 bits (128), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 119/260 (45%), Gaps = 27/260 (10%)

Query: 52  RSNTS--GIIQ-ILKKEGLGK-LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDE 107
           R+NT+  G+I+ I +++  G+ L+ G+G   +G S+  A  +G Y   K +   HL  + 
Sbjct: 43  RANTTYTGLIRDIFERQQWGRELYRGLGVNLLGNSVAWALYFGCYRCAKDIALRHLGNES 102

Query: 108 ATAYKYR---TSIYLLSSATAEFFADIMLCPFEAIKVKQQTT--MPPWCNNVIEGWKKMY 162
           AT    R      Y+L++ ++     ++  P   IK +   T    P+  +  +G  K+Y
Sbjct: 103 ATGIMDRRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRIMATSRAGPY-KSTFDGVYKLY 161

Query: 163 AKEGLNGFYKGITP--LWCRQ--IPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISV 218
             EG+  F++G+ P  L   Q  I + +     F       Y    T K+E    +++SV
Sbjct: 162 QTEGVLAFWRGVVPSLLGVSQGAIYFALYDTLKFH------YLHSSTDKAE----RRLSV 211

Query: 219 SFVGGY--MAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPV 276
           S + G   ++ ++     +P  ++ SK+  +      +   ++ +YSR G  G + GL  
Sbjct: 212 SEIIGITCISKMISVTSVYPFQLLKSKLQ-DFGAPSGITQLVQTVYSREGIRGFYRGLSA 270

Query: 277 RILMIGTLTSFQWLIYDSFK 296
            +L     T   + +Y++ K
Sbjct: 271 NLLRAVPATCITFFVYENIK 290

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 81/164 (49%), Gaps = 11/164 (6%)

Query: 36  PLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           P+ +IK R+        Y+S   G+ ++ + EG+   + GV  + +G S QGA  +  Y+
Sbjct: 133 PIWVIKTRIMATSRAGPYKSTFDGVYKLYQTEGVLAFWRGVVPSLLGVS-QGAIYFALYD 191

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSAT--AEFFADIMLCPFEAIKVKQQTTMPPWC 151
             K  Y  H   D+A   + R S+  +   T  ++  +   + PF+ +K K Q    P  
Sbjct: 192 TLKFHY-LHSSTDKA---ERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQDFGAP-- 245

Query: 152 NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
           + + +  + +Y++EG+ GFY+G++    R +P T   F  +E I
Sbjct: 246 SGITQLVQTVYSREGIRGFYRGLSANLLRAVPATCITFFVYENI 289

>YBR192W (RIM2) [375] chr2 (607609..608742) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters, required for respiration [1134 bp, 377 aa]
          Length = 377

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 89/183 (48%), Gaps = 24/183 (13%)

Query: 35  TPLDLIKCRLQVDPT------LYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGK 88
            P+ LIK R+Q+D         Y+++   +  +++ EG   L+ G+ A+ +G S++G  +
Sbjct: 194 NPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLG-SVEGILQ 252

Query: 89  YGGYELFKRLYSTHLVKD--------EATAYKYRTSIYLLSSA-TAEFFADIMLCPFEAI 139
           +  YE  KRL     ++         ++T+ K +       SA  A+F A I   P E +
Sbjct: 253 WLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIATYPHEVV 312

Query: 140 KVKQQTTMPPWCNN------VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
           + + + T  P  N       +++ +K +  +EGL   Y G+TP   R +P ++  F ++E
Sbjct: 313 RTRLRQT--PKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMFGTWE 370

Query: 194 RIV 196
            ++
Sbjct: 371 IVI 373

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/302 (22%), Positives = 112/302 (37%), Gaps = 59/302 (19%)

Query: 36  PLDLIKCRLQVDPTL--YRSN--------------------------TSGII-QILKKEG 66
           P DL+K RLQ D  L  Y+S                           T GII  + K+EG
Sbjct: 72  PFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQEG 131

Query: 67  LGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAE 126
              LF G+G   +G     +  +  Y   K +Y+      + T       I+L+++ATA 
Sbjct: 132 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPM-----IHLMAAATAG 186

Query: 127 FFADIMLCPFEAIKVKQQ-----TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQ 181
           +       P   IK + Q      T      N  +  K +   EG  G YKG++  +   
Sbjct: 187 WATATATNPIWLIKTRVQLDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGS 246

Query: 182 IP-------YTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVS 234
           +        Y   K    ER +E    +    KS    +++         +A  + +I +
Sbjct: 247 VEGILQWLLYEQMKRLIKERSIEKFGYQAEGTKSTSEKVKEWCQRSGSAGLAKFVASIAT 306

Query: 235 HPADVMVSKINNERKVN-----ESMNVALKRIYSRIGFVGLWNGL--------PVRILMI 281
           +P +V+ +++    K N       +  + K I    G   +++GL        P  I+M 
Sbjct: 307 YPHEVVRTRLRQTPKENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSIIMF 366

Query: 282 GT 283
           GT
Sbjct: 367 GT 368

>Kwal_26.7653
          Length = 325

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/208 (22%), Positives = 92/208 (44%), Gaps = 15/208 (7%)

Query: 106 DEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCN------NVIEGWK 159
           D+  A K   +   ++   A   A  +  P E +K + Q       +      N ++  K
Sbjct: 15  DKPAAQKVSKTGSFIAGGMAACIAVTVTNPIELVKTRMQLQGEMSADAQRIYKNPMQALK 74

Query: 160 KMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVS 219
            ++  EG+ G  KG++  +  QI     +   +E I  ++  +      +   +Q ++V+
Sbjct: 75  VIFKNEGIRGLQKGLSCAYIYQIGLNGSRLGFYEPI-RSVLNKTFYPAMDPHKVQNVAVN 133

Query: 220 FVGGYMAGILCAIVSHPADVMVSKI---NNERKVNESMNV-----ALKRIYSRIGFVGLW 271
            V G  +GI+ AI+  P  ++ +++   +N  ++ +  +       L  IY   GF GL+
Sbjct: 134 VVSGATSGIIGAIMGSPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLY 193

Query: 272 NGLPVRILMIGTLTSFQWLIYDSFKAYV 299
            G+   IL  G  +S Q  IY++ K ++
Sbjct: 194 RGVDAAILRTGAGSSVQLPIYNTAKHFL 221

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 72/175 (41%), Gaps = 14/175 (8%)

Query: 35  TPLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86
           +PL LIK R+Q           T Y S  +G+  I + EG   L+ GV A  +      +
Sbjct: 149 SPLFLIKTRMQSYSNAIQIGQQTHYTSIWNGLSSIYRAEGFKGLYRGVDAAILRTGAGSS 208

Query: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146
            +   Y   K     H +  E T       ++L++S  + F   +++ P++ I  +    
Sbjct: 209 VQLPIYNTAKHFLLKHDLMKEGTG------LHLVASTVSGFGVGVVMNPWDVILTRVYNQ 262

Query: 147 MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA 201
                   ++ + K    EG+   YKG      R  P+T+   T  E+ ++ +YA
Sbjct: 263 KGNLYKGPLDCFVKTVRIEGIGALYKGFEAQIFRIAPHTILCLTFMEQTMKVVYA 317

>Kwal_26.7972
          Length = 358

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 82/174 (47%), Gaps = 23/174 (13%)

Query: 103 LVKDEATAYKYRTSIYLLSSATAEFFA----DIMLCPFEAIKVKQQTTMPPWCN------ 152
           +V  +  +   R++ Y+L S  A   A      ++ P + IK+  QT+ P +        
Sbjct: 11  MVPSKNQSVDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTM 70

Query: 153 NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSA 212
            +I     + A +G+ GFY+G +    R  PY   KF ++E+I   +   +P+K+ E  A
Sbjct: 71  GLIRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFM---IPSKEYETHA 127

Query: 213 LQQISVSFVGGYMAGILCAIVSHPAD---VMVSKINNERKVNESMNVALKRIYS 263
            +  S     G MAG+    +++P D   V ++ + +  ++   M   +K+IY+
Sbjct: 128 RRLAS-----GSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIK--MLPVIKQIYT 174

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/329 (21%), Positives = 122/329 (37%), Gaps = 72/329 (21%)

Query: 2   SKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQV-DPTL--YRSNTSGI 58
           SK +S ++  +  Y     L G +A     + + PLD IK   Q  +P    Y  +T G+
Sbjct: 14  SKNQS-VDKRSAHYILRSGLAGGIAGSCAKTLIAPLDRIKILFQTSNPHYLKYSGSTMGL 72

Query: 59  IQ----ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRL------YSTHLVKDEA 108
           I+    I   +G+   + G  AT I      A K+  YE  +        Y TH  +   
Sbjct: 73  IRAGAHINAHDGIRGFYQGHSATLIRIFPYAAIKFIAYEQIRHFMIPSKEYETHARR--- 129

Query: 109 TAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMY---AKE 165
                     L S + A   +  M  P + I+V+           ++   K++Y   A E
Sbjct: 130 ----------LASGSMAGLCSVFMTYPLDLIRVRLAYVTDRSRIKMLPVIKQIYTERASE 179

Query: 166 GLN-------------GFYKGITPLWCRQIPYTMCKFTSFERIVEAI-------YARLPT 205
            L               FY+G TP     IPY    F + +   + +       Y+ LP 
Sbjct: 180 SLTSKSYVPRWFAHWCNFYRGFTPTVLGMIPYAGVSFFAHDLCGDILRSGALSPYSVLPI 239

Query: 206 KKSEMSALQQISVS--------FVGGYMAGILCAIVSHPADVMVSK----------INNE 247
              E++   +   S         V G +AG+     S+P +++  +          I+N 
Sbjct: 240 SDEELTIRSKKQSSRPLKTWAELVAGGLAGMASQTASYPFEIIRRRLQVSVVSPTSIHNF 299

Query: 248 RKVNESMNVALKRIYSRIGFVGLWNGLPV 276
           + + + + +    IY   G+ G + GL +
Sbjct: 300 QTIPDMIRI----IYKERGWRGFFVGLSI 324

>KLLA0E09680g complement(860245..861168) similar to ca|CA5146|CaYMC2
           Candida albicans Carnitine/acylcarnitine translocase (by
           homology), start by similarity
          Length = 307

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 82/195 (42%), Gaps = 19/195 (9%)

Query: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVD----PTLYRSNTSGIIQILKKEGLGKLFT 72
           + C + G++A         P++L K +LQV      T Y+     I +I   +G+  L+ 
Sbjct: 122 SGCIISGVLAGWSVSFIAPPIELAKAKLQVQYDKTTTRYKGPLDVIKKIYSAQGIRGLYK 181

Query: 73  GVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEAT----AYKYRTSIYLLSSA-TAEF 127
           G+ +T I +       +G YEL  R +  +    EA     A  +  S    ++A  ++ 
Sbjct: 182 GLISTLI-FRTHFVYWWGSYELLTRWFRENTKMSEAAINFWAGGFSASFGFWTTAYPSDV 240

Query: 128 FADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187
              ++LC       K   +   W   V    K +Y  +G+NGF+KG  P + R  P    
Sbjct: 241 VKQVVLC-----NDKYDGSFKSWRTAV----KDIYQSKGINGFFKGFVPSFLRSFPANAA 291

Query: 188 KFTSFERIVEAIYAR 202
              +FE ++    A+
Sbjct: 292 ALAAFEFVLRTSGAK 306

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 40/167 (23%), Positives = 72/167 (43%), Gaps = 16/167 (9%)

Query: 135 PFEAIKVKQQTTM-PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQI--PYTMCKFTS 191
           PF+ IKV+ QT+         ++   K +  +G+ GFY G TP     I     M     
Sbjct: 43  PFDTIKVRLQTSQNETRFKGPLDCVYKTFRNQGIRGFYLGFTPPLVGWILMDSVMLGCLH 102

Query: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNE---- 247
             R++   Y     +K  +S         + G +AG   + ++ P ++  +K+  +    
Sbjct: 103 NYRMLMHKYVYPNDEKLPLSG------CIISGVLAGWSVSFIAPPIELAKAKLQVQYDKT 156

Query: 248 -RKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293
             +    ++V +K+IYS  G  GL+ GL +  L+  T   + W  Y+
Sbjct: 157 TTRYKGPLDV-IKKIYSAQGIRGLYKGL-ISTLIFRTHFVYWWGSYE 201

>Sklu_2431.5 YBR192W, Contig c2431 8526-9638
          Length = 370

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 95/195 (48%), Gaps = 22/195 (11%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPT----LYRSNTSGIIQILKKEGLGKLFTGVGA 76
           +    A   T ++  P+ L+K RLQ+D       Y+++   +  +++KEG+  L+ G+ A
Sbjct: 175 MAAATAGWATSTATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSA 234

Query: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLVK--------DEATAYKYRTSIYLLSSA-TAEF 127
           + +G S++G  ++  YE  K +     ++        +++T+ K +       SA  A+F
Sbjct: 235 SYLG-SVEGILQWVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKF 293

Query: 128 FADIMLCPFEAIKVKQQTTMPPWCNN------VIEGWKKMYAKEGLNGFYKGITPLWCRQ 181
            A I+  P E ++ + +    P  N       +++  + +  +EGL   Y G+TP   R 
Sbjct: 294 VASIITYPHEVVRTRLRQA--PLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRT 351

Query: 182 IPYTMCKFTSFERIV 196
           +P ++  F ++E ++
Sbjct: 352 VPNSIIMFGTWELVI 366

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/296 (20%), Positives = 118/296 (39%), Gaps = 54/296 (18%)

Query: 36  PLDLIKCRLQVD--PTLYRSN---------------------TSGII-QILKKEGLGKLF 71
           P D++K RLQ D     Y+S+                     T GII  + + EG   LF
Sbjct: 72  PFDVVKTRLQSDVFQAAYKSHAKSIGPNQANVIAQGVRHFKETFGIISNVYRNEGFRSLF 131

Query: 72  TGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADI 131
            G+G   +G     +  +  Y   K +YS  L   +   +     I+L+++ATA +    
Sbjct: 132 KGLGPNLVGVIPARSINFFTYGTTKEIYSKTLNNGQEAVW-----IHLMAAATAGWATST 186

Query: 132 MLCPFEAIKVKQQTTMPPWCNNVIEGW---KKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
              P   +K + Q             W   K +  KEG+ G YKG++  +   +   + +
Sbjct: 187 ATNPIWLVKTRLQLDKAGTTKKYKNSWDCLKNVVQKEGILGLYKGLSASYLGSVE-GILQ 245

Query: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGY--------MAGILCAIVSHPADVM 240
           +  +E++   I  R   K   +S +++ +   +  +        +A  + +I+++P +V+
Sbjct: 246 WVLYEQMKHIIKQRSMEKFGNISEVEKSTSDKIKEWCQRSGSAGLAKFVASIITYPHEVV 305

Query: 241 VSKINNERKVNESMNV-----ALKRIYSRIGFVGLWNGL--------PVRILMIGT 283
            +++      N  +       +++ I    G   ++ GL        P  I+M GT
Sbjct: 306 RTRLRQAPLENGKLKYTGLVQSIRVIIKEEGLASMYGGLTPHLLRTVPNSIIMFGT 361

>Scas_645.9
          Length = 391

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 104/250 (41%), Gaps = 42/250 (16%)

Query: 60  QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYL 119
           +I K EG+  L+ G+    +         + GYE        +L  +   A    T   L
Sbjct: 138 KIWKLEGITTLWRGISINLLMAIPANIVYFTGYE--------YLRDNSPLATSSPTFNPL 189

Query: 120 LSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGL------------ 167
           +  A A   A   + P E +K K Q+   P  +     W  M  KE L            
Sbjct: 190 MCGAIARILAASTVAPLELLKTKLQSI--PRVSKSTTSW--MMVKELLKETRQEMRISGA 245

Query: 168 -NGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMA 226
            N  +KG+     R +P++   + S+E     ++  + T KS  S L     SF+GG ++
Sbjct: 246 SNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLW--MDTSKSH-SNLTFFINSFIGGSIS 302

Query: 227 GILCAIVSHPADVMVSKI------NNERKVNESMNVA--------LKRIYSRIGFVGLWN 272
           G + A+V+HP DV  ++       NN++ V +S ++         L+ I+   G+  L+ 
Sbjct: 303 GTIAALVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYT 362

Query: 273 GLPVRILMIG 282
           GL  R++ I 
Sbjct: 363 GLVPRMVKIA 372

 Score = 35.4 bits (80), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 78/196 (39%), Gaps = 29/196 (14%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII--QILKKE--------GLGKLFT 72
           G +A     S+V PL+L+K +LQ  P + +S TS ++  ++LK+             LF 
Sbjct: 192 GAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETRQEMRISGASNALFK 251

Query: 73  GVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIY--LLSSATAEFFAD 130
           G+  T        A  +G YE  K    THL  D + ++   T      +  + +   A 
Sbjct: 252 GLEITLWRDVPFSAIYWGSYEFCK----THLWMDTSKSHSNLTFFINSFIGGSISGTIAA 307

Query: 131 IMLCPFEAIKVKQQTTMP-------------PWCNNVIEGWKKMYAKEGLNGFYKGITPL 177
           ++  PF+  K + Q +                   N+ +  + ++  EG    Y G+ P 
Sbjct: 308 LVTHPFDVGKTRWQISFMGNNDKSVVKSPDIEQTKNMFKFLRNIWKLEGWGALYTGLVPR 367

Query: 178 WCRQIPYTMCKFTSFE 193
             +  P      +S+E
Sbjct: 368 MVKIAPSCAIMISSYE 383

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 50/113 (44%), Gaps = 19/113 (16%)

Query: 2   SKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQV------DPTLYRS-- 53
           SK+ S +  +   +    ++ G +A   TH    P D+ K R Q+      D ++ +S  
Sbjct: 283 SKSHSNLTFFINSFIGG-SISGTIAALVTH----PFDVGKTRWQISFMGNNDKSVVKSPD 337

Query: 54  --NTSGIIQILKK----EGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYS 100
              T  + + L+     EG G L+TG+    +  +   A     YEL KRL++
Sbjct: 338 IEQTKNMFKFLRNIWKLEGWGALYTGLVPRMVKIAPSCAIMISSYELSKRLFN 390

 Score = 32.0 bits (71), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 72/166 (43%), Gaps = 25/166 (15%)

Query: 152 NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMS 211
           N  +E + K++  EG+   ++GI+      IP  +  FT +E      Y R      + S
Sbjct: 130 NGTLEAFNKIWKLEGITTLWRGISINLLMAIPANIVYFTGYE------YLR------DNS 177

Query: 212 ALQQISVSF---VGGYMAGILCAIVSHPADVMVSKINNERKVNES------MNVALKRIY 262
            L   S +F   + G +A IL A    P +++ +K+ +  +V++S      +   LK   
Sbjct: 178 PLATSSPTFNPLMCGAIARILAASTVAPLELLKTKLQSIPRVSKSTTSWMMVKELLKETR 237

Query: 263 SRIGFVG----LWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLPTS 304
             +   G    L+ GL + +      ++  W  Y+  K ++ + TS
Sbjct: 238 QEMRISGASNALFKGLEITLWRDVPFSAIYWGSYEFCKTHLWMDTS 283

>AGR191W [4502] [Homologous to ScYDL198C (YHM1) - SH]
           complement(1114974..1115870) [897 bp, 298 aa]
          Length = 298

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 70/280 (25%), Positives = 109/280 (38%), Gaps = 26/280 (9%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGK--------LFTGV 74
           GI+  G  H    P+D I  RL  + T   +N   +  ++ +E   K        LF G+
Sbjct: 20  GILEIGVFH----PVDTISKRLMSNHTKI-TNAQQLNDVVFREHASKPFGQRLFTLFPGL 74

Query: 75  GATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF--FADIM 132
           G        Q   KYGG        + H   D   A+  +T   L S+         +I+
Sbjct: 75  GYAATYKIFQRVYKYGGQPFANEFLNKHFKADFDGAFGEKTGKALRSATAGSLIGIGEIV 134

Query: 133 LCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSF 192
           L P + +K+K+QT    +      G+ ++   EG+ G Y+G      R  P +   F   
Sbjct: 135 LLPLDVLKIKRQTNPESFRG---RGFLRILRDEGM-GLYRGWGWTAARNAPGSFALFGGN 190

Query: 193 ERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER-KVN 251
               E I   L  K    +   Q  VS + G  A +   IVS P DV+ ++I +   +  
Sbjct: 191 AFAKEYI---LGLKDYSQATWGQNFVSSIFGASASL---IVSAPLDVIKTRIQSRNFESA 244

Query: 252 ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLI 291
           ES    +K      G    + GL  ++L  G    F + I
Sbjct: 245 ESGFTIVKNTLKNEGATAFFKGLTPKLLTTGPKLVFSFAI 284

>KLLA0F04697g complement(461126..462049) similar to sp|P40464
           Saccharomyces cerevisiae YIL134w FLX1 FAD carrier
           protein (MCF), mitochondrial, start by similarity
          Length = 307

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 70/314 (22%), Positives = 137/314 (43%), Gaps = 42/314 (13%)

Query: 6   SPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQV-----DPTLYRSNTSGIIQ 60
           SP++   KE  +  T G I     TH    PLDLIK RLQ+      P+ Y +    II 
Sbjct: 10  SPLQ---KEIISGLTAGTITTI-VTH----PLDLIKLRLQLAAIDLKPSSYYNQVQRII- 60

Query: 61  ILKKEGLG------KLFTGVGATCIGYSLQGAGKYGGYELFKRL-YSTHLVKDEATAYKY 113
              K+G G      + + G+G   IG ++     +G Y   K + YS  L  + A   K+
Sbjct: 61  ---KDGSGTQQLLKEAYRGLGINIIGNAVAWGLYFGLYRCSKDVVYS--LSSEPALQNKF 115

Query: 114 ------RTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWC-NNVIEGWKKMYAKEG 166
                  +S+YL+S+  +     ++  P   IK +  +T       +++    ++Y +EG
Sbjct: 116 MNDRKMTSSMYLVSAGASGLATALLTNPMWVIKTRIMSTKSSQGYTSILNAITRIYTEEG 175

Query: 167 LNGFYKGITPLWCRQIPYTMCKFTSFERI-VEAIYARLPTKKSEMSALQQISVSFVGGYM 225
           L  F++G+ P     +      F  ++ + ++ ++ R   ++  ++A++ I +      +
Sbjct: 176 LKTFWRGLVPSLF-GVTQGALYFAIYDTLKLKYLHDRNDIQERRLNAVETIGII----SL 230

Query: 226 AGILCAIVSHPADVMVSKINN---ERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIG 282
           + ++     +P  ++ + +     E   N  MN  ++ I+   G  G + GL   ++   
Sbjct: 231 SKMISVSSVYPLQLLKTNLQTFRTEHNENSKMNSLIRSIWHTNGIAGFYKGLFANLVRAI 290

Query: 283 TLTSFQWLIYDSFK 296
             T   + +Y+ FK
Sbjct: 291 PSTCITFGVYEHFK 304

>Scas_662.12
          Length = 308

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 83/183 (45%), Gaps = 12/183 (6%)

Query: 22  GGIVACGPTHSSVTPLDLIKCRL----QVDPTLYRSNTSGIIQILKKEGLGKLFTGVGAT 77
            G+++   T     PL +IK R+    +     Y+S   G   +L KEG   ++ G+  +
Sbjct: 123 SGLISGISTTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPS 182

Query: 78  CIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFE 137
            +G S QGA  +  Y+  K  ++ +L K +         I L+SS  ++  + + + PF+
Sbjct: 183 LLGVS-QGAIYFMIYDNLKLHFNVNLNKSKKDNANANLKIVLISSL-SKMLSVMSVYPFQ 240

Query: 138 AIKVKQQT------TMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
            +K   QT       +P    + I   +K+Y   G+ G YKG++    R IP T   F  
Sbjct: 241 LLKSNLQTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCI 300

Query: 192 FER 194
           +E 
Sbjct: 301 YEN 303

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/300 (21%), Positives = 121/300 (40%), Gaps = 28/300 (9%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTL--------YRSNTSGIIQILKKEG-LGKLF 71
           + G+ A   T   V PLDLIK RLQ+  T         Y    + +I   KK G  G ++
Sbjct: 12  ISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINNSKKMGSQGPIY 71

Query: 72  TGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKY----RTSIYLLSSATAEF 127
             +  +  G  +   G    + L+  +Y++   KD      Y     T+I+L S   +  
Sbjct: 72  NLIKESYRGLPINLLGNAVAWSLYFTIYNS--TKDYMFQNNYLHNNNTTIFLTSGLISGI 129

Query: 128 FADIMLCPFEAIKVKQQTTMPPWCNN---VIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184
              ++  P   IK +  +T     ++   +  G+K +  KEG    + G+ P     +  
Sbjct: 130 STTLLTNPLWVIKTRIMSTSRHHKDSYKSIRHGFKSLLTKEGPKAIWMGLLPSLL-GVSQ 188

Query: 185 TMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI 244
               F  ++ +       L   K + +A   + +  +   ++ +L  +  +P  ++ S +
Sbjct: 189 GAIYFMIYDNLKLHFNVNLNKSKKD-NANANLKIVLISS-LSKMLSVMSVYPFQLLKSNL 246

Query: 245 NNERKVNESMN-------VALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKA 297
              R V  ++          +++IY   G  GL+ GL   +L     T   + IY++FK+
Sbjct: 247 QTFRSVTNNIPQNDYHFITLIRKIYRDNGIKGLYKGLSANLLRAIPSTCITFCIYENFKS 306

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 46/108 (42%), Gaps = 20/108 (18%)

Query: 210 MSALQQISVSFVGGYMAGILCAIVSHPADVMVSKIN--------NERK-----VNESMNV 256
           M  L  I    + G  AG L  ++ HP D++  ++           +K     +NE +N 
Sbjct: 1   MHELTPIQKEIISGLSAGSLTTLIVHPLDLIKVRLQLLATTTTQQHQKGYTYLINELINN 60

Query: 257 ALKR-----IYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           + K      IY+ I     + GLP+ +L      S  + IY+S K Y+
Sbjct: 61  SKKMGSQGPIYNLIK--ESYRGLPINLLGNAVAWSLYFTIYNSTKDYM 106

>CAGL0M09020g complement(896312..897358) highly similar to sp|P33303
           Saccharomyces cerevisiae YJR095w succinate-fumarate
           transporter, start by similarity
          Length = 348

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/256 (19%), Positives = 107/256 (41%), Gaps = 28/256 (10%)

Query: 60  QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYL 119
            I  +EG   L+ G+GA  IG   + A ++  YE ++ L +     D+ T     ++ ++
Sbjct: 88  NIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLA-----DKQTGVVSTSNTFI 142

Query: 120 LSSATAEFFADIMLCPFEAIKVKQQT---------TMPPWCNNVIEGWKKMYAKEGLNGF 170
                    A +++ P E +K++ Q            P + N V  G+  +  +EG++  
Sbjct: 143 AGVGAGVTEAVLVVNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGY-TIIKEEGISAL 201

Query: 171 YKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILC 230
           Y+G++    RQ       FT + ++ E +     T+      L     S + G ++G + 
Sbjct: 202 YRGVSLTAARQATNQGANFTVYSKLREFLQEYHGTE-----TLPSWETSCI-GLISGAIG 255

Query: 231 AIVSHPADVMVSKINNERKVNESMNVALKRI-------YSRIGFVGLWNGLPVRILMIGT 283
              + P D + +++  ++  +       KRI           GF  L+ G+  R++ +  
Sbjct: 256 PFSNAPLDTIKTRLQKDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAP 315

Query: 284 LTSFQWLIYDSFKAYV 299
             +  + +Y+  + ++
Sbjct: 316 GQAVTFTVYEFVRRHL 331

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 71/177 (40%), Gaps = 24/177 (13%)

Query: 34  VTPLDLIKCRLQ---VDPT--LYRSNTSGIIQ----ILKKEGLGKLFTGVGATCIGYSLQ 84
           V P++++K RLQ   ++P   L +   +  +Q    I+K+EG+  L+ GV  T    +  
Sbjct: 156 VNPMEVVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATN 215

Query: 85  GAGKYGGYELFKRLYSTHLVKDEATAYKYRTS-IYLLSSATAEFFADIMLCPFEAIKVKQ 143
               +  Y   +     +      T   + TS I L+S A   F       P + IK + 
Sbjct: 216 QGANFTVYSKLREFLQEY--HGTETLPSWETSCIGLISGAIGPFSN----APLDTIKTRL 269

Query: 144 QTTMPPWCNNVIEGWKK-------MYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
           Q            GWK+       +  +EG    YKGITP   R  P     FT +E
Sbjct: 270 QKDKSTSFKGE-SGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYE 325

 Score = 33.9 bits (76), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/156 (21%), Positives = 66/156 (42%), Gaps = 19/156 (12%)

Query: 155 IEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQ 214
           I   + +YA+EG    YKG+  +    IP    +F+S+E      Y  L   K   + + 
Sbjct: 83  IRTGRNIYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYE-----FYRTLLADKQ--TGVV 135

Query: 215 QISVSFVGGYMAGILCAI-VSHPADVMVSKINNERKVNESMNVALKR----------IYS 263
             S +F+ G  AG+  A+ V +P +V+  ++  +  +N + ++A  +          I  
Sbjct: 136 STSNTFIAGVGAGVTEAVLVVNPMEVVKIRLQAQH-LNPNHDLAKPKYTNAVQAGYTIIK 194

Query: 264 RIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
             G   L+ G+ +      T     + +Y   + ++
Sbjct: 195 EEGISALYRGVSLTAARQATNQGANFTVYSKLREFL 230

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 45/106 (42%), Gaps = 14/106 (13%)

Query: 6   SPIELYTKEYYAACTLG-------GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGI 58
           S +  + +EY+   TL        G+++      S  PLD IK RLQ D +      SG 
Sbjct: 224 SKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGESGW 283

Query: 59  -------IQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKR 97
                   Q+LK+EG   L+ G+    +  +   A  +  YE  +R
Sbjct: 284 KRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRR 329

>KLLA0C13431g 1145919..1146905 similar to sgd|S0005626 Saccharomyces
           cerevisiae YOR100c CRC1 mitochondrial carnitine carrier,
           member of the mitochondrial carrier (MCF) family, start
           by similarity
          Length = 328

 Score = 53.1 bits (126), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 124/294 (42%), Gaps = 29/294 (9%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ 60
           +S+TKS +    K   AA  +GG+ A    H    P DL+K R Q +    RS    +  
Sbjct: 18  VSQTKSQLTENLKSL-AAGGVGGVCAVLTGH----PFDLVKVRCQSNQA--RSAMDAVSH 70

Query: 61  ILK--KEGLGK--------LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATA 110
           IL+  ++  G          + GV    +G +   A  + GY++ K+L ++      + A
Sbjct: 71  ILQAARQAAGPTSLNAVRGFYKGVVPPLLGVTPIFAVSFWGYDVGKKLVTSVPSSAASGA 130

Query: 111 YKYRTSIYLLSSATAEFFADI----MLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEG 166
                 + L   A A F + I    +  P E +KV  QTT      + ++  K++   +G
Sbjct: 131 AAVEPELTLSQMAAAGFISAIPTTLVTAPTERVKVVLQTTQ--GKASFLDAAKQIVRTQG 188

Query: 167 LNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMA 226
               +KG      R  P +   F S+E   E +         E+S    I+   + G MA
Sbjct: 189 FQSLFKGSLATLSRDGPGSALYFASYEICKEYLNKASGHTSGELS----ITNVCISGGMA 244

Query: 227 GILCAIVSHPADVMVSKINNERKVNESMNVALKRIY-SRIGFVGLWNGLPVRIL 279
           G+   +V  P D + +++ +  K  +SM    + IY +R G  G + G+   IL
Sbjct: 245 GVSMWVVVFPIDTVKTQLQSSSK-RQSMLEVTRMIYNTRGGIKGFFPGVGPAIL 297

>Kwal_23.3529
          Length = 395

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 126/307 (41%), Gaps = 38/307 (12%)

Query: 13  KEY--YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLG 68
           KEY   A C + G +      S +  LD +K R Q  P    YR+  S   +I  +EG+ 
Sbjct: 80  KEYSAIAHCIVAGGIGGAIGDSVMHSLDTVKTRQQGAPNAPKYRNMISAYQKIFMEEGIR 139

Query: 69  K-LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF 127
           + L+ G  A  +G     A  +G YEL KR     L+ D        T  +L +  + + 
Sbjct: 140 RGLYGGYTAAMLGSFPSAAIFFGTYELTKR----KLIDDWGVN---ETLSHLTAGLSGDL 192

Query: 128 FADIMLCPFEAIKVKQQT----TMPPWCN-----NVIEGWKKMYAKEGLNGFYKGITPLW 178
            + ++  P E +K + Q       P + +     N+ +    +   EG    + G     
Sbjct: 193 VSSVVYVPSEVLKTRLQLQGCYNNPHFHSGYNYRNLRDAITAIVRLEGWQTLFFGYKATL 252

Query: 179 CRQIPYTMCKFTSFERIVE-AIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237
           CR +P++  +F  +E+  + A      T   ++S L ++         AG L  I++ P 
Sbjct: 253 CRDLPFSAFQFAFYEKFRQWAFTLEGKTPSQDLSLLNELLTG----AAAGGLAGIITTPM 308

Query: 238 DVMVSKINNER------------KVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLT 285
           DV+ ++I  +             ++  S+   L  +Y   G +G ++G+  R +     +
Sbjct: 309 DVIKTRIQTQMPSTVASDSTRLVRIENSLIKGLTAVYRSEGTLGFFSGVGPRFIWTSIQS 368

Query: 286 SFQWLIY 292
           S   L+Y
Sbjct: 369 SIMLLLY 375

>CAGL0M05225g 563163..564308 highly similar to sp|P38127
           Saccharomyces cerevisiae YBR192w RIM2 mitochondrial
           carrier protein, start by similarity
          Length = 381

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 90/188 (47%), Gaps = 30/188 (15%)

Query: 35  TPLDLIKCRLQVDPT----LYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYG 90
            P+ ++K R+Q+D       Y+++   +  IL+ EG+  L+ G+ A+ +G S++G  ++ 
Sbjct: 198 NPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLG-SVEGILQWL 256

Query: 91  GYELFKRLY-------------STHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFE 137
            YE  K L              ST    D+   +  R+      +  A+F A I+  P E
Sbjct: 257 LYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSG----GAGLAKFMASIVTYPHE 312

Query: 138 AIKVKQQTTMPPWCNN------VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
            ++ + + +  P  N       +++ ++ +  +EGL   Y G+TP   R +P ++  F +
Sbjct: 313 VVRTRLRQS--PLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGT 370

Query: 192 FERIVEAI 199
           +E +++ +
Sbjct: 371 WEVVIKLL 378

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/300 (19%), Positives = 110/300 (36%), Gaps = 57/300 (19%)

Query: 36  PLDLIKCRLQVD-----------------------------PTLYRSNTSGIIQILKKEG 66
           P DL+K RLQ D                              T ++   S I  + ++EG
Sbjct: 76  PFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQEG 135

Query: 67  LGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAE 126
              LF G+G   +G     +  +  Y   K +YS      +   +     I+L+++ATA 
Sbjct: 136 FRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPW-----IHLMAAATAG 190

Query: 127 FFADIMLCPFEAIKVKQQTTMPPWCN---NVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183
           +       P   +K + Q           N  +  K +   EG+ G Y+G++  +   + 
Sbjct: 191 WATATATNPIWMVKTRVQLDKAGKTRTYKNSYDCLKSILRNEGIYGLYRGLSASYLGSVE 250

Query: 184 -------YTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHP 236
                  Y   K    +R +E   A   +  +    ++Q      G  +A  + +IV++P
Sbjct: 251 GILQWLLYEQLKHLIKKRSIEKFGAHDESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYP 310

Query: 237 ADVMVSKINNERKVNESMNV-----ALKRIYSRIGFVGLWNGL--------PVRILMIGT 283
            +V+ +++      N  +       + + I    G   +++GL        P  I+M GT
Sbjct: 311 HEVVRTRLRQSPLENGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGT 370

>ADR036C [1777] [Homologous to ScYPR128C (ANT1) - SH]
           (771097..772119) [1023 bp, 340 aa]
          Length = 340

 Score = 52.8 bits (125), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 46/232 (19%), Positives = 103/232 (44%), Gaps = 7/232 (3%)

Query: 51  YRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATA 110
           Y+     + +I   EG+  L+ G+G++ +   +Q    +  Y L ++ Y   L +     
Sbjct: 72  YKGALDALQRIYGAEGVAGLYRGLGSSTVAGFIQSFSYFFWYTLVRKHY-FRLKQARGGD 130

Query: 111 YKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT-MPPWCNNVIEGWKKMYAKEGLNG 169
            ++ T   L+    A   + + + P   +  +QQT        ++    ++++A+ G  G
Sbjct: 131 ARFSTPEELVLGIVAAATSQLFVNPINVVATRQQTRGQAAGAADMRTVAREVHAENGWRG 190

Query: 170 FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEM---SALQQISVSFVGGYMA 226
           F+ G+       +  ++  + ++ER+ EA++   P   S +   +AL     +FV G ++
Sbjct: 191 FWAGLKVSLVLTVNPSIT-YATYERLREALFP-TPAAASHLVDSAALLSPGQNFVMGVLS 248

Query: 227 GILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRI 278
            I+  +++ P  +  + +       +  +  L  +YS  G + LW GL  +I
Sbjct: 249 KIVSTVLTQPLIIAKASLQRSGSCFQDFHQVLHHLYSTEGPLSLWKGLGPQI 300

>YIL006W (YIL006W) [2659] chr9 (344059..345180) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1122 bp, 373 aa]
          Length = 373

 Score = 53.1 bits (126), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 77/187 (41%), Gaps = 12/187 (6%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVD------PTLYRSNTSGIIQILKKEGLGK 69
           + A +   I A   + +   P+ ++K RL +       PT Y+       ++  +EG   
Sbjct: 176 FVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKA 235

Query: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129
           L+ G+  + +G     A  +  YE  K  +  H    E           +++S+ ++  A
Sbjct: 236 LYAGLVPSLLGL-FHVAIHFPIYEDLKVRF--HCYSRENNTNSINLQRLIMASSVSKMIA 292

Query: 130 DIMLCPFEAIKVKQQ--TTMPPWCNN-VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTM 186
             +  P E ++ + Q  + +P      +    K  YA+EGL GFY G T    R IP + 
Sbjct: 293 SAVTYPHEILRTRMQLKSDIPDSIQRRLFPLIKATYAQEGLKGFYSGFTTNLVRTIPASA 352

Query: 187 CKFTSFE 193
               SFE
Sbjct: 353 ITLVSFE 359

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/279 (17%), Positives = 113/279 (40%), Gaps = 32/279 (11%)

Query: 33  SVTPLDLIKCRLQV-------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQG 85
           +V PLD+ K RLQ        +   YR     +  I++ EG   L+ G+    +GY    
Sbjct: 94  AVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPRGLYKGLVPIVLGYFPTW 153

Query: 86  AGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVK--Q 143
              +  YE  K+ +     + +  A          ++ TA   +  +  P   +K +   
Sbjct: 154 MIYFSVYEFSKKFFHGIFPQFDFVAQS-------CAAITAGAASTTLTNPIWVVKTRLML 206

Query: 144 QTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIY 200
           Q+ +   P       + ++K++ +EG    Y G+ P     + +    F  +E +    +
Sbjct: 207 QSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLL-GLFHVAIHFPIYEDLKVRFH 265

Query: 201 ARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVAL-- 258
                  +    LQ++    +   ++ ++ + V++P +++ +++  +  + +S+   L  
Sbjct: 266 CYSRENNTNSINLQRL---IMASSVSKMIASAVTYPHEILRTRMQLKSDIPDSIQRRLFP 322

Query: 259 --KRIYSRIGFVGLWNGLPVRILMI-----GTLTSFQWL 290
             K  Y++ G  G ++G    ++        TL SF++ 
Sbjct: 323 LIKATYAQEGLKGFYSGFTTNLVRTIPASAITLVSFEYF 361

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/197 (20%), Positives = 79/197 (40%), Gaps = 27/197 (13%)

Query: 115 TSIYLLSSATAEFFADIMLCPFEAIKVKQQTT------MPPWCNNVIEGWKKMYAKEGLN 168
           T I  LS A A F + + +CP +  K + Q          P+   ++     +   EG  
Sbjct: 77  TQITALSGAFAGFLSGVAVCPLDVAKTRLQAQGLQTRFENPYYRGIMGTLSTIVRDEGPR 136

Query: 169 GFYKGITPLWCRQIPYTMCKFTSFE---RIVEAIYARLPTKKSEMSALQQISVSFVGGYM 225
           G YKG+ P+     P  M  F+ +E   +    I+ +        +A+            
Sbjct: 137 GLYKGLVPIVLGYFPTWMIYFSVYEFSKKFFHGIFPQFDFVAQSCAAI-----------T 185

Query: 226 AGILCAIVSHPADVMVSKINNERKVNESMN------VALKRIYSRIGFVGLWNGLPVRIL 279
           AG     +++P  V+ +++  +  + E          A ++++ + GF  L+ GL   +L
Sbjct: 186 AGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTFDAFRKLFYQEGFKALYAGLVPSLL 245

Query: 280 MIGTLTSFQWLIYDSFK 296
            +  + +  + IY+  K
Sbjct: 246 GLFHV-AIHFPIYEDLK 261

>AGL047C [4264] [Homologous to ScYPR011C - NSH] (616853..617803)
           [951 bp, 316 aa]
          Length = 316

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/312 (20%), Positives = 127/312 (40%), Gaps = 43/312 (13%)

Query: 10  LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSN---TSGIIQILKKEG 66
           +Y  + + A   GG V    + + V+P++ +K  LQV  +    N      + Q+ K+EG
Sbjct: 11  VYKNDGFIAFVAGG-VGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEG 69

Query: 67  LGKLFTGVGATCIGYSLQGAGKYGGYELFK-RLYSTHLVKDEATAYKYRTSIYLLSSATA 125
           +  LF G G  C+      A +Y  YE  K R++       E    + R+   L+  A  
Sbjct: 70  VKGLFRGNGINCLRIFPYSAVQYAVYEFCKTRVFHVGQSGHE----QLRSWERLVGGALG 125

Query: 126 EFFADIMLCPFEAIKVK----------------QQTTMPPWCNNVIEGWKKMYAKEG-LN 168
              + ++  P + ++ +                     PP    ++E  ++++ +EG L 
Sbjct: 126 GGASVLVTYPLDLVRTRLSIQTANLAKLHRSKAHDIRRPP---GIVELLRRIFREEGGLR 182

Query: 169 GFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGI 228
           G+Y+G+ P     +P+    F  +ER+   I         +  A    +     G ++G 
Sbjct: 183 GWYRGVYPTSLGVVPFVALNFALYERLKALI-------PHDYDAGSVAAAKLAIGAVSGG 235

Query: 229 LCAIVSHPADVMVSKIN----NERKVN---ESMNVALKRIYSRIGFVGLWNGLPVRILMI 281
           +   V +P D++  +       + ++     S+  AL  I  + G  G + GL   ++ +
Sbjct: 236 IAQTVVYPFDLLRRRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKV 295

Query: 282 GTLTSFQWLIYD 293
               + QW +Y+
Sbjct: 296 VPAMAVQWFVYE 307

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 78/187 (41%), Gaps = 27/187 (14%)

Query: 36  PLDLIKCRLQVDPT----LYRSNTS------GIIQILKK-----EGLGKLFTGVGATCIG 80
           PLDL++ RL +       L+RS         GI+++L++      GL   + GV  T +G
Sbjct: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194

Query: 81  YSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIK 140
                A  +  YE  K L           A K      L   A +   A  ++ PF+ ++
Sbjct: 195 VVPFVALNFALYERLKALIPHDYDAGSVAAAK------LAIGAVSGGIAQTVVYPFDLLR 248

Query: 141 VK------QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194
            +       Q+ +     +V +    +  +EGL G+YKG+T    + +P    ++  +E 
Sbjct: 249 RRFQVLTMGQSELGFRYASVADALWTIGRQEGLRGYYKGLTANLVKVVPAMAVQWFVYEL 308

Query: 195 IVEAIYA 201
           I E ++ 
Sbjct: 309 ISENMHG 315

 Score = 35.8 bits (81), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 18/87 (20%), Positives = 41/87 (47%), Gaps = 2/87 (2%)

Query: 109 TAYKYRTSIYLLSSATAEFFADIMLCPFEAIKV--KQQTTMPPWCNNVIEGWKKMYAKEG 166
           T YK    I  ++       +  ++ P E +K+  + Q++   +   ++   K++Y +EG
Sbjct: 10  TVYKNDGFIAFVAGGVGGAVSRTVVSPVERVKILLQVQSSTTAYNGGLVHAVKQVYKEEG 69

Query: 167 LNGFYKGITPLWCRQIPYTMCKFTSFE 193
           + G ++G      R  PY+  ++  +E
Sbjct: 70  VKGLFRGNGINCLRIFPYSAVQYAVYE 96

>AFL196W [2999] [Homologous to ScYMR166C - SH]
           complement(66955..68040) [1086 bp, 361 aa]
          Length = 361

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 123/304 (40%), Gaps = 41/304 (13%)

Query: 19  CTLGGIVACGPTHSSVTPLDLIKCRLQVDP--TLYRSNTSGIIQILKKEGLGK-LFTGVG 75
           C L G +      S +  LD +K R Q  P    YR   S    +  +EG+ + L+ G G
Sbjct: 56  CVLAGGIGGAIGDSVMHSLDTVKTRQQGAPGEVKYRHMISAYRTLALEEGVRRGLYGGYG 115

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
           A  +G     A  +G YE  KR     ++ +      + T  +L +    + F+ ++  P
Sbjct: 116 AAMLGSFPSAAVFFGTYEWVKR----QMINEWQI---HETYSHLAAGFLGDLFSSVVYVP 168

Query: 136 FEAIKVKQQTTMPPWCNN------------VIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183
            E +K + Q      C N            + +  + +   EG++  + G      R +P
Sbjct: 169 SEVLKTRLQLQ---GCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKATLSRDLP 225

Query: 184 YTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSK 243
           ++  +F  +ER  +  +A L  +K     L   +   V G  AG L  I++ P DV+ ++
Sbjct: 226 FSALQFAFYERFRK--WAFLLERKPVDGHL-SFTAEVVTGASAGGLAGIITTPLDVVKTR 282

Query: 244 INNE-------------RKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWL 290
           I  +              ++N S+  +L  +    G  G ++G+  R +     +S   L
Sbjct: 283 IQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTSIQSSIMLL 342

Query: 291 IYDS 294
           +Y +
Sbjct: 343 LYQT 346

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 26/91 (28%)

Query: 11  YTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDP-----------------TLYRS 53
           +T E     + GG+          TPLD++K R+Q  P                 +++RS
Sbjct: 255 FTAEVVTGASAGGLAGI-----ITTPLDVVKTRIQTQPRGSAGTPDASAPARLNGSIFRS 309

Query: 54  NTSGIIQILKKEGLGKLFTGVGATCIGYSLQ 84
               ++ +L+ EGLG  F+GVG   I  S+Q
Sbjct: 310 ----LLVVLRYEGLGGAFSGVGPRFIWTSIQ 336

>CAGL0J04114g complement(384321..385232) similar to sp|Q99297
           Saccharomyces cerevisiae YOR222w ODC2 or sp|Q03028
           Saccharomyces cerevisiae YPL134c ODC1, start by
           similarity
          Length = 303

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/281 (20%), Positives = 115/281 (40%), Gaps = 31/281 (11%)

Query: 36  PLDLIKCRLQVD-------PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGK 88
           PLD++K R+Q+           Y      + QI+K+EG  +L+ G+ +  +  + + A K
Sbjct: 28  PLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATK 87

Query: 89  YGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMP 148
           +   + +++++     KD     K    I +LS + A      ++ PFE +K++ Q    
Sbjct: 88  FACNDSYQKMF-----KDLYGVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNS 142

Query: 149 PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKS 208
            + N  +E   K   + G+   Y G+     R   +    F     ++  I A LP  K+
Sbjct: 143 KF-NGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFG----VIFQIRALLPKAKT 197

Query: 209 EMSALQQISVSFVGGYMAGILCAIVSHPA-DVMVSKINNERKVNESMNV----------A 257
                ++ +   + G + G       H    V+ S+I +      +             +
Sbjct: 198 NT---EKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPS 254

Query: 258 LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAY 298
           L +IYS  GF  L+ G   +IL +G       ++++   A+
Sbjct: 255 LFKIYSEEGFTALYKGFIPKILRLGPGGGIMLVVFNGMMAF 295

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 58/161 (36%), Gaps = 18/161 (11%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           + P +L+K RLQ   + +      + + +++ G+  L+ G+ +T    +    G +G   
Sbjct: 127 IVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSLYNGLESTMWRNAFWNGGYFGVIF 186

Query: 94  LFKRLYSTHLVKDEATAY-----------KYRTSIYLLSSATAEFFADIMLCPFEAIKVK 142
             + L        E T             +Y T   +LS   +   +        A    
Sbjct: 187 QIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHTILSVVKSRIQSG-------ATTTL 239

Query: 143 QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIP 183
              T+ P  N       K+Y++EG    YKG  P   R  P
Sbjct: 240 ADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGP 280

 Score = 28.5 bits (62), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 7/84 (8%)

Query: 220 FVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVA-------LKRIYSRIGFVGLWN 272
           FV G  AG+   +V +P DV+ +++  +        VA       L +I  R GF  L+ 
Sbjct: 12  FVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTGSGVAYNGVIDCLGQIVKREGFSRLYK 71

Query: 273 GLPVRILMIGTLTSFQWLIYDSFK 296
           G+   +LM     + ++   DS++
Sbjct: 72  GISSPMLMEAPKRATKFACNDSYQ 95

>Scas_669.6
          Length = 373

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/313 (21%), Positives = 125/313 (39%), Gaps = 50/313 (15%)

Query: 19  CTLGGIVACGPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLGK-LFTGVG 75
           C L G +      SS+  LD +K R Q  P    Y++ T+    I  +EG+ + L+ G  
Sbjct: 54  CVLAGGIGGIIGDSSMHSLDTVKTRQQGAPMTPKYKNMTTAYRTIFLEEGIARGLYGGYF 113

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
           A  +G     A  +G YE  KR     L  ++  ++       L +    +F +  +  P
Sbjct: 114 AAMLGSFPSAAIFFGTYEWCKRKMIGDLGFNDTVSH-------LSAGLLGDFVSSFVYVP 166

Query: 136 FEAIKVKQQTTMPPWCNN-----------VIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184
            E +K + Q  +    NN           +    + +   EG+   + G      R +P+
Sbjct: 167 SEVLKTRLQ--LQGRVNNPFFQSGYNYRSLRTAIRIIVNTEGVKALFFGYKATLARDLPF 224

Query: 185 TMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI 244
           +  +F  +E+  +  + +L  K      L   +  F G  +AG L  I++ P DV+ +++
Sbjct: 225 SALQFGFYEKFRQTAF-KLEKKDITKHNLSIPNEIFTGA-IAGGLAGIITTPMDVIKTRL 282

Query: 245 NNER----------------KVNE---------SMNVALKRIYSRIGFVGLWNGLPVRIL 279
             ++                K N+         S+  +LK +Y   G +G ++G+  R +
Sbjct: 283 QTQQADINPNSATTVGAISAKTNKKSRPIVLSNSIFRSLKLVYQSEGVIGFFSGVGPRFV 342

Query: 280 MIGTLTSFQWLIY 292
                +S   L+Y
Sbjct: 343 WTSVQSSIMLLLY 355

>Sklu_2363.2 YPR011C, Contig c2363 11969-12940
          Length = 323

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 125/303 (41%), Gaps = 45/303 (14%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVD--PTLYRSNTSGII-QILKKEGLGKLFTGVGAT 77
           L G +A   + + V+P + +K  LQV    T Y     G + Q+ ++EG   LF G G  
Sbjct: 27  LAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPGLFRGNGLN 86

Query: 78  CIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIY--LLSSATAEFFADIMLCP 135
           CI      A ++  YE  K+    H    + +  + +   +  L S A     + +   P
Sbjct: 87  CIRIFPYSAVQFVVYEACKK----HFFHVDGSKGREQLQNWQRLFSGALCGGCSVLATYP 142

Query: 136 FEAIKVK----------------QQTTMPPWCNNVIEGWKKMYAKEG-LNGFYKGITPLW 178
            + ++ +                   + PP   +++    + Y +EG + G Y+G+ P  
Sbjct: 143 LDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLL---CRTYKEEGGIKGLYRGVWPTS 199

Query: 179 CRQIPYTMCKFTSFERIVEAIYARLPT-KKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237
              +PY    F  +E+  E     +P    + ++   ++S+    G ++G +   V++P 
Sbjct: 200 LGVVPYVALNFAVYEQFKEF----MPEGTDNTLANFYKLSI----GALSGGVAQTVTYPF 251

Query: 238 DVMVSKIN------NERKVN-ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWL 290
           D++  +        NE     +S+  AL  I    GF G + GL   +  +   T+  WL
Sbjct: 252 DLLRRRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWL 311

Query: 291 IYD 293
           +Y+
Sbjct: 312 VYE 314

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 95/206 (46%), Gaps = 22/206 (10%)

Query: 112 KYRTSIYLLSSATAEFFADIMLCPFEAIKV--KQQTTMPPWCNNVIEGWKKMYAKEGLNG 169
           K  +++  L+   A   +  ++ PFE +K+  + Q +   +   ++   +++Y +EG  G
Sbjct: 19  KNDSNVAFLAGGLAGAVSRTVVSPFERVKILLQVQNSTTAYNQGIVGAVRQVYREEGTPG 78

Query: 170 FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGIL 229
            ++G      R  PY+  +F  +E   +  +    +K  E   LQ     F G    G  
Sbjct: 79  LFRGNGLNCIRIFPYSAVQFVVYEACKKHFFHVDGSKGREQ--LQNWQRLFSGALCGG-- 134

Query: 230 CAIV-SHPADVMVSKIN----NERKVNES--MNVA--------LKRIYSRIGFV-GLWNG 273
           C+++ ++P D++ ++++    N  K+++S   N++        L R Y   G + GL+ G
Sbjct: 135 CSVLATYPLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRG 194

Query: 274 LPVRILMIGTLTSFQWLIYDSFKAYV 299
           +    L +    +  + +Y+ FK ++
Sbjct: 195 VWPTSLGVVPYVALNFAVYEQFKEFM 220

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 76/186 (40%), Gaps = 27/186 (14%)

Query: 36  PLDLIKCRLQVDPT----LYRSNTSGI----------IQILKKEG-LGKLFTGVGATCIG 80
           PLDL++ RL +       L +S    I           +  K+EG +  L+ GV  T +G
Sbjct: 142 PLDLVRTRLSIQTANLTKLSKSRAHNISKPPGVWDLLCRTYKEEGGIKGLYRGVWPTSLG 201

Query: 81  YSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIK 140
                A  +  YE FK         D   A  Y+ SI  LS   A+     +  PF+ ++
Sbjct: 202 VVPYVALNFAVYEQFKEFMPEG--TDNTLANFYKLSIGALSGGVAQ----TVTYPFDLLR 255

Query: 141 VKQQ------TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194
            + Q        +     +V++    +   EG  G+YKG+T    + IP T   +  +E 
Sbjct: 256 RRFQVLAMGGNELGFRYKSVMDALITIGKTEGFRGYYKGLTANLFKVIPSTAVSWLVYEV 315

Query: 195 IVEAIY 200
           + + ++
Sbjct: 316 VCDLMH 321

>CAGL0G03135g 290834..291757 similar to sp|P53257 Saccharomyces
           cerevisiae YGR096w, hypothetical start
          Length = 307

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/273 (21%), Positives = 113/273 (41%), Gaps = 31/273 (11%)

Query: 9   ELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLG 68
           E+ T     A +L G+ A     + + PLD +K +LQV P  +  N + +I ILK+EG+ 
Sbjct: 12  EVSTTNSLVAGSLSGLFA----RTCIAPLDTVKIKLQVTP--HNKNANVLINILKREGIR 65

Query: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRT----SIYLLSSAT 124
             + G     I Y + G  ++G Y          L  D   + +  +    S+  ++S+ 
Sbjct: 66  GFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGL--DLNISPQLYSCLVGSLAGMTSSL 123

Query: 125 AEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184
           A +  D++   F A     Q  +    + ++  W    + EGL GF+ G           
Sbjct: 124 ASYPFDVLRTRFAA---NSQGQLIKLRDEIMAIW----SHEGLMGFFSGCGSSMINIGLN 176

Query: 185 TMCKFTSFE--RIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242
           T   F  +E  +I     ++L  ++   + L +++     G ++G    + + P D +  
Sbjct: 177 TAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELA-----GPISGFTSKLATFPLDTVRR 231

Query: 243 KIN-----NERKVNESMNVALKRIYSRIGFVGL 270
           +I      NE + +      + + Y    F+G+
Sbjct: 232 RIQIRNSPNEERHDREFTKDIYKSYKNRRFLGV 264

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/205 (20%), Positives = 81/205 (39%), Gaps = 43/205 (20%)

Query: 18  ACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSG--------IIQILKKEGLGK 69
           +C +G +     + +S  P D+++ R       + +N+ G        I+ I   EGL  
Sbjct: 110 SCLVGSLAGMTSSLASY-PFDVLRTR-------FAANSQGQLIKLRDEIMAIWSHEGLMG 161

Query: 70  LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYR----TSIYLLSSATA 125
            F+G G++ I   L  A  +G YE      S  +  +E +    R    T +  L+   +
Sbjct: 162 FFSGCGSSMINIGLNTAIMFGVYE------SIKIFTEERSKLSDRRDPFTLLNELAGPIS 215

Query: 126 EFFADIMLCPFEAIKVKQQTTMPP--------WCNNVIEGWKK---------MYAKEGLN 168
            F + +   P + ++ + Q    P        +  ++ + +K          M  +EG  
Sbjct: 216 GFTSKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPL 275

Query: 169 GFYKGITPLWCRQIPYTMCKFTSFE 193
             Y+G+T    + +P T     S+E
Sbjct: 276 SLYRGVTMSLIKSVPSTAISLWSYE 300

>YIL134W (FLX1) [2542] chr9 (97395..98330) Protein involved in
           transport of FAD from cytosol into the mitochondrial
           matrix, member of mitochondrial carrier (MCF) family of
           membrane transporters [936 bp, 311 aa]
          Length = 311

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 62/304 (20%), Positives = 126/304 (41%), Gaps = 37/304 (12%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILK----------KEGLGKL 70
           + G+ A   T   V PLDL+K RLQ+  T  +    G   ++K          +    +L
Sbjct: 14  ISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIRSSANSGRSVTNEL 73

Query: 71  FTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATA-------YKYRTSIYLLSSA 123
           + G+     G ++     +G Y + K L    + K   T        +K  + IYL + A
Sbjct: 74  YRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGNDHKMNSLIYLSAGA 133

Query: 124 TAEFFADIMLCPFEAIKVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR 180
           ++     I+  P   IK +  +T         ++  G +++   +G  G +KG+ P    
Sbjct: 134 SSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGFQGLWKGLVPAL-- 191

Query: 181 QIPYTMCKFTSFERIVEAIYARLPTKKSE------MSALQQISVSFVGGYMAGILCAIVS 234
              + + +   +  + + +  R   +K E      ++ L+ I ++ +G  ++  L     
Sbjct: 192 ---FGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVSVTLV---- 244

Query: 235 HPADVMVSKINNERKVNESMNV--ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIY 292
           +P  ++ S + + R   +   +   +K I +  GFVGL+ GL   ++     T   + +Y
Sbjct: 245 YPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCITFCVY 304

Query: 293 DSFK 296
           ++ K
Sbjct: 305 ENLK 308

>Scas_709.9
          Length = 365

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 77/176 (43%), Gaps = 12/176 (6%)

Query: 35  TPLDLIKCRLQVDPTL------YRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGK 88
            P+ ++K RL +   L      YR       +I+ +EG+  L+TG+  +  G  L  A  
Sbjct: 181 NPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGL-LHVAIH 239

Query: 89  YGGYELFK-RLYSTHLVK-DEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146
           +  YE  K RL+   +     +  +    +  +++S+ ++  A I+  P E ++ + Q  
Sbjct: 240 FPVYEKLKNRLHCDTITGGHNSQEHSLHLTRLIIASSASKMLASILTYPHEILRTRMQLK 299

Query: 147 MPPWC---NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
                   + +++  K+ Y  EGL GFY G      R +P +     SFE    A+
Sbjct: 300 SDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEYFRNAL 355

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/291 (20%), Positives = 118/291 (40%), Gaps = 39/291 (13%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQ------VDPTLYRSNTSGIIQILKKEGLGKLFTGV 74
           L GI+ C        PLD+ K RLQ      ++   YR     +  I+  EG+  L+ G+
Sbjct: 77  LSGIIVC--------PLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLYKGL 128

Query: 75  GATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLC 134
               +GY       +  YE  K LY   L   +  ++         S+ TA   + ++  
Sbjct: 129 IPIILGYFPTWMIYFSVYEFAKDLYPRVLPNSDFISHS-------CSAITAGAASTVLTN 181

Query: 135 PFEAIKVKQQTTMP-----PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKF 189
           P   +K +     P           I+ +KK+  +EG+   Y G+ P     + +    F
Sbjct: 182 PIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGLVPSMFGLL-HVAIHF 240

Query: 190 TSFERIVEAIYARLPT--KKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNE 247
             +E++   ++    T    S+  +L  ++   +    + +L +I+++P +++ +++  +
Sbjct: 241 PVYEKLKNRLHCDTITGGHNSQEHSL-HLTRLIIASSASKMLASILTYPHEILRTRMQLK 299

Query: 248 RK----VNESMNVALKRIYSRIGFVGLWNGLPVRILMIG-----TLTSFQW 289
                     +   +KR Y   G +G ++G    +L        TL SF++
Sbjct: 300 SDKLLISKHKLLDLIKRTYRYEGLLGFYSGFATNLLRTVPASAITLVSFEY 350

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 74/170 (43%), Gaps = 21/170 (12%)

Query: 117 IYLLSSATAEFFADIMLCPFEAIKVKQQ-----TTMPPWCNNVIEGWKKMYAKEGLNGFY 171
           I  LS A A F + I++CP +  K + Q     +   P+   V+     +   EG+ G Y
Sbjct: 66  ITALSGALAGFLSGIIVCPLDVTKTRLQAQGIQSIENPYYRGVLGTMSTIVVDEGVRGLY 125

Query: 172 KGITPLWCRQIPYTMCKFTSFERIVEAIYAR-LPTKKSEMSALQQISVSFVGGYMAGILC 230
           KG+ P+     P  M  F+ +E   + +Y R LP       +   I+        AG   
Sbjct: 126 KGLIPIILGYFPTWMIYFSVYE-FAKDLYPRVLPNSDFISHSCSAIT--------AGAAS 176

Query: 231 AIVSHPADVMVSKINNERKVNESMN------VALKRIYSRIGFVGLWNGL 274
            ++++P  V+ +++  +  + ES         A K+I ++ G   L+ GL
Sbjct: 177 TVLTNPIWVVKTRLMLQTPLGESRTHYRGTIDAFKKIITQEGVRTLYTGL 226

>KLLA0F17864g complement(1634241..1635164) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 307

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 84/196 (42%), Gaps = 28/196 (14%)

Query: 15  YYAACTLGGIVACGPTHSSV-----TPLDLIKCRLQVDPTL-----YRSNTSGIIQILKK 64
           Y    +LG    CG    S      TP++ ++ RLQ+         Y+S      ++LK+
Sbjct: 116 YDNTLSLGQYYTCGFVSGSANALLATPIEHVRIRLQLQKEALANAEYKSTLDCTEKLLKQ 175

Query: 65  EGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLV----KDEATAYKYRTSIYLL 120
              G L  G  AT +  S  G G Y  +  ++ L ++ L     +++ +A+K      + 
Sbjct: 176 ---GSLMRGFTATLMRTS-HGFGIY--FLTYETLIASQLAHGFRREDISAWK----ACMF 225

Query: 121 SSATAEFFADIMLCPFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPL 177
            + +  FF   M  PF+ +K   Q      P +  NV++  K +Y + GL  F KG  P 
Sbjct: 226 GALSGAFFW-AMTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIYRERGLRAFTKGFMPT 284

Query: 178 WCRQIPYTMCKFTSFE 193
             R +P     F +FE
Sbjct: 285 MLRSLPVNGATFAAFE 300

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 52/252 (20%), Positives = 104/252 (41%), Gaps = 27/252 (10%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELF 95
           P D+IK RLQ  P    +    I  ++K EG    + G  A  +G     + ++G  E  
Sbjct: 44  PFDIIKVRLQTMPG-NATAWEAITDLVKYEGFMGFYKGTMAPLVGVGACVSCQFGINEAM 102

Query: 96  KRLY-----STHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPW 150
           KR +     S  +  +  +  +Y T  ++  SA A     ++  P E ++++ Q      
Sbjct: 103 KRYFRDLNRSRGIYDNTLSLGQYYTCGFVSGSANA-----LLATPIEHVRIRLQLQKEAL 157

Query: 151 CN----NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK 206
            N    + ++  +K+  +  L    +G T    R        F ++E ++ +  A    +
Sbjct: 158 ANAEYKSTLDCTEKLLKQGSL---MRGFTATLMRTSHGFGIYFLTYETLIASQLAH-GFR 213

Query: 207 KSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVAL----KRIY 262
           + ++SA +    + + G ++G     +++P DV+ S +  ++ VN +    +    K IY
Sbjct: 214 REDISAWK----ACMFGALSGAFFWAMTYPFDVVKSVMQADKLVNPAYGTNVVQVAKNIY 269

Query: 263 SRIGFVGLWNGL 274
              G      G 
Sbjct: 270 RERGLRAFTKGF 281

>CAGL0K11616g complement(1121834..1122796) highly similar to
           sp|P32332 Saccharomyces cerevisiae YKL120w, hypothetical
           start
          Length = 320

 Score = 51.2 bits (121), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 77/179 (43%), Gaps = 15/179 (8%)

Query: 135 PFEAIKVKQQTTMPPWC------NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
           P E +K++ Q              N  +    ++  EG+ G  KG+   +  QI     +
Sbjct: 38  PIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSR 97

Query: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI---N 245
              +E I  A+  +      E   +Q + ++   G  +GI+ A++  P  ++ +++   +
Sbjct: 98  LGFYEPI-RAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYS 156

Query: 246 NERKVNESMNV-----ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           N  K+ E  +       LK IY   G  GL+ G+   IL  G  +S Q  IY++ K ++
Sbjct: 157 NAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFL 215

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 102/260 (39%), Gaps = 48/260 (18%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT-------SGIIQILKKEGLG 68
           + + T GG+ AC    +   P++++K R+Q+   L  +N          +  + + EG+ 
Sbjct: 19  FGSFTAGGLAACIAV-TVTNPIEVVKIRMQLQGELMAANQRIYTNPFQAMGVVFRNEGIR 77

Query: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFF 128
            L  G+ A  I        + G YE  + + +     D+ +       I + + A +   
Sbjct: 78  GLQKGLVAAYIYQIALNGSRLGFYEPIRAVMNKTFYPDQESHKVQSVGINVFAGAASGII 137

Query: 129 ADIMLCPF-----------EAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPL 177
             +M  P             AIK+ +QT        V  G K +Y  EG+ G ++GI   
Sbjct: 138 GAVMGSPLFLVKTRLQSYSNAIKIGEQT----HYTGVWNGLKTIYMTEGVKGLFRGIDAA 193

Query: 178 WCR-------QIP-YTMCK-FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGI 228
             R       Q+P Y   K F     I+E                   S+      ++G+
Sbjct: 194 ILRTGAGSSVQLPIYNTAKNFLLRNDIME----------------DGPSLHLTASTISGL 237

Query: 229 LCAIVSHPADVMVSKINNER 248
             A+V +P DV++++I N++
Sbjct: 238 GVAVVMNPWDVILTRIYNQK 257

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 71/175 (40%), Gaps = 14/175 (8%)

Query: 35  TPLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86
           +PL L+K RLQ         + T Y    +G+  I   EG+  LF G+ A  +     GA
Sbjct: 143 SPLFLVKTRLQSYSNAIKIGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAIL---RTGA 199

Query: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146
           G      ++    +  L  D     +   S++L +S  +     +++ P++ I  +    
Sbjct: 200 GSSVQLPIYNTAKNFLLRND---IMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQ 256

Query: 147 MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA 201
                   I+   K    EG+   YKG      R  P+T+   T  E+ ++ ++A
Sbjct: 257 KGDLYKGPIDCLVKTVKIEGITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHA 311

>AFR146W [3338] [Homologous to ScYOR130C (ORT1) - SH]
           complement(702404..703249) [846 bp, 281 aa]
          Length = 281

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 78/184 (42%), Gaps = 21/184 (11%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTL------YRSNTSGIIQILKKEGLGKLFTGV 74
             G +A   T   +TP++L+KC+LQV          Y +    +  I+K+ GLG L+ G 
Sbjct: 107 FAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLGGLWQGQ 166

Query: 75  GATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLC 134
             T I  S  GA  +  YE+ K   +      E T ++    +   + A A F A I   
Sbjct: 167 SGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWEL---LASGAGAGAAFHASIF-- 221

Query: 135 PFEAIKVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
           P + +K   QT    + P    V++       K G  GFY+G+     R +P     F  
Sbjct: 222 PADTVKSTMQTEHLGLGPAVRTVLK-------KHGPTGFYRGVGITLLRALPANAVIFYV 274

Query: 192 FERI 195
           +E +
Sbjct: 275 YESL 278

>KLLA0E08877g complement(791157..792041) similar to sgd|S0002277
           Saccharomyces cerevisiae YDL119c, start by similarity
          Length = 294

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/268 (20%), Positives = 111/268 (41%), Gaps = 17/268 (6%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQILKK-EGLGKLFTGVGATCIGYSLQGAGKYGGYEL 94
           P DL+K RLQ D       TS + + LK  E   +L+ G   +CI  S+  A        
Sbjct: 27  PFDLLKTRLQQD------KTSTLWKTLKSIETPSQLWRGALPSCIRTSVGSAMYLTMLNS 80

Query: 95  FKRLYST-HLVKDEATAYKYRTSIY--LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWC 151
            ++  S         ++Y  + ++Y  + S A       ++  P   IKV+ ++T+  + 
Sbjct: 81  IRQAISKGKNTGSTGSSYLPQLNMYENMFSGAVTRALTGLITMPITVIKVRYESTLYQYT 140

Query: 152 NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMS 211
           + +      ++  EGL GF++G      R  PY       ++R+   +   LP+   +++
Sbjct: 141 S-LRYATSHIFRTEGLRGFFRGFGATALRDAPYAGLYMLFYDRMKVLVPTLLPSNVVKLN 199

Query: 212 ALQQISV---SFVGG---YMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRI 265
           +  + S    + + G   + A ++   ++ P D + +++  E     S       I ++ 
Sbjct: 200 SDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQLEPAKFHSFTSTFWHIATKE 259

Query: 266 GFVGLWNGLPVRILMIGTLTSFQWLIYD 293
               L+ G+ +R+          W IY+
Sbjct: 260 SVRNLFAGISLRLTRKAFSAGIAWGIYE 287

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 16  YAACTLGGIVA--CGPTHSSVT-PLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFT 72
           YA+  + G  A       +S+T P D +K R+Q++P  + S TS    I  KE +  LF 
Sbjct: 207 YASTLINGSSAFSAAVIATSITAPFDTVKTRMQLEPAKFHSFTSTFWHIATKESVRNLFA 266

Query: 73  GVGATCIGYSLQGAGKYGGYE 93
           G+       +      +G YE
Sbjct: 267 GISLRLTRKAFSAGIAWGIYE 287

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 69/173 (39%), Gaps = 16/173 (9%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELF 95
           P+ +IK R +     Y S       I + EGL   F G GAT     L+ A   G Y LF
Sbjct: 124 PITVIKVRYESTLYQYTSLRYATSHIFRTEGLRGFFRGFGATA----LRDAPYAGLYMLF 179

Query: 96  --------KRLYSTHLVK---DEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ 144
                     L  +++VK   D   +    T I   S+ +A   A  +  PF+ +K + Q
Sbjct: 180 YDRMKVLVPTLLPSNVVKLNSDNRYSTYASTLINGSSAFSAAVIATSITAPFDTVKTRMQ 239

Query: 145 TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVE 197
              P   ++    +  +  KE +   + GI+    R+       +  +E IV+
Sbjct: 240 LE-PAKFHSFTSTFWHIATKESVRNLFAGISLRLTRKAFSAGIAWGIYEEIVK 291

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 9/39 (23%), Positives = 24/39 (61%)

Query: 210 MSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248
           MS  ++ +   +GG+  G++ AI+  P D++ +++  ++
Sbjct: 1   MSEQRRATTHLIGGFSGGLVSAIILQPFDLLKTRLQQDK 39

>Sklu_2435.2 YPR128C, Contig c2435 2489-3523 reverse complement
          Length = 344

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 67/304 (22%), Positives = 128/304 (42%), Gaps = 55/304 (18%)

Query: 19  CTLGGIVACGPTHSSVTPLDLIKC----RLQVDPTL------------------------ 50
             L G VA    ++ V PLDL+K     +L+ D  L                        
Sbjct: 6   SALSGAVASAMANTVVYPLDLVKTLVQTQLKQDEQLKQLETEPQSQDKDEPVKDIPPVPI 65

Query: 51  ---------YRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLY-S 100
                    Y S    I +I K+EG+  L+ G+  + +    Q    +  Y   ++ Y  
Sbjct: 66  KLNENNYLQYNSTFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYSFVRKCYFR 125

Query: 101 THLVKDEATAYKYRTSIYL--LSSATAEFFADIMLCPFEAIKVKQQTTMP-PWCNNVIEG 157
             L+  + T +     + L  +++AT++ F +    P   I  +QQT       N+ +  
Sbjct: 126 VKLINRKNTKFTTIEELLLGIVAAATSQIFTN----PISLISARQQTRQGIDGDNDFLTV 181

Query: 158 WKKMYAKE-GLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA--RLPTKKSEMSALQ 214
            K++Y ++  + GF+KG+       I  ++  +TS+E++ +A++    +  KK  + +  
Sbjct: 182 AKEIYKEQRSIKGFWKGLKVSLMLTINPSIT-YTSYEKLKDALFTTDTMNLKKELVDSSS 240

Query: 215 QIS--VSFVGGYMAGILCAIVSHPADVMVSKINNERKVNE--SMNVALKRIYSRIGFVGL 270
           Q+S   +F  G ++ ++ AI++ P  +++SK   +R  +   S    L  +Y   G    
Sbjct: 241 QLSPYQNFTLGVLSKMISAIITMP--LIISKAWLQRNGSNFSSFQQVLYYLYKNEGLRSW 298

Query: 271 WNGL 274
           W GL
Sbjct: 299 WKGL 302

 Score = 32.3 bits (72), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 82/195 (42%), Gaps = 21/195 (10%)

Query: 93  ELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCN 152
           +L K L  T L +DE      +      S    E   DI   P   IK+ +   +    N
Sbjct: 25  DLVKTLVQTQLKQDEQLK---QLETEPQSQDKDEPVKDIPPVP---IKLNENNYLQ--YN 76

Query: 153 NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYAR---LPTKKSE 209
           +  +   K+Y +EG+ G Y+G+T         T   F  +   V   Y R   +  K ++
Sbjct: 77  STFDAIYKIYKQEGIRGLYQGLTTSVMAGFFQTFSYFFWYS-FVRKCYFRVKLINRKNTK 135

Query: 210 MSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKV---NESMNVALKRIY-SRI 265
            + ++++ +    G +A     I ++P  ++ ++    + +   N+ + VA K IY  + 
Sbjct: 136 FTTIEELLL----GIVAAATSQIFTNPISLISARQQTRQGIDGDNDFLTVA-KEIYKEQR 190

Query: 266 GFVGLWNGLPVRILM 280
              G W GL V +++
Sbjct: 191 SIKGFWKGLKVSLML 205

>CAGL0J05522g complement(524930..526489) highly similar to sp|P48233
           Saccharomyces cerevisiae YNL083w, hypothetical start
          Length = 519

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 119/283 (42%), Gaps = 24/283 (8%)

Query: 38  DLIKCRLQVDPTLYRSN-TSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFK 96
           D++       P   RS     II + ++ G+   + G G   +    + + K+G +E+ K
Sbjct: 244 DVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKSFYVGNGLNALKVFPESSIKFGSFEITK 303

Query: 97  RLYS-THLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNV- 154
           +L +     KD     K  T    ++   A   A   + P + +K + Q    P    + 
Sbjct: 304 KLMTKVENCKDTKDLSKLST---FIAGGLAGVCAQFSVYPIDTLKFRMQCA--PLNAELK 358

Query: 155 -----IEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVE---AIYARLPTK 206
                I+  K+MY + GL  FY+G+T       PY      +F  + +   +  A+   K
Sbjct: 359 GRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNK 418

Query: 207 KSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNE------RKVNESMNVALKR 260
           K E   L  + V  +G + +G   A V +P +++ +++  +       + +   +V LK 
Sbjct: 419 KEEDVELSNLVVLPMGAF-SGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKT 477

Query: 261 IYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLPT 303
           I  R G+ GL+ GL   +  +    S  +L Y++ K  + L +
Sbjct: 478 I-QREGYPGLFKGLVPTLAKVCPAVSISYLCYENLKKLMKLQS 519

 Score = 29.6 bits (65), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 76/195 (38%), Gaps = 22/195 (11%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSG---IIQILKK---EGLGK 69
           + A  L G+ A      SV P+D +K R+Q  P    +   G   +IQ  K+   EG  K
Sbjct: 324 FIAGGLAGVCA----QFSVYPIDTLKFRMQCAP--LNAELKGRKLMIQTAKEMYTEGGLK 377

Query: 70  LF-TGVGATCIGYSLQGAGKYGGYELFKRLY----STHLVKDEATAYKYRTSIYLLSSAT 124
           LF  GV    +G     A   G + + K+ Y    +  L K E    +    + L   A 
Sbjct: 378 LFYRGVTVGVLGIFPYAALDLGTFSMLKKWYISSKAKKLNKKEEDV-ELSNLVVLPMGAF 436

Query: 125 AEFFADIMLCPFEAIKVKQQT----TMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR 180
           +  F   ++ P   ++ + Q       P   +   +   K   +EG  G +KG+ P   +
Sbjct: 437 SGTFGATVVYPINLLRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAK 496

Query: 181 QIPYTMCKFTSFERI 195
             P     +  +E +
Sbjct: 497 VCPAVSISYLCYENL 511

>Kwal_55.21335
          Length = 317

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 76/180 (42%), Gaps = 14/180 (7%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVD-----PTLYRSNTSGIIQILKKEGLGKLFTGVG 75
           L G  A   T   +TP++LIKC LQV       T +      +  I++ +G+G L+ G  
Sbjct: 144 LSGAFAGACTSYVLTPVELIKCTLQVSNLEGATTRHSKIWPTVKHIVQHKGIGGLWQGQS 203

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
           +T I     GA  +  YE  K   +      E   ++      L S A+A    +  + P
Sbjct: 204 STFIRECAGGAVWFTTYESLKSYLARRRNDTENHTWE-----LLASGASAGVAFNASIFP 258

Query: 136 FEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
            + IK   QT        +++  K++ A+ G  G Y+G+     R  P     F ++E +
Sbjct: 259 ADTIKSTAQTQHL----GIVDATKRILARSGPAGLYRGLGITLIRAAPANAIVFYTYETL 314

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 112/266 (42%), Gaps = 22/266 (8%)

Query: 36  PLDLIKCRLQVDPT-LYRSNTSGIIQILKKEGLGK-LFTGVGATCIGYSLQGAGKYGGYE 93
           PLD IK RLQ  P  ++ ++ S I    +KEG  K  + GV +  +G +L+ A  +  + 
Sbjct: 65  PLDTIKVRLQTQPAHVFPTSWSCIKYTYQKEGFVKGFYQGVASPLVGAALENAVLFVTFN 124

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ-TTMPPWCN 152
             +      L + E+ +   +T   +LS A A      +L P E IK   Q + +     
Sbjct: 125 RAQNF----LQQYESVSPLSQT---VLSGAFAGACTSYVLTPVELIKCTLQVSNLEGATT 177

Query: 153 NVIEGW---KKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSE 209
              + W   K +   +G+ G ++G +  + R+       FT++E +   +  R    ++ 
Sbjct: 178 RHSKIWPTVKHIVQHKGIGGLWQGQSSTFIRECAGGAVWFTTYESLKSYLARRRNDTENH 237

Query: 210 MSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVG 269
              L         G  AG+       PAD + S    +   +  +  A KRI +R G  G
Sbjct: 238 TWEL------LASGASAGVAFNASIFPADTIKSTAQTQ---HLGIVDATKRILARSGPAG 288

Query: 270 LWNGLPVRILMIGTLTSFQWLIYDSF 295
           L+ GL + ++      +  +  Y++ 
Sbjct: 289 LYRGLGITLIRAAPANAIVFYTYETL 314

>AFR542W [3734] [Homologous to ScYMR241W (YHM2) - SH]
           complement(1408478..1409410) [933 bp, 310 aa]
          Length = 310

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 74/150 (49%), Gaps = 13/150 (8%)

Query: 158 WKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSE--MSALQQ 215
           +K+++A EGL G  KG+  +  RQ+     +F    R+VE    R+  K+S+  +SA+++
Sbjct: 157 FKQIFAAEGLRGINKGVNAVAIRQMTNWGSRF-GLSRLVEDGIRRVTHKRSDEKLSAMEK 215

Query: 216 ISVSFVGGYMAGILCAIVSHPADV----MVSKINN-ERKVNESMNVALKRIYSRIGFVGL 270
           I  S +GG ++       + P +V    M S+ N+  R  N ++    + IY   G  GL
Sbjct: 216 IVASALGGGLSAW-----NQPIEVIRVEMQSRTNDPNRPKNLTVGKTFRYIYENNGLRGL 270

Query: 271 WNGLPVRILMIGTLTSFQWLIYDSFKAYVG 300
           + G+  RI +    T F     D  + +VG
Sbjct: 271 YRGVTPRIGLGVWQTIFMVGFGDIARDFVG 300

>Sklu_2075.3 , Contig c2075 6414-7451 reverse complement
          Length = 345

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/200 (24%), Positives = 83/200 (41%), Gaps = 27/200 (13%)

Query: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK----EGLGKLFT 72
           + C + G++A         P++L K +LQV      +  +G + ++KK     G+  L+ 
Sbjct: 159 SGCIISGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYTGPVDVIKKVYSSNGVRGLYK 218

Query: 73  GVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSA-TAEFFADI 131
           G+ +T I +       +G YEL  R +  H    +       T+I   S   +A F    
Sbjct: 219 GLTSTLI-FRTNFVFWWGSYELLTRWFKEHTNMSD-------TAINFWSGGFSASFGFWT 270

Query: 132 MLCPFEAIKVKQQTTMPPWCNNVIEG----WK----KMYAKEGLNGFYKGITPLWCRQIP 183
              P + IK   Q  +   CN+  +G    WK     ++   G  GF+KG  P + R  P
Sbjct: 271 TAYPSDVIK---QVVL---CNDKYDGTFRSWKLAAKDIWRTRGYRGFFKGFVPSFLRSFP 324

Query: 184 YTMCKFTSFERIVEAIYARL 203
                  +FE ++    A++
Sbjct: 325 ANAAALAAFEFVLRTSGAKV 344

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 69/166 (41%), Gaps = 14/166 (8%)

Query: 135 PFEAIKVKQQTTMPP-WCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQI--PYTMCKFTS 191
           PF+ IKV+ QT+         ++   K + ++G+ GFY G TP     I     M     
Sbjct: 80  PFDTIKVRLQTSQDSTRFKGPLDCVYKTFTQQGIRGFYLGFTPPLVGWILMDSVMLGCLH 139

Query: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN 251
             R++   Y     +K  +S         + G MAG   + ++ P ++  +K+  +    
Sbjct: 140 NYRMLLKKYVYYNEEKLPLSG------CIISGVMAGWSVSFIAAPVELAKAKLQVQYDAK 193

Query: 252 ESMNVA----LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYD 293
            +        +K++YS  G  GL+ GL    L+  T   F W  Y+
Sbjct: 194 TTKYTGPVDVIKKVYSSNGVRGLYKGL-TSTLIFRTNFVFWWGSYE 238

>Sklu_2194.3 YMR241W, Contig c2194 5245-6183
          Length = 312

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 4/124 (3%)

Query: 158 WKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK---KSEMSALQ 214
           +K++Y K+G+ G  KG+  +  RQ+     +F  F R+VE        K     +++AL+
Sbjct: 157 FKEIYKKDGIKGINKGVNAVAIRQMTNWGSRF-GFSRLVEEGIRNATGKTNPDDKLTALE 215

Query: 215 QISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
           +I+ S +GG ++     I     ++   K +  R  N +++ A K IY   G  GL+ G+
Sbjct: 216 KIAASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIKGLYRGV 275

Query: 275 PVRI 278
             RI
Sbjct: 276 APRI 279

 Score = 29.3 bits (64), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 65/177 (36%), Gaps = 23/177 (12%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII---------QILKKEG 66
           + +  +GG+   G    +   +    C   V+ T  +S  +G I         +I KK+G
Sbjct: 108 FGSGIMGGV--TGGVAQAYLTMGFCTCMKTVEITKKKSAGAGAIPQSSWGAFKEIYKKDG 165

Query: 67  LGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAE 126
           +  +  GV A  I        ++G    F RL     +++          +  L    A 
Sbjct: 166 IKGINKGVNAVAIRQMTNWGSRFG----FSRLVEEG-IRNATGKTNPDDKLTALEKIAAS 220

Query: 127 FFADIMLC---PFEAIKVKQQTTMP----PWCNNVIEGWKKMYAKEGLNGFYKGITP 176
                +     P E I+V+ Q+       P    V   +K +Y   G+ G Y+G+ P
Sbjct: 221 AIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVSSAFKYIYQSSGIKGLYRGVAP 277

>YNL003C (PET8) [4582] chr14 complement(624974..625828) Protein of
           the mitochondrial carrier (MCF) family of membrane
           transporters, has similarity to Mrs4p and Mrs3p [855 bp,
           284 aa]
          Length = 284

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 122/296 (41%), Gaps = 35/296 (11%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIG 80
           L G  A   T     P+D IK RLQ     + +            G   ++ G+G+  + 
Sbjct: 9   LSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANG-----------GYKGIYRGLGSAVVA 57

Query: 81  YSLQGAGKYGGYELFKRLYSTHLVK--DEATAYKYRTSIYLLSSATAEFFADIMLCPFEA 138
            +   +  +  Y+  K     ++ K   + +     T+ ++LSS+  E  A ++  P E 
Sbjct: 58  SAPGASLFFISYDYMKVKSRPYISKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEV 117

Query: 139 IKVKQQ--TTMPPWCNNVIEGWKKMYAKEGLN-GFYKGITPLWCRQIPYTMCKFTSFERI 195
           +K + Q  +T   W    ++   +   KEGL    Y+G +    R+IP+T  +F  +E +
Sbjct: 118 VKQRTQVHSTNSSW--QTLQSILRNDNKEGLRKNLYRGWSTTIMREIPFTCIQFPLYEYL 175

Query: 196 VEAIYARLPTKKSEMSALQQISVS----FVGGYMAGILCAIVSHPADVMVSKINNERKVN 251
                     KK+   A  Q  V      + G +AG + A  + P D + +++    K  
Sbjct: 176 ----------KKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRL-MLNKTT 224

Query: 252 ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV--GLPTSG 305
            S+   + RIY   G    ++G+  R + I    +    +Y++  + +    PT+G
Sbjct: 225 ASLGSVIIRIYREEGPAVFFSGVGPRTMWISAGGAIFLGMYETVHSLLSKSFPTAG 280

>YKL120W (OAC1) [3145] chr11 (216990..217964) Mitochondrial
           oxaloacetate transporter, member of the mitochondrial
           carrier (MCF) family of membrane transporters [975 bp,
           324 aa]
          Length = 324

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 77/176 (43%), Gaps = 15/176 (8%)

Query: 135 PFEAIKVKQQ------TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
           P E IK++ Q       +      N I+G   ++  EG+ G  KG+   +  QI     +
Sbjct: 42  PIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIKGLQKGLNAAYIYQIGLNGSR 101

Query: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248
              +E I  ++  +L     E   +Q + V+   G  +GI+ A++  P  ++ +++ +  
Sbjct: 102 LGFYEPIRSSL-NQLFFPDQEPHKVQSVGVNVFSGAASGIIGAVIGSPLFLVKTRLQSYS 160

Query: 249 ---KVNESMNV-----ALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296
              K+ E  +       L  I+   G  GL+ G+   IL  G  +S Q  IY++ K
Sbjct: 161 EFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAK 216

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/251 (20%), Positives = 96/251 (38%), Gaps = 30/251 (11%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVD-------PTLYRSNTSGIIQILKKEGLG 68
           + +   GG+ AC    +   P++LIK R+Q+          +Y++   G+  I K EG+ 
Sbjct: 23  FGSFVAGGLAACIAV-TVTNPIELIKIRMQLQGEMSASAAKVYKNPIQGMAVIFKNEGIK 81

Query: 69  KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFF 128
            L  G+ A  I        + G YE  +   +     D+         + + S A +   
Sbjct: 82  GLQKGLNAAYIYQIGLNGSRLGFYEPIRSSLNQLFFPDQEPHKVQSVGVNVFSGAASGII 141

Query: 129 ADIMLCPF-----------EAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPL 177
             ++  P            E IK+ +QT        V  G   ++  EG+ G ++GI   
Sbjct: 142 GAVIGSPLFLVKTRLQSYSEFIKIGEQT----HYTGVWNGLVTIFKTEGVKGLFRGIDAA 197

Query: 178 WCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237
             R    +  +   +      +      K      L   ++S +G        A+V +P 
Sbjct: 198 ILRTGAGSSVQLPIYNTAKNILVKNDLMKDGPALHLTASTISGLG-------VAVVMNPW 250

Query: 238 DVMVSKINNER 248
           DV++++I N++
Sbjct: 251 DVILTRIYNQK 261

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 76/175 (43%), Gaps = 14/175 (8%)

Query: 35  TPLDLIKCRLQV--------DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGA 86
           +PL L+K RLQ         + T Y    +G++ I K EG+  LF G+ A  +     GA
Sbjct: 147 SPLFLVKTRLQSYSEFIKIGEQTHYTGVWNGLVTIFKTEGVKGLFRGIDAAIL---RTGA 203

Query: 87  GKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTT 146
           G      ++    +  LVK++    K   +++L +S  +     +++ P++ I  +    
Sbjct: 204 GSSVQLPIYNTAKNI-LVKNDL--MKDGPALHLTASTISGLGVAVVMNPWDVILTRIYNQ 260

Query: 147 MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA 201
                   I+   K    EG+   YKG      R  P+T+   T  E+ ++ +Y+
Sbjct: 261 KGDLYKGPIDCLVKTVRIEGVTALYKGFAAQVFRIAPHTIMCLTFMEQTMKLVYS 315

>CAGL0C02013g complement(209930..210919) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1, hypothetical
           start
          Length = 329

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 73/159 (45%), Gaps = 27/159 (16%)

Query: 153 NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSA 212
           NV+    ++Y + GL  ++KG  P   RQ+  ++ +FT+F  + +  +A    + +E   
Sbjct: 180 NVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTTFTMLKQ--FAPKEYQNNE--- 234

Query: 213 LQQISVSFVGGYMAGIL-----CAIV--SHPADVMVSKINNERKV---NESMNVALKRIY 262
                      Y A +L     CA+V  + P DV+ +++  +  V     S+N A  RI+
Sbjct: 235 -----------YFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCAY-RIF 282

Query: 263 SRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGL 301
              GF  LW G   R++ +G   S  + IY   +  + L
Sbjct: 283 VEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQYTENMIAL 321

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 48/95 (50%), Gaps = 4/95 (4%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPT--LYRSNTSGI 58
           M K  +P E    EY+A  TL G+++      +  PLD+IK R+Q   +  LYR++ +  
Sbjct: 221 MLKQFAPKEYQNNEYFA--TLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSINCA 278

Query: 59  IQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
            +I  +EG   L+ G     +   L G+  +G Y+
Sbjct: 279 YRIFVEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQ 313

>Sklu_2115.4 YDL119C, Contig c2115 2906-3805
          Length = 299

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/294 (20%), Positives = 121/294 (41%), Gaps = 24/294 (8%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQV--DPTLYRSNTSGIIQILKKEGLGKLFTGVGATC 78
           +GG V    +   + P DL+K RLQ   D TL+     G ++ ++     +L+ G   + 
Sbjct: 12  IGGFVGGLTSAIVLQPFDLLKTRLQQNKDTTLW-----GTLKEIRSPK--QLWRGALPSS 64

Query: 79  IGYSLQGAGKYGGYELFKRLYSTHLVK--DEATAYKYRTSIY--LLSSATAEFFADIMLC 134
           +  S+  A       +F+   +    +  +  +++  + ++Y  L S A        +  
Sbjct: 65  LRTSIGSALYLSTLNVFRTAMAKGKTQTLNPGSSFLPQLTMYENLASGAFTRGVVGFITM 124

Query: 135 PFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194
           P   IKV+ ++TM  +  ++ E  + +Y+ EG+ GF+ G      R  PY       +E+
Sbjct: 125 PITIIKVRYESTMYSY-KSLGEATRHIYSTEGIRGFFNGCGATVMRDAPYAGLYVLLYEK 183

Query: 195 IVEAIYARLPT------KKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248
               +   LP+      +    +      V+ +  +M+  L   ++ P D + +++  + 
Sbjct: 184 AKLLVPMMLPSSTISYDEAGMFTTYTSTVVNSISAFMSASLATTITSPFDTIKTRMQLDP 243

Query: 249 KVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDS----FKAY 298
                    L  I S+  F  L++GL +R+          W IY+     F AY
Sbjct: 244 TKFSGFYKTLVLIVSKEKFKNLFDGLTLRLTRKAFSAGIAWGIYEELIKRFMAY 297

>Scas_697.47
          Length = 328

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 115/274 (41%), Gaps = 34/274 (12%)

Query: 18  ACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEG----------- 66
           A  +GG+ A    H    P DLIK R Q   +   S+T   I+I+ K+            
Sbjct: 42  AGGVGGVCAVLTGH----PFDLIKVRCQ---SGQASSTIHAIKIILKDARAIPTSNMLVN 94

Query: 67  -LGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATA 125
            +   + GV    +G +   A  + GY++ K++ +     D ++A      + +   A A
Sbjct: 95  SVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKIVTRS---DSSSA-----QLTMGQMAAA 146

Query: 126 EFFADI----MLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQ 181
            F + I    +  P E IKV  QT       + I   K +    G+   +KG      R 
Sbjct: 147 GFISAIPTTLVTAPTERIKVVLQTAGANSKTSFIGAAKNIVKDGGVKSLFKGSLATLARD 206

Query: 182 IPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMV 241
            P +   F S+E   + +  R  T +S+   +   +V   GG +AG+   +V  P D + 
Sbjct: 207 GPGSALYFASYEISKKFLNDRNATAESKTGEVNIANVCLAGG-IAGMSMWLVVFPIDTIK 265

Query: 242 SKINNERKVNESMNVALKRIY-SRIGFVGLWNGL 274
           +K+ +    ++SM  A + IY  R G  G + GL
Sbjct: 266 TKLQSSSG-SQSMVAATREIYVKRGGIKGFFPGL 298

>CAGL0H10538g 1027739..1028632 highly similar to tr|Q07534
           Saccharomyces cerevisiae YDL119c, hypothetical start
          Length = 297

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/291 (19%), Positives = 120/291 (41%), Gaps = 23/291 (7%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK-EGLGKLFTGVGATCI 79
           +GG      +  ++ PLDL+K R Q      ++    + Q +K  +   +L+ G   + I
Sbjct: 9   IGGFAGGLSSAVALQPLDLLKTRFQ------QTKGGTLWQTVKSLDTPWQLWRGTLPSAI 62

Query: 80  GYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKY-------RTSIY--LLSSATAEFFAD 130
             S+  A       L +   +     D A +          + S+Y  L++ A A     
Sbjct: 63  RTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNLPQLSMYENLVTGAFARGTVG 122

Query: 131 IMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFT 190
            +  P   IKV+ ++T+  +  ++ E  K + A+EG+ GF++G  P   R  PY+     
Sbjct: 123 YITMPITIIKVRYESTLYNY-KSIAEAAKSIAAQEGIRGFFRGFGPTCLRDAPYSGLYVL 181

Query: 191 SFERIVEAIYARLP------TKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKI 244
            +E++   +   LP        +   +A    +++     ++  +   V+ P D + +++
Sbjct: 182 LYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRM 241

Query: 245 NNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSF 295
             E    ++    L  I ++   + +++GL +R+          W IY+  
Sbjct: 242 QLEPTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYEEL 292

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 6/95 (6%)

Query: 5   KSPIELYTKEYYAACT------LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGI 58
           KS ++L ++  Y A T         I++     +   P D IK R+Q++PT +++  S +
Sbjct: 196 KSLLQLDSEGRYTAYTSTAINSTSAILSASMATTVTAPFDTIKTRMQLEPTKFKTFWSTL 255

Query: 59  IQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
             I+ +E   K+F+G+       +L     +G YE
Sbjct: 256 TTIVTQEHPIKIFSGLSMRLTRKALSAGIAWGIYE 290

>AGL065C [4246] [Homologous to ScYHR002W (LEU5) - SH]
           (585963..586970) [1008 bp, 335 aa]
          Length = 335

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 66/139 (47%), Gaps = 17/139 (12%)

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCN------NVIEGWKKMYAKEGLNGFYKGITPLWCRQI 182
           A  ++ P + IK+  QT+ P +         ++   K + A +G  GF++G +    R  
Sbjct: 33  AKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLVRASKYIMAHDGPRGFFQGHSATLLRIF 92

Query: 183 PYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242
           PY   KF ++E+I   +   +PT + E    + +S     G +AG+    V++P D++  
Sbjct: 93  PYAAIKFIAYEQIRSVV---IPTWRHESHWRRLLS-----GSLAGLCSVFVTYPLDLVRV 144

Query: 243 KINNERKVNESMNVALKRI 261
           ++     V E  +  +++I
Sbjct: 145 RLAY---VTERHDAKVRKI 160

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 68/335 (20%), Positives = 131/335 (39%), Gaps = 45/335 (13%)

Query: 3   KTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQV-DPTL--YRSNTSGII 59
           +   P++  + +Y     L G +A     + V PLD IK   Q  +P    +  +  G++
Sbjct: 6   RGSGPVDKSSVDYIVKSGLAGGIAGSCAKTLVAPLDRIKILFQTSNPQFAQFAGSMGGLV 65

Query: 60  Q----ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRT 115
           +    I+  +G    F G  AT +      A K+  YE  + +    ++        +R 
Sbjct: 66  RASKYIMAHDGPRGFFQGHSATLLRIFPYAAIKFIAYEQIRSV----VIPTWRHESHWRR 121

Query: 116 SIYLLSSATAEFFADIMLCPFEAIKVK------------QQTTMPPWCNNVIEGWKKMYA 163
              LLS + A   +  +  P + ++V+            ++     +     E  +K Y 
Sbjct: 122 ---LLSGSLAGLCSVFVTYPLDLVRVRLAYVTERHDAKVRKIMACIYNERPSEALRKWYI 178

Query: 164 KEGL---NGFYKGITPLWCRQIPYTMCKFTS-------FERIVEAIYARLPTKKS---EM 210
            +     + FY+G TP     IPY    F +       F   +   Y+ L    S   + 
Sbjct: 179 PQWFAHWSNFYRGYTPTVIGMIPYAGVSFFAHDLCQDIFRHPMLEPYSVLSPGGSSAYDR 238

Query: 211 SALQQISVSFVGGYMAGILCAIVSHPADVM-----VSKINNE-RKVNESMNVALKRIYSR 264
           +   +     V G +AG+     ++P +++     VS I +  R+    +N   K IY+ 
Sbjct: 239 TVPLKTWAQLVAGGLAGMASQTAAYPFEIIRRRLQVSAITDPTRRHFVGINEIAKIIYTE 298

Query: 265 IGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
            G+ G + GL +  + +  + +  + IY+  K Y+
Sbjct: 299 GGWRGFFVGLSIGYIKVTPMVACSFFIYERTKWYL 333

>Kwal_55.21106
          Length = 328

 Score = 48.9 bits (115), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/282 (20%), Positives = 112/282 (39%), Gaps = 34/282 (12%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQ----------------------VDPTLYRSNTSGIIQ 60
           G VA    +  V PLDL+K  +Q                      V    Y+ +   +I+
Sbjct: 10  GAVASSLANVVVYPLDLVKTLIQTQNKEPNIGSEAGVKPQAKKSRVQEIRYKHSLDALIK 69

Query: 61  ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKR-LYSTHLVKDEATAYKYRTSIYL 119
           I K +G+  L+ G+  + I   LQ    +  Y + ++  +   L++      K+ T   L
Sbjct: 70  IFKTKGVLGLYQGLWTSIIAGFLQSFSYFFWYSIVRKSFFRYKLLRGRLG--KFSTPEEL 127

Query: 120 LSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKE-GLNGFYKGITPLW 178
           L    A   + I   P   I  +QQT+         E   ++Y+++  + GF++G     
Sbjct: 128 LLGIVAAAVSQIFTSPIGVISTRQQTSTSGSKGGFREVLHQIYSEQNNITGFWRGFKVSL 187

Query: 179 CRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQIS------VSFVGGYMAGILCAI 232
              +  ++  F S+E++ + I+        E   L + S       +F+ G  + ++  +
Sbjct: 188 ILTVNPSIT-FASYEKL-QDIFITSKRAVDENGQLLETSGQLSPRQNFLLGVFSKVISTL 245

Query: 233 VSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
           ++ P  V  + +       +S    L  +Y + G + LW GL
Sbjct: 246 ITQPLIVSKAYLQRTGSNFQSFQQVLLYLYKQEGLISLWKGL 287

>AGR383W [4694] [Homologous to ScYDL119C - SH]
           complement(1436769..1437650) [882 bp, 293 aa]
          Length = 293

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/280 (21%), Positives = 118/280 (42%), Gaps = 33/280 (11%)

Query: 33  SVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK-EGLGKLFTGVGATCIGYSLQGAGKYGG 91
           ++ PLDL+K RLQ      ++  S +  +L++     +L+ G   + +  S+       G
Sbjct: 25  ALQPLDLLKTRLQ------QAQASSLRSVLREVRTTRELWRGTLPSALRTSI-------G 71

Query: 92  YELFKRL--YSTHLVKDEATAYKYRTSIY--------LLSSATAEFFADIMLCPFEAIKV 141
             L+  L  YS   +   + A + R+S+         LL+ A +     ++  P   IKV
Sbjct: 72  SALYLSLLNYSRSALARGSEA-RTRSSLLPRLQSYQNLLTGALSRAAVGLVTMPITVIKV 130

Query: 142 KQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYA 201
           + ++T+  + N + E  + ++  EG  GF+KG      R  PY       +E+  E +  
Sbjct: 131 RYESTLYAY-NGLAEATRHIWRSEGARGFFKGAAATTLRDAPYAGLYVLLYEQAKEMLPR 189

Query: 202 RLPT------KKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMN 255
            LP       +  +++A     V+ V  +++  L   ++ P D + +++  +      + 
Sbjct: 190 ALPATLLGADESGKLTAPASAMVNGVSAFLSASLATTLTAPFDTIKTRMQLQSHPVGFVQ 249

Query: 256 VALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSF 295
             L+ I        L++GL +R+          W IY+  
Sbjct: 250 T-LRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEEL 288

 Score = 30.4 bits (67), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 39/181 (21%), Positives = 69/181 (38%), Gaps = 27/181 (14%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELF 95
           P+ +IK R +     Y         I + EG    F G  AT    +L+ A   G Y L 
Sbjct: 124 PITVIKVRYESTLYAYNGLAEATRHIWRSEGARGFFKGAAAT----TLRDAPYAGLYVLL 179

Query: 96  ---------KRLYSTHLVKDE-------ATAYKYRTSIYLLSSATAEFFADIMLCPFEAI 139
                    + L +T L  DE       A+A     S +L +S      A  +  PF+ I
Sbjct: 180 YEQAKEMLPRALPATLLGADESGKLTAPASAMVNGVSAFLSAS-----LATTLTAPFDTI 234

Query: 140 KVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
           K + Q    P     ++  + +  +E     + G++   CR+       +  +E +++ +
Sbjct: 235 KTRMQLQSHPV--GFVQTLRHIVCEERARTLFDGLSLRLCRKAMSACIAWGIYEELLKLL 292

Query: 200 Y 200
           +
Sbjct: 293 H 293

>CAGL0K02915g 259026..260054 highly similar to sp|P38702
           Saccharomyces cerevisiae YHR002w LEU5, hypothetical
           start
          Length = 342

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 69/143 (48%), Gaps = 17/143 (11%)

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCN------NVIEGWKKMYAKEGLNGFYKGITPLWCRQI 182
           A  ++ P + IK+  QT+ P +         + E  K ++  +G+ GF++G +    R  
Sbjct: 32  AKTLIAPLDRIKILFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLRIF 91

Query: 183 PYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242
           PY   KF ++E+I   +   +P+++ E S  ++++     G +AG+    +++P D+   
Sbjct: 92  PYAAVKFVAYEQIRSIL---IPSREYE-SHWRRLA----SGSLAGLCSVFITYPLDLTRV 143

Query: 243 KINNERKVNESMNVALKRIYSRI 265
           ++     V E   V L+ I   I
Sbjct: 144 RLAY---VTEHKRVKLRDIVKTI 163

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 66/349 (18%), Positives = 134/349 (38%), Gaps = 55/349 (15%)

Query: 1   MSKT--KSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGI 58
           M+KT  +  ++  + +Y     L G V+     + + PLD IK   Q     Y      +
Sbjct: 1   MTKTNNRQAVDKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKILFQTSNPHYSKYAGSL 60

Query: 59  I-------QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAY 111
           +        I   +G+   F G   T +      A K+  YE  + +    L+       
Sbjct: 61  VGLYEAAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQIRSI----LIPSREYES 116

Query: 112 KYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMY---AKEGLN 168
            +R    L S + A   +  +  P +  +V+           + +  K +Y   A EGL 
Sbjct: 117 HWRR---LASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTIYHEPASEGLT 173

Query: 169 -------------GFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARL--PTKKSEMSAL 213
                         FY+G  P     IPY    F + + I + + + L  P    ++S+ 
Sbjct: 174 SHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLMAPYAVKQLSSQ 233

Query: 214 QQIS-------------VSFVGGYMAGILCAIVSHPADVMVSKIN----NERKVNE---- 252
           +++                 V G ++GIL    ++P +++  ++     + RK+ +    
Sbjct: 234 EELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVSTLSPRKMYDHKFQ 293

Query: 253 SMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGL 301
           S++   + IY   G+ G + GL +  + +  + +  + +Y+  K ++G+
Sbjct: 294 SISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHLGI 342

>Sklu_2374.7 YNL083W, Contig c2374 13874-15415 reverse complement
          Length = 513

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 111/256 (43%), Gaps = 21/256 (8%)

Query: 61  ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL 120
           + ++ G+   + G G   I    + A K+G +EL K+L + HL     T+   + S Y+ 
Sbjct: 263 LYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFELAKQLMA-HLEGVHHTSELSKFSTYI- 320

Query: 121 SSATAEFFADIMLCPFEAIKVKQQ----TTMPPWCNNVIEGWKKMYAKEGLNGFYKGITP 176
           +       A   + P + +K + Q     T       +I   ++MY   GL  FY+G+T 
Sbjct: 321 AGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGGLKLFYRGVTV 380

Query: 177 LWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSAL--QQISVS-FV---GGYMAGILC 230
                 PY      +F  + +   AR    +++M+ +   Q+++S F+    G  +G + 
Sbjct: 381 GVMGIFPYAALDLGTFSALKKWYIAR----QAKMTGVPVDQVTISNFIVLPMGAFSGTVG 436

Query: 231 AIVSHPADVMVSKINNERKVNE-----SMNVALKRIYSRIGFVGLWNGLPVRILMIGTLT 285
           A V +P +++ +++  +               L +   R G+ GL+ GL   +  +    
Sbjct: 437 ATVVYPINLLRTRLQAQGTYAHPHTYTGFRDVLWKTVQREGYQGLFKGLVPNLAKVCPAV 496

Query: 286 SFQWLIYDSFKAYVGL 301
           S  +L Y++FK  + L
Sbjct: 497 SISYLCYENFKRLMKL 512

 Score = 34.7 bits (78), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 65/154 (42%), Gaps = 21/154 (13%)

Query: 154 VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLP--TKKSEMS 211
           +I+    +Y + G+  FY G      +  P +  KF SFE + + + A L      SE+S
Sbjct: 256 LIKAATTLYRQGGIRAFYVGNGLNVIKVFPESAMKFGSFE-LAKQLMAHLEGVHHTSELS 314

Query: 212 ALQQISVSFVGGYMAGILCAIVSHPAD-----VMVSKINNERKVNESMNVALKRIYSRIG 266
                  +++ G M G++     +P D     V  + ++   K NE +    +++Y   G
Sbjct: 315 KFS----TYIAGGMGGVVAQFSVYPIDTLKYRVQCAPLDTALKGNELLISTARQMYRDGG 370

Query: 267 F--------VGLWNGLPVRILMIGTLTSF-QWLI 291
                    VG+    P   L +GT ++  +W I
Sbjct: 371 LKLFYRGVTVGVMGIFPYAALDLGTFSALKKWYI 404

>Scas_687.15*
          Length = 328

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 70/160 (43%), Gaps = 25/160 (15%)

Query: 136 FEAIKVKQQTTMPPW--------CNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187
           F   K KQ +    W         +N+    K++Y   GL GF +G  P   RQ+  +  
Sbjct: 154 FHVAKPKQLSPQEQWRQVYSKYPSSNIFSVVKEIYLTRGLRGFAQGAMPTVFRQVSNSTV 213

Query: 188 KFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIV--SHPADVMVSKIN 245
           +FT++  + + I        S    L ++    +G + +   CA+V  + P DV+ +++ 
Sbjct: 214 RFTAYTTLKQLI--------SPTQPLNEVYAFGIGLFSS---CAVVALTQPIDVVKTRMQ 262

Query: 246 NERK---VNESMNVALKRIYSRIGFVGLWNGLPVRILMIG 282
           ++        S+N A  R++   G V LW G   R+  +G
Sbjct: 263 SKTAHYFYKNSLNCAY-RVFVEEGMVSLWKGWLPRLFKVG 301

>Scas_717.20
          Length = 356

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 60/122 (49%), Gaps = 14/122 (11%)

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCN------NVIEGWKKMYAKEGLNGFYKGITPLWCRQI 182
           A  ++ P + IK+  QT+ P +         + E  K ++  +G+ GF++G +    R  
Sbjct: 46  AKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLKEAAKHIWLNDGIRGFFQGHSVTLMRIF 105

Query: 183 PYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242
           PY   KF ++E+I   +   +P+K+ E    + +S     G +AG+     ++P D++  
Sbjct: 106 PYAAVKFVAYEQIRNTL---IPSKEYESHWRRLMS-----GSLAGLCSVFTTYPLDLIRV 157

Query: 243 KI 244
           ++
Sbjct: 158 RL 159

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 64/347 (18%), Positives = 131/347 (37%), Gaps = 57/347 (16%)

Query: 3   KTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII--- 59
           + + PI+  + EY     L G ++     + + PLD IK   Q     Y      ++   
Sbjct: 19  RNQMPIDKNSLEYITRSGLAGGISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLK 78

Query: 60  ----QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRT 115
                I   +G+   F G   T +      A K+  YE   ++ +T +   E  ++  R 
Sbjct: 79  EAAKHIWLNDGIRGFFQGHSVTLMRIFPYAAVKFVAYE---QIRNTLIPSKEYESHWRR- 134

Query: 116 SIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLN------- 168
              L+S + A   +     P + I+V+          +++   K +Y +           
Sbjct: 135 ---LMSGSLAGLCSVFTTYPLDLIRVRLAYVTEHKRISLLGLVKTIYKEPASTTLEAKGY 191

Query: 169 ---------GFYKGITPLWCRQIPYTMCKFTSFERIVEAI-------YARLPTKKSEMSA 212
                     FY+G TP     IPY    F + + + + +       Y+ L   +SE   
Sbjct: 192 IPNWFAHWCNFYRGYTPTVLGMIPYAGVSFFAHDLLHDVLKHPILAPYSVLALSESEQEE 251

Query: 213 LQ--------QISVSFVGGYMAGILCAIVSHPADVM----------VSKINNERKVNESM 254
                     +     + G +AG+     ++P +++          VS++ + R   +S+
Sbjct: 252 RHFKHQRLPLRTWAELLSGGLAGMASQTAAYPFEIIRRRLQVSTLSVSQMYDHR--FQSI 309

Query: 255 NVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGL 301
           +   K IY   G+ G + GL +  + +  + +  + +Y+  K ++G+
Sbjct: 310 SEIAKIIYKERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHLGI 356

>Kwal_47.19228
          Length = 281

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 57/127 (44%), Gaps = 13/127 (10%)

Query: 159 KKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISV 218
           +++Y   G+ GF +G  P   RQ   +  +FT++  + + I    P  +           
Sbjct: 136 QEIYRSRGIRGFLQGTMPTIIRQTSNSAVRFTTYTSLKQMISPNKPLNE---------YY 186

Query: 219 SFVGGYMAGILCAIVSHPADVMVSKINNE---RKVNESMNVALKRIYSRIGFVGLWNGLP 275
           +F  G+++      V+ P DV+ +++ ++        S+N A  RI+   GF   W G  
Sbjct: 187 AFALGFISSCAVVAVTQPIDVIKTRMQSKYTWSNYKNSLNCAY-RIFVEEGFTKFWKGWA 245

Query: 276 VRILMIG 282
            R++ +G
Sbjct: 246 PRLMKVG 252

>KLLA0E15532g complement(1383230..1384210) similar to sp|P23500
           Saccharomyces cerevisiae YKR052c MRS4 RNA splicing
           protein and member of the mitochondrial carrier family
           (MCF), start by similarity
          Length = 326

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 109/302 (36%), Gaps = 43/302 (14%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNT--------------------SGIIQ 60
           + G  A    HS + P+D +K R+Q    +  + +                      I +
Sbjct: 25  IAGAFAGIMEHSIMFPIDALKTRMQAVSEIKAAASASASGGAGAASGGAGAGTLLQQISR 84

Query: 61  ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLL 120
           I   EG   L+ GV +  +G     A  +  YE  K        KD  T    +T++   
Sbjct: 85  ISSTEGSLALWRGVQSMVMGAGPAHAVYFATYEFCKEQLID--AKDFNTHQPLKTAV--- 139

Query: 121 SSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR 180
           S   A   AD ++ PF+ IK + Q       +++      +Y  EG   F+         
Sbjct: 140 SGVAATVAADALMNPFDTIKQRLQLQSKSSDSSMWRMAFNIYKNEGPMAFFYSYPTTLAM 199

Query: 181 QIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVM 240
            IP+    F  +E           TK    +      +  + G +AG  CA V+ P D +
Sbjct: 200 NIPFAALNFVIYES---------STKFFNPTNAYNPWIHCLCGGIAGATCAAVTTPLDCI 250

Query: 241 --VSKINNERKVN-------ESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLI 291
             V +I     V+        +   A + I+   G+ G W GL  R++     T+  W  
Sbjct: 251 KTVLQIRGSDTVHVESFKTANTFKKAAQAIWQSYGWKGFWRGLQPRVISNIPATAISWTS 310

Query: 292 YD 293
           Y+
Sbjct: 311 YE 312

>KLLA0F08547g 796328..797254 similar to sp|Q04013 Saccharomyces
           cerevisiae YMR241w YHM2 yeast suppressor gene of HM
           (mitochondrial histone) mutant (ABF2) singleton, start
           by similarity
          Length = 308

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 14/129 (10%)

Query: 158 WKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK---KSEMSALQ 214
           +K++Y KEG+ G  KG+  +  RQ+     +F  F R+VE    +   K     +++AL+
Sbjct: 153 FKEIYNKEGIRGINKGVNAVAIRQMTNWGSRF-GFSRLVEEGLRKFTGKTNPDDKLTALE 211

Query: 215 QISVSFVGGYMAGILCAIVSHPADV----MVSKINN-ERKVNESMNVALKRIYSRIGFVG 269
           +I  S +GG ++       + P +V    M SK N+  R  + ++  A + IY   G  G
Sbjct: 212 KIFASAIGGGLSAW-----NQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKG 266

Query: 270 LWNGLPVRI 278
           L+ G+  RI
Sbjct: 267 LYRGVTPRI 275

 Score = 34.3 bits (77), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 72/180 (40%), Gaps = 30/180 (16%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ--------ILKKEGL 67
           + A  +GG+   G    +   +    C   V+ T ++S  +G  Q        I  KEG+
Sbjct: 105 FGAGIMGGV--SGGVAQAYLTMGFCTCMKTVEITKHKSAAAGAKQSSWAAFKEIYNKEGI 162

Query: 68  GKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF 127
             +  GV A  I        ++G    F RL    L K     +  +T+     +A  + 
Sbjct: 163 RGINKGVNAVAIRQMTNWGSRFG----FSRLVEEGLRK-----FTGKTNPDDKLTALEKI 213

Query: 128 FADIMLC-------PFEAIKVKQQ--TTMP--PWCNNVIEGWKKMYAKEGLNGFYKGITP 176
           FA  +         P E I+V+ Q  T  P  P    V + ++ +Y   G+ G Y+G+TP
Sbjct: 214 FASAIGGGLSAWNQPIEVIRVEMQSKTNDPNRPKDLTVGKAFRYIYQSNGVKGLYRGVTP 273

>KLLA0A09383g complement(818752..819852) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 366

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 98/237 (41%), Gaps = 23/237 (9%)

Query: 51  YRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATA 110
           + S      +I + EGL  L+ G+  T +         + GYE+F+       ++D    
Sbjct: 97  FNSTWEAFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFR---DHSPMRDS--- 150

Query: 111 YKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ--------TTMPPWCNNVIEGWKKMY 162
             Y +   L   ATA   A   + P E IK + Q        TT      ++++  +   
Sbjct: 151 --YPSLNPLFCGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEI 208

Query: 163 AKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK--KSEMSALQQISV-S 219
              G    +KG+     R +P++   + S+E   +  +     +  +  +S      + S
Sbjct: 209 RSGGYKVLFKGLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINS 268

Query: 220 FVGGYMAGILCAIVSHPADV----MVSKINNERKVNESMNVALKRIYSRIGFVGLWN 272
           F+GG ++G   A+++HP DV    M   ++ E K   ++    KR+ +R  F  L+N
Sbjct: 269 FIGGSVSGSSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYN 325

 Score = 32.0 bits (71), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 81/201 (40%), Gaps = 35/201 (17%)

Query: 27  CGPTH-----SSVTPLDLIKCRLQVDPTLYRSNTSGII--QILKKE-------GLGKLFT 72
           CG T      ++V PL+LIK RLQ  P   +  T+ ++   +LK+        G   LF 
Sbjct: 159 CGATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFK 218

Query: 73  GVGATCIGYSLQGAGKYGGYELFKRLYSTHLVK-----DEATAYKYRTSIYLLSSATAEF 127
           G+  T        A  +G YE +K+ +     +     + +  + +  + ++  S +   
Sbjct: 219 GLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSGS- 277

Query: 128 FADIMLCPFEAIKVKQQTTMP---PWCNNVIEGWKKMYAK------------EGLNGFYK 172
            A ++  PF+  K + Q TM       N ++   K++ A+            EG    Y 
Sbjct: 278 SAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGALYT 337

Query: 173 GITPLWCRQIPYTMCKFTSFE 193
           G+ P   +  P      +++E
Sbjct: 338 GLIPRVMKIAPSCAIMISTYE 358

>Scas_696.9
          Length = 312

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 6/124 (4%)

Query: 159 KKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSE----MSALQ 214
           + +YAKEGL G YKG+  +  RQ+     +F  F R+VE  + R  T K++    ++A +
Sbjct: 158 RSIYAKEGLRGIYKGVNAVAIRQMTNWGSRF-GFSRLVED-WVRKATGKTKPEDRLNAWE 215

Query: 215 QISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
           +I  + VGG ++     I     ++   K +  R  N ++    K I    G  GL+ G+
Sbjct: 216 KIGATAVGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKGLYRGV 275

Query: 275 PVRI 278
             RI
Sbjct: 276 TPRI 279

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 50/122 (40%), Gaps = 10/122 (8%)

Query: 61  ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEA-TAYKYRTSIYL 119
           I  KEGL  ++ GV A  I        ++G    F RL    + K    T  + R + + 
Sbjct: 160 IYAKEGLRGIYKGVNAVAIRQMTNWGSRFG----FSRLVEDWVRKATGKTKPEDRLNAWE 215

Query: 120 LSSATAEFFA-DIMLCPFEAIKVKQQTTMP----PWCNNVIEGWKKMYAKEGLNGFYKGI 174
              ATA          P E I+V+ Q+       P    V + +K +    G+ G Y+G+
Sbjct: 216 KIGATAVGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVAKTFKYIMKTNGVKGLYRGV 275

Query: 175 TP 176
           TP
Sbjct: 276 TP 277

>Kwal_55.20868
          Length = 380

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 85/196 (43%), Gaps = 20/196 (10%)

Query: 115 TSIYLLSSATAEFFADIMLCPFEAIKVKQQ-----TTMPPWCNNVIEGWKKMYAKEGLNG 169
           T I  LS A A F A + +CP +  K + Q     +    +   ++     +   EG  G
Sbjct: 75  TEITALSGAMAGFLAGVTVCPLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARG 134

Query: 170 FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGIL 229
            YKG+ P+     P  M  F+ +ER  + +Y R+        +   IS S      AG +
Sbjct: 135 LYKGLVPIIMGYFPTWMIYFSVYER-SKKLYPRI------FPSFDFISHS-ASALTAGTV 186

Query: 230 CAIVSHPADVMVSKINNERKVNE------SMNVALKRIYSRIGFVGLWNGLPVRILMIGT 283
             I+++P  V+ +++  +  VN+      S   A  ++Y+  G    + GL   +L +  
Sbjct: 187 STILTNPVWVVKTRLMLQTHVNKNSTHYTSTFDAFHKMYTTEGLRTFYAGLLPSLLGLFH 246

Query: 284 LTSFQWLIYDSFKAYV 299
           + +  + IY+  K ++
Sbjct: 247 V-AIHFPIYEKLKVWL 261

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/301 (18%), Positives = 119/301 (39%), Gaps = 39/301 (12%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQV-----DPTLYRSNTSGIIQ-ILKKEGLGKLFTGV 74
           L G+  C        PLD+ K RLQ      +P+ Y     G +  I++ EG   L+ G+
Sbjct: 88  LAGVTVC--------PLDVAKTRLQAQGLHSNPSNYYKGILGTLTTIIRDEGARGLYKGL 139

Query: 75  GATCIGYSLQGAGKYGGYELFKRLY-----STHLVKDEATAYKYRTSIYLLSSATAEFFA 129
               +GY       +  YE  K+LY     S   +   A+A    T   +L++       
Sbjct: 140 VPIIMGYFPTWMIYFSVYERSKKLYPRIFPSFDFISHSASALTAGTVSTILTNPVWVVKT 199

Query: 130 DIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKF 189
            +ML       V + +T      +  + + KMY  EGL  FY G+ P     + +    F
Sbjct: 200 RLML----QTHVNKNSTH---YTSTFDAFHKMYTTEGLRTFYAGLLPSLL-GLFHVAIHF 251

Query: 190 TSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKIN---- 245
             +E++   ++      ++E   L  ++   +    + ++ + +++P +++ +++     
Sbjct: 252 PIYEKLKVWLHCTPSMSRTEDHNL-NLARLIIASSASKMVASTLTYPHEILRTRMQLKAY 310

Query: 246 -------NERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAY 298
                   ++     +   +K  Y   G  G ++G    +      ++   + ++ F+ Y
Sbjct: 311 PTDPLAALQKTSRHGLIRLIKHTYKSEGLRGFYSGFTANLARTLPASAITLVSFEYFRKY 370

Query: 299 V 299
           +
Sbjct: 371 L 371

>YPR058W (YMC1) [5488] chr16 (673746..674669) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 83/193 (43%), Gaps = 19/193 (9%)

Query: 10  LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDP-TLYRSNTSGIIQILKKEGLG 68
           L   +YYA    GGIV         +P++ ++ RLQ    +   +   G ++ +KK    
Sbjct: 118 LSLPQYYACGVTGGIV----NSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHN 173

Query: 69  K-LFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYK----YRTSIYLLSSA 123
           K L  G+  T +     G G Y  + +++ L +  + K      K    ++  I+   S 
Sbjct: 174 KALLRGLTPTILREG-HGCGTY--FLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSG 230

Query: 124 TAEFFADIMLCPFEAIKVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCR 180
           TA +   +M+ P + IK   QT     P + N++    K +YA  G+  F+KG  P   R
Sbjct: 231 TALW---LMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLR 287

Query: 181 QIPYTMCKFTSFE 193
             P     F +FE
Sbjct: 288 AAPANGATFATFE 300

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 87/204 (42%), Gaps = 13/204 (6%)

Query: 100 STHLVKD--EATAYKYRTSIYLLSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIE 156
           S  L+ D  E   +     +  L + TA   A +++  PF+  KV+ QT+  P     +E
Sbjct: 7   SPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--TTAME 64

Query: 157 GWKKMYAKEGLNGFYKG-ITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQ 215
             +K+ A EG  GFYKG +TPL    I    C    F  + EA+      + ++MS+   
Sbjct: 65  VVRKLLANEGPRGFYKGTLTPL----IGVGACVSLQFG-VNEAMKRFFHHRNADMSSTLS 119

Query: 216 ISVSFVGGYMAGILCAIVSHPADVMVSKINNE--RKVNESMNVALKRIYSRIGFVGLWNG 273
           +   +  G   GI+ + ++ P + +  ++  +     N      L+ I        L  G
Sbjct: 120 LPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRG 179

Query: 274 LPVRILMIGTLTSFQWLIYDSFKA 297
           L   IL  G      +L+Y++  A
Sbjct: 180 LTPTILREGHGCGTYFLVYEALIA 203

 Score = 31.2 bits (69), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 4/69 (5%)

Query: 34  VTPLDLIKCRLQVD----PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKY 89
           V PLD+IK  +Q D    P    S +S    +    G+G  F G G T +  +      +
Sbjct: 237 VYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATF 296

Query: 90  GGYELFKRL 98
             +EL  RL
Sbjct: 297 ATFELAMRL 305

>Kwal_47.18216
          Length = 333

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 59/305 (19%), Positives = 113/305 (37%), Gaps = 61/305 (20%)

Query: 36  PLDLIKCRLQVDPTLYRS--NTSGII----QILKKEGLGKLFTGVGATCIGYSLQGAGKY 89
           PLD IK R+Q+            G I     I  +EG   L+ G+GA  IG   + A ++
Sbjct: 30  PLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLALYKGLGAVVIGIIPKMAIRF 89

Query: 90  GGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQT---- 145
             YE F+      L+ D  T      + ++         A +++ P E +K++ Q     
Sbjct: 90  TSYEFFR-----TLLADRQTGVVSTGNTFVAGVGAGITEAVMVVNPMEVVKIRLQAQHVR 144

Query: 146 -----------------------------TMPPWCNNVIEGWKKMYAKEGLNGFYKGITP 176
                                           P   N I+    +  +EG    Y+G++ 
Sbjct: 145 YVPLKAQLAGSVTSSSATFSSATTATENVAATPKYRNAIQAAYVIVKEEGPRALYRGVSL 204

Query: 177 LWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQI---SVSFVGGYMAGILCAIV 233
              RQ       FT        +Y+ L ++  E      +     S + G ++G L    
Sbjct: 205 TAARQATNQGANFT--------VYSTLKSRLQEYHQTDMLPSWETSLI-GLISGALGPFS 255

Query: 234 SHPADVMVSKINNERKVNE----SMNVALKR-IYSRIGFVGLWNGLPVRILMIGTLTSFQ 288
           + P D + +++  ++  ++    S  +A+ R +    GF  L+ G+  R++ +    +  
Sbjct: 256 NAPLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMRVAPGQAVT 315

Query: 289 WLIYD 293
           + +Y+
Sbjct: 316 FTVYE 320

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 60/152 (39%), Gaps = 15/152 (9%)

Query: 51  YRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATA 110
           YR+       I+K+EG   L+ GV  T    +      +  Y   K     +   D   +
Sbjct: 179 YRNAIQAAYVIVKEEGPRALYRGVSLTAARQATNQGANFTVYSTLKSRLQEYHQTDMLPS 238

Query: 111 YKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYA------- 163
           ++  TS+  L S     F++    P + IK + Q       ++   GW ++ A       
Sbjct: 239 WE--TSLIGLISGALGPFSN---APLDTIKTRLQKDKSTSKDS---GWSRILAIGRQLIR 290

Query: 164 KEGLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
           +EG    YKGITP   R  P     FT +E I
Sbjct: 291 EEGFRALYKGITPRVMRVAPGQAVTFTVYELI 322

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 54/131 (41%), Gaps = 13/131 (9%)

Query: 116 SIYLLSSATAEFFADIMLCPFEAIKVKQQ-----TTMPPWCNNVIEGWKKMYAKEGLNGF 170
           +I L++  TA  F  +   P + IKV+ Q               I   + +  +EG    
Sbjct: 11  AINLVAGGTAGLFEALCCHPLDTIKVRMQIYSRAREQGQRARGFIGTARDISTQEGFLAL 70

Query: 171 YKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILC 230
           YKG+  +    IP    +FTS+E     +  R        + +     +FV G  AGI  
Sbjct: 71  YKGLGAVVIGIIPKMAIRFTSYEFFRTLLADR-------QTGVVSTGNTFVAGVGAGITE 123

Query: 231 AI-VSHPADVM 240
           A+ V +P +V+
Sbjct: 124 AVMVVNPMEVV 134

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 26  ACGPTHSSVTPLDLIKCRLQVDPTLYR-SNTSGII----QILKKEGLGKLFTGVGATCIG 80
           A GP  ++  PLD IK RLQ D +  + S  S I+    Q++++EG   L+ G+    + 
Sbjct: 250 ALGPFSNA--PLDTIKTRLQKDKSTSKDSGWSRILAIGRQLIREEGFRALYKGITPRVMR 307

Query: 81  YSLQGAGKYGGYELFKR 97
            +   A  +  YEL ++
Sbjct: 308 VAPGQAVTFTVYELIRK 324

>YOR100C (CRC1) [4905] chr15 complement(513295..514278)
           Mitochondrial carnitine carrier, member of the
           mitochondrial carrier family (MCF) of membrane
           transporters [984 bp, 327 aa]
          Length = 327

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 123/294 (41%), Gaps = 36/294 (12%)

Query: 1   MSKTKSPIE----LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQ---VDPTLYRS 53
           ++K++ PI+        + + A  +GG+ A    H    P DLIK R Q    + T++  
Sbjct: 20  LTKSRPPIKSNPVRENIKSFVAGGVGGVCAVFTGH----PFDLIKVRCQNGQANSTVHA- 74

Query: 54  NTSGIIQILKKEGLGKLFT--------GVGATCIGYSLQGAGKYGGYELFKRLYSTHLVK 105
             + II+  K +  G LFT        GV    +G +   A  + GY++ K+L + +  +
Sbjct: 75  -ITNIIKEAKTQVKGTLFTNSVKGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTFNNKQ 133

Query: 106 DEATAYKYRTSIYLLSSATAEFFADI----MLCPFEAIKVKQQTTMPPWCNNVIEGWKKM 161
             +        + +   A A F + I    +  P E +KV  QT+      + I+  K +
Sbjct: 134 GGSN------ELTMGQMAAAGFISAIPTTLVTAPTERVKVVLQTSSK---GSFIQAAKTI 184

Query: 162 YAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFV 221
             + G+   +KG      R  P +   F S+E     + +R P + +       I    +
Sbjct: 185 VKEGGIASLFKGSLATLARDGPGSALYFASYEISKNYLNSRQPRQDAGKDEPVNILNVCL 244

Query: 222 GGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIY-SRIGFVGLWNGL 274
            G +AG+   +   P D + +K+       ++M  A K IY  R G  G + GL
Sbjct: 245 AGGIAGMSMWLAVFPIDTIKTKLQ-ASSTRQNMLSATKEIYLQRGGIKGFFPGL 297

>Sklu_2433.8 YFR045W, Contig c2433 11995-13257 reverse complement
          Length = 420

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 13/127 (10%)

Query: 159 KKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISV 218
           K++Y   GL GF +G  P   RQ+  +  +FT++  + + I    P  +           
Sbjct: 275 KEIYLTRGLRGFVQGTAPTIFRQMGNSAVRFTTYTSLKQLISPNKPLNE---------YY 325

Query: 219 SFVGGYMAGILCAIVSHPADVMVSKINNE---RKVNESMNVALKRIYSRIGFVGLWNGLP 275
           +FV G+++      V+ P DV+ +++ ++        S+N A  RI+   G    W G  
Sbjct: 326 AFVLGFISSCAVVAVTQPIDVIKTRMQSKYAWANYKNSLNCAY-RIFVEEGIPKFWKGWA 384

Query: 276 VRILMIG 282
            R++ +G
Sbjct: 385 PRLMKVG 391

>CAGL0K07436g complement(734496..735419) highly similar to sp|Q04013
           Saccharomyces cerevisiae YMR241w, hypothetical start
          Length = 307

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 59/124 (47%), Gaps = 4/124 (3%)

Query: 158 WKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK---KSEMSALQ 214
           +K +Y KEG+ G  KG+  +  RQ+     +F    R+VE    +L  K     +++AL+
Sbjct: 152 FKSIYKKEGIRGINKGVNAVAIRQMTNWGSRF-GLSRLVEDGIRKLTGKTGKDDKLTALE 210

Query: 215 QISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
           +I  S +GG ++     I     ++   K +  R  N ++    K IY   G  GL+ G+
Sbjct: 211 KIMASAIGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGV 270

Query: 275 PVRI 278
             R+
Sbjct: 271 TPRV 274

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 76/179 (42%), Gaps = 26/179 (14%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRS-NTSGII---------QILKKE 65
           + A  +GGI   G T + +T +    C   V+ T  ++ N  G+I          I KKE
Sbjct: 102 FGAGIMGGITG-GVTQAYLT-MGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKE 159

Query: 66  GLGKLFTGVGATCIGYSLQGAGKYGGYEL----FKRLYSTHLVKDEATAYKYRTSIYLLS 121
           G+  +  GV A  I        ++G   L     ++L       D+ TA +      +++
Sbjct: 160 GIRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALE-----KIMA 214

Query: 122 SATAEFFADIMLCPFEAIKVKQQTTM--PPWCNNVIEG--WKKMYAKEGLNGFYKGITP 176
           SA     +     P E I+V+ Q+    P    N+  G  +K +Y   GL G Y+G+TP
Sbjct: 215 SAIGGGLS-AWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTP 272

>AER419W [2919] [Homologous to ScYNL083W - SH]
           complement(1442595..1444076) [1482 bp, 493 aa]
          Length = 493

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 59/274 (21%), Positives = 105/274 (38%), Gaps = 14/274 (5%)

Query: 35  TPLDLIKCRLQVDPTLYRSN-TSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           TP  L+    + DP   RS        + ++ GL   + G G   I    + A K+G +E
Sbjct: 216 TPEQLLHHNPRADPAKIRSPLVKAATSLYRQGGLRAFYLGNGLNVIKVFPESAMKFGSFE 275

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ-TTMPPWCN 152
           L KR+ +  L     T    R S Y ++       A   + P + +K + Q   +   C 
Sbjct: 276 LAKRVLAG-LEGCGETGELSRLSTY-VAGGLGGIMAQFSVYPIDTLKFRIQCAPLDTRCR 333

Query: 153 N---VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKK-- 207
               +I+  K MY + GL  FY+G+        PY      +F  +      R       
Sbjct: 334 GLPLLIKTAKDMYREGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGI 393

Query: 208 SEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN-----ESMNVALKRIY 262
           SE   +    V    G  +G + A V +P +++ +++  +         +      ++  
Sbjct: 394 SENEVVMSNLVVLPMGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTV 453

Query: 263 SRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296
            R G  GL+ GL   +  +    +  +L Y++ K
Sbjct: 454 QREGLPGLYKGLVPTLAKVCPAVAISYLCYENLK 487

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 78/203 (38%), Gaps = 16/203 (7%)

Query: 9   ELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII-----QILK 63
           EL     Y A  LGGI+A      SV P+D +K R+Q  P   R     ++      + +
Sbjct: 292 ELSRLSTYVAGGLGGIMA----QFSVYPIDTLKFRIQCAPLDTRCRGLPLLIKTAKDMYR 347

Query: 64  KEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSA 123
           + GL   + G+G   +G     A   G +   KR Y T        +        L+   
Sbjct: 348 EGGLRLFYRGLGVGILGVFPYAALDLGTFSALKRWYITRRANALGISENEVVMSNLVVLP 407

Query: 124 TAEFFADI---MLCPFEAIKVKQQT----TMPPWCNNVIEGWKKMYAKEGLNGFYKGITP 176
              F   +   ++ P   ++ + Q       P   +   + ++K   +EGL G YKG+ P
Sbjct: 408 MGAFSGTVGATVVYPINLLRTRLQAQGTYAHPHRYDGFQDVFRKTVQREGLPGLYKGLVP 467

Query: 177 LWCRQIPYTMCKFTSFERIVEAI 199
              +  P     +  +E +  A+
Sbjct: 468 TLAKVCPAVAISYLCYENLKRAM 490

>KLLA0D14036g complement(1203522..1204817) some similarities with
           sp|P40556 Saccharomyces cerevisiae YIL006w, hypothetical
           start
          Length = 431

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 86/207 (41%), Gaps = 28/207 (13%)

Query: 11  YTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDP-------TLYRSNTSGIIQILK 63
           +    + + ++  + A   + +   P+ ++K RL +         T Y++     I+I K
Sbjct: 210 FNNSEFLSHSMSALTAGAISTTLTNPIWVVKTRLMLQSGKNIKGMTHYKNTLDAFIKIYK 269

Query: 64  KEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRL---YSTHLVKDEAT----------- 109
            EG+   ++G+  +  G  L  A  +  YE  K++   Y +     E             
Sbjct: 270 VEGIKSFYSGLIPSLFGL-LHVAIHFPVYEKLKKVLHCYPSGRPNQETMNVNGNSNPQTT 328

Query: 110 -AYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQ--TTMPPWCNNVIEGWKKMYAKEG 166
            +  ++    +++S  ++  A  +  P E ++ + Q  + M P   ++I   +  YAKEG
Sbjct: 329 GSTNFQLGRLIVASCGSKMIASTLTYPHEILRTRLQLKSDMKPSIKSII---RTTYAKEG 385

Query: 167 LNGFYKGITPLWCRQIPYTMCKFTSFE 193
           + GFY G      R +P +     SFE
Sbjct: 386 IRGFYSGFLTNMFRTVPASAITLVSFE 412

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 38/99 (38%), Gaps = 19/99 (19%)

Query: 115 TSIYLLSSATAEFFADIMLCPFEAIKVKQQT---------TMPPWCNNVIEGWK------ 159
           T I  LS A A F A +++CP +  K + Q          T P        G K      
Sbjct: 103 TEITALSGALAGFLAGVIVCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIW 162

Query: 160 ----KMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194
                +   E + G YKGI P+     P  M  F+ +ER
Sbjct: 163 GTLTTIVRDESIRGLYKGIVPIVLGYFPTWMIYFSVYER 201

>Scas_714.18
          Length = 305

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 81/188 (43%), Gaps = 36/188 (19%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSG--------------------------IIQILKKEGL 67
           +TP++LIKC+LQ+    Y  + +                           I  I+K++GL
Sbjct: 124 LTPVELIKCKLQISNLHYSLHDNDGEQQDEEDEDQGMVIGEGRHTRIIPTIKSIIKEKGL 183

Query: 68  GKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEF 127
             L+ G  +T I  S+     +  YEL K+      ++D  +     T   L+S ATA  
Sbjct: 184 FGLWQGQSSTFIRESIGSVVWFATYELMKQ-----TLRDPKSEVN-TTWQLLISGATAGL 237

Query: 128 FADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187
             +  + P + +K   QT        ++E  + +  ++G+ GFY+G+     R +P    
Sbjct: 238 AFNGSVFPADTVKSIMQTEHLA----LMETVRSILERDGVAGFYRGLGITLLRAVPSNAA 293

Query: 188 KFTSFERI 195
            F ++E++
Sbjct: 294 VFYTYEKL 301

>CAGL0F07711g complement(751794..752900) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, hypothetical start
          Length = 368

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 110/280 (39%), Gaps = 46/280 (16%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLGK-LFT 72
           + A  +GGI+     HS    LD +K R Q  P +  Y+        +  +EG  + L+ 
Sbjct: 57  FLAGGVGGIIGDSAMHS----LDTVKTRQQGAPNVHKYKHMLQAYRTMFIEEGFRRGLYG 112

Query: 73  GVGATCIGYSLQGAGKYGGYELFKR-LYSTHLVKDEATAYKYRTSIYLLSSATAEFFADI 131
           G  A  +G     A  +  YE  KR + + + + D        T  +L +    +FF+  
Sbjct: 113 GYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLND--------TFSHLTAGFLGDFFSSF 164

Query: 132 MLCPFEAIKVKQQTT---MPPWCNN------VIEGWKKMYAKEGLNGFYKGITPLWCRQI 182
           +  P E +K + Q       P  N+      +      +Y  EG+   + G      R +
Sbjct: 165 VYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDL 224

Query: 183 PYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVM-- 240
           P++  +F  +E+  +  +A L   K        IS   V G  AG L  I++ P DV+  
Sbjct: 225 PFSALQFAFYEKFRQ--WAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKT 282

Query: 241 --------------VSKINNERK---VNESMNVALKRIYS 263
                          +KI N  K   +  S+  +L+ +Y+
Sbjct: 283 RVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYT 322

>CAGL0B04543g 441599..442552 highly similar to tr|Q12289
           Saccharomyces cerevisiae YOR100c CRC1, start by
           similarity
          Length = 317

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 68/178 (38%), Gaps = 5/178 (2%)

Query: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGA 76
           A     G ++  PT     P + IK  LQ +     S       I+   G+  LF G  A
Sbjct: 133 AQMATAGFISAIPTTLVTAPTERIKVVLQTNSEFKGSFIKAAKHIVSTGGVKSLFNGSLA 192

Query: 77  TCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPF 136
           T        A  +  YEL K   +  + K +    +   +   L+   A     +++ P 
Sbjct: 193 TLARDGPGSALYFASYELSKAFLNKSVAKKDKD--EVNLANVCLAGGIAGMSMWLVVFPI 250

Query: 137 EAIKVKQQTTMPPWCNNVIEGWKKMYAKE-GLNGFYKGITPLWCRQIPYTMCKFTSFE 193
           + IK + Q    P   ++++  K +Y +  G+ GF+ G+ P   R  P     F   E
Sbjct: 251 DTIKTRLQVATTPI--SMVQATKDIYIQRGGIKGFFPGLGPALLRSFPANAATFLGVE 306

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 105/278 (37%), Gaps = 38/278 (13%)

Query: 18  ACTLGGIVACGPTHSSVTPLDLIKCRLQVDP----------------TLYRSNTSGIIQI 61
           A  +GG+ A    H    P DLIK R Q +                 +L   N S    +
Sbjct: 27  AGGVGGVCAVLTGH----PFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSL 82

Query: 62  LKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLS 121
             K  +   + GV    IG +   A  + GY++ KRL +     D          +    
Sbjct: 83  FFKNSVKGFYKGVIPPLIGVTPIFAVSFWGYDIGKRLVTWKQASD--------APLTTAQ 134

Query: 122 SATAEFFADI----MLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPL 177
            ATA F + I    +  P E IKV  QT    +  + I+  K + +  G+   + G    
Sbjct: 135 MATAGFISAIPTTLVTAPTERIKVVLQTN-SEFKGSFIKAAKHIVSTGGVKSLFNGSLAT 193

Query: 178 WCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPA 237
             R  P +   F S+E  +   +      K +   +   +V   GG +AG+   +V  P 
Sbjct: 194 LARDGPGSALYFASYE--LSKAFLNKSVAKKDKDEVNLANVCLAGG-IAGMSMWLVVFPI 250

Query: 238 DVMVSKINNERKVNESMNVALKRIY-SRIGFVGLWNGL 274
           D + +++        SM  A K IY  R G  G + GL
Sbjct: 251 DTIKTRL-QVATTPISMVQATKDIYIQRGGIKGFFPGL 287

 Score = 35.4 bits (80), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 68/180 (37%), Gaps = 20/180 (11%)

Query: 135 PFEAIKVKQQTTMPPWCNNVIEGWKK---------------MYAKEGLNGFYKGITPLWC 179
           PF+ IKV+ Q+       + +    K               ++ K  + GFYKG+ P   
Sbjct: 41  PFDLIKVRCQSNQAKSTMDAVSIILKEARSLSTVNGSLTTSLFFKNSVKGFYKGVIPPLI 100

Query: 180 RQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADV 239
              P     F  ++     I  RL T K    A    +     G+++ I   +V+ P + 
Sbjct: 101 GVTPIFAVSFWGYD-----IGKRLVTWKQASDAPLTTAQMATAGFISAIPTTLVTAPTER 155

Query: 240 MVSKINNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           +   +    +   S   A K I S  G   L+NG    +   G  ++  +  Y+  KA++
Sbjct: 156 IKVVLQTNSEFKGSFIKAAKHIVSTGGVKSLFNGSLATLARDGPGSALYFASYELSKAFL 215

>Kwal_34.15907
          Length = 312

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 158 WKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK---KSEMSALQ 214
           +K++Y+KEG+ G  KG+  +  RQ+     +F    R+VE        K     +++AL+
Sbjct: 157 FKEIYSKEGIKGINKGVNAVAIRQMTNWGSRF-GLSRLVEQGIRDFTGKTNPDDKLTALE 215

Query: 215 QISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
           +I  S +GG ++     I     ++   K +  R    ++  A K IY   G  GL+ G+
Sbjct: 216 KIFASALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKKLTVGSAFKYIYQSSGIKGLYRGV 275

Query: 275 PVRILMIGTLTSFQWLIYDSFKAYVG 300
             RI +    T F     D  K +VG
Sbjct: 276 APRIGLGVWQTVFMVGFGDIAKEFVG 301

 Score = 30.8 bits (68), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 61/151 (40%), Gaps = 20/151 (13%)

Query: 37  LDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFK 96
           +++ K +  V   + +S+ S   +I  KEG+  +  GV A  I        ++G      
Sbjct: 136 VEITKAKSAVAGAIPQSSWSAFKEIYSKEGIKGINKGVNAVAIRQMTNWGSRFG------ 189

Query: 97  RLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLC-------PFEAIKVKQQTTMP- 148
               + LV+     +  +T+     +A  + FA  +         P E I+V+ Q+    
Sbjct: 190 ---LSRLVEQGIRDFTGKTNPDDKLTALEKIFASALGGGLSAWNQPIEVIRVEMQSKKED 246

Query: 149 ---PWCNNVIEGWKKMYAKEGLNGFYKGITP 176
              P    V   +K +Y   G+ G Y+G+ P
Sbjct: 247 PNRPKKLTVGSAFKYIYQSSGIKGLYRGVAP 277

>KLLA0D04290g 366536..367102 similar to sgd|S0006215 Saccharomyces
           cerevisiae YPR011c, hypothetical start
          Length = 188

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 69/137 (50%), Gaps = 7/137 (5%)

Query: 112 KYRTSIYLLSSATAEFFADIMLCPFEAIKV--KQQTTMPPWCNNVIEGWKKMYAKEGLNG 169
           K  +SI  ++   A   +  ++ PFE +K+  + Q++   + + +I    ++Y +EG+ G
Sbjct: 8   KQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVAG 67

Query: 170 FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPT-KKSEMSALQQISVSFVGGYMAGI 228
            ++G      R  PY+  +F  +E   + I+    T  K ++   Q++S     G + G 
Sbjct: 68  LFRGNGLNCVRIFPYSAVQFVVYEWCKKHIFHVDGTVGKEQLLNWQRLS----AGALCGG 123

Query: 229 LCAIVSHPADVMVSKIN 245
           +  + ++P D++ ++++
Sbjct: 124 MSVLATYPLDLVRTRLS 140

 Score = 35.4 bits (80), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 9  ELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII----QILKK 64
          +L  +E   A   GG VA   + + V+P + +K  LQV  +    N  GII    Q+ K+
Sbjct: 5  QLAKQESSIAFIAGG-VAGAVSRTVVSPFERVKILLQVQSSTSAYN-HGIINAVGQVYKE 62

Query: 65 EGLGKLFTGVGATCI 79
          EG+  LF G G  C+
Sbjct: 63 EGVAGLFRGNGLNCV 77

 Score = 32.0 bits (71), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 47/91 (51%), Gaps = 3/91 (3%)

Query: 212 ALQQISVSFVGGYMAGILCAIVSHPAD---VMVSKINNERKVNESMNVALKRIYSRIGFV 268
           A Q+ S++F+ G +AG +   V  P +   +++   ++    N  +  A+ ++Y   G  
Sbjct: 7   AKQESSIAFIAGGVAGAVSRTVVSPFERVKILLQVQSSTSAYNHGIINAVGQVYKEEGVA 66

Query: 269 GLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           GL+ G  +  + I   ++ Q+++Y+  K ++
Sbjct: 67  GLFRGNGLNCVRIFPYSAVQFVVYEWCKKHI 97

>KLLA0B08503g complement(753498..754409) similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 mitochondrial
           carrier protein (MCF), start by similarity
          Length = 303

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 101/250 (40%), Gaps = 16/250 (6%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQ-ILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYEL 94
           P D  K RLQ   T   +N   +I+ ++K EG    + G     +G     + ++G  E 
Sbjct: 43  PFDTTKVRLQTSET--STNAVKVIKDLIKNEGPMGFYKGTLTPLVGVGACVSLQFGVNEA 100

Query: 95  FKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNV 154
            KR + T    DEA +       Y +      F    +  P E I+++ QT         
Sbjct: 101 MKRFFHTF---DEAASQHLSLLQYYICGVAGGFTNSFLASPIEHIRIRLQTQTGSGATAE 157

Query: 155 IEGWKKMYAKEGLNG-FYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSAL 213
            +G      K  +NG   +G+TP   R+       F ++E ++     +   ++ ++ A 
Sbjct: 158 FKGPIDCIKKLRVNGQLMRGLTPTMLRESHGCGVYFLTYEALI-GHQVKSGIQRKDIPAW 216

Query: 214 QQISVSFVGGYMAGILCAIVSHPADVM--VSKINNERKVNESMNVAL--KRIYSRIGFVG 269
           +      + G  +G L   + +P DV+  V + +N +      N+    + I +R G  G
Sbjct: 217 KLC----LFGAASGTLLWTMVYPLDVIKSVMQTDNLKTPKNGNNILTVGRTIIARQGVSG 272

Query: 270 LWNGLPVRIL 279
           L+ G    +L
Sbjct: 273 LFKGFAPTML 282

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 57/139 (41%), Gaps = 11/139 (7%)

Query: 102 HLVKDEATAYKYRTSIYLLSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIEGWKK 160
            L+ D  + +     I  L + TA   A +++  PF+  KV+ QT+      N ++  K 
Sbjct: 9   QLIDDLESPHDNTRVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTS--ETSTNAVKVIKD 66

Query: 161 MYAKEGLNGFYKG-ITPLWCRQIPYTMC---KFTSFERIVEAIYARLPTKKSEMSALQQI 216
           +   EG  GFYKG +TPL    +    C   +F   E +    +         +S LQ  
Sbjct: 67  LIKNEGPMGFYKGTLTPL----VGVGACVSLQFGVNEAMKRFFHTFDEAASQHLSLLQYY 122

Query: 217 SVSFVGGYMAGILCAIVSH 235
                GG+    L + + H
Sbjct: 123 ICGVAGGFTNSFLASPIEH 141

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 82/177 (46%), Gaps = 14/177 (7%)

Query: 25  VACGPTHSSV-TPLDLIKCRLQVDP-TLYRSNTSGIIQILKKEGL-GKLFTGVGATCIGY 81
           VA G T+S + +P++ I+ RLQ    +   +   G I  +KK  + G+L  G+  T +  
Sbjct: 126 VAGGFTNSFLASPIEHIRIRLQTQTGSGATAEFKGPIDCIKKLRVNGQLMRGLTPTMLRE 185

Query: 82  SLQGAGKYG-GYE-LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAI 139
           S  G G Y   YE L      + + + +  A+K    + L  +A+       M+ P + I
Sbjct: 186 S-HGCGVYFLTYEALIGHQVKSGIQRKDIPAWK----LCLFGAASGTLLW-TMVYPLDVI 239

Query: 140 KVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE 193
           K   QT     P   NN++   + + A++G++G +KG  P   R  P     F +FE
Sbjct: 240 KSVMQTDNLKTPKNGNNILTVGRTIIARQGVSGLFKGFAPTMLRAAPANAATFATFE 296

>ABL023W [569] [Homologous to ScYKL120W (OAC1) - SH]
           complement(355977..356906) [930 bp, 309 aa]
          Length = 309

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 69/178 (38%), Gaps = 16/178 (8%)

Query: 35  TPLDLIKCRLQV-----DPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKY 89
           +PL L+K R+Q       P L       ++ + K  G+  L+ GV A  +   +  A + 
Sbjct: 136 SPLQLVKTRMQALAPRRVPPLPGRMGRRLVALFKDRGVRGLYQGVDAALLRTGVGSAVQL 195

Query: 90  GGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPP 149
             Y   K   S H+    A        +Y L+SA +     I + PF+    +       
Sbjct: 196 AVYSHAKEALSRHVPDGMA--------LYTLASALSSVAVCIAMNPFDVAMTRMYHHRGG 247

Query: 150 WCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFE---RIVEAIYARLP 204
                ++   K   +EG +  YKG      R  P+T+   T  E   R+V  +  RLP
Sbjct: 248 LYRGPLDCLCKTVRQEGFSALYKGHLAQLLRIAPHTILCLTLMEQALRVVRLVENRLP 305

>KLLA0C11363g complement(975442..976995) similar to sp|P48233
           Saccharomyces cerevisiae YNL083w singleton, start by
           similarity
          Length = 517

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 111/257 (43%), Gaps = 27/257 (10%)

Query: 63  KKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYST-HLVKDEATAYKYRTSIYL-- 119
           ++ GL   + G G   +    + A K+G +E+ KR+ +    VKD  T+   R S Y+  
Sbjct: 269 RQGGLRAFYVGNGLNVVKVFPESAIKFGSFEMAKRIMARLENVKD--TSELSRLSTYIAG 326

Query: 120 -LSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNV------IEGWKKMYAKEGLNGFYK 172
            L    A+F     + P + +K + Q    P   N+      ++  K+MY + G+  FY+
Sbjct: 327 GLGGVAAQF----SVYPIDTLKYRIQCA--PLNTNLKKSSILLQTAKEMYQQGGIRLFYR 380

Query: 173 GITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFV---GGYMAGIL 229
           G+        PY      +F  + +  Y +   KK+ +   + I  + +    G  +G +
Sbjct: 381 GVHIGVMGIFPYAALDLGTFSAL-KKWYIKKEAKKTGLPEDEVIISNLIVLPMGAFSGTV 439

Query: 230 CAIVSHPADVMVSKINNE-----RKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTL 284
            A + +P +++ +++  +            +  LK+   R G+ GL+ GL   +  +   
Sbjct: 440 GATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQREGYQGLFKGLVPNLAKVCPA 499

Query: 285 TSFQWLIYDSFKAYVGL 301
            S  +L Y++ K  + L
Sbjct: 500 VSISYLCYENLKRLMKL 516

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 73/163 (44%), Gaps = 18/163 (11%)

Query: 154 VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSAL 213
           +I+    +Y + GL  FY G      +  P +  KF SFE + + I ARL   K + S L
Sbjct: 260 LIKAATTLYRQGGLRAFYVGNGLNVVKVFPESAIKFGSFE-MAKRIMARLENVK-DTSEL 317

Query: 214 QQISVSFVGGYMAGILCAIVSHPADVMVSKIN------NERKVNESMNVALK-------R 260
            ++S +++ G + G+      +P D +  +I       N +K +  +  A +       R
Sbjct: 318 SRLS-TYIAGGLGGVAAQFSVYPIDTLKYRIQCAPLNTNLKKSSILLQTAKEMYQQGGIR 376

Query: 261 IYSRIGFVGLWNGLPVRILMIGTLTSF-QWLIYDSFKAYVGLP 302
           ++ R   +G+    P   L +GT ++  +W I    K   GLP
Sbjct: 377 LFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKK-TGLP 418

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/210 (23%), Positives = 76/210 (36%), Gaps = 22/210 (10%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ 60
           +   K   EL     Y A  LGG+ A      SV P+D +K R+Q  P       S I+ 
Sbjct: 308 LENVKDTSELSRLSTYIAGGLGGVAA----QFSVYPIDTLKYRIQCAPLNTNLKKSSILL 363

Query: 61  ILKKE-----GLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLY------STHLVKDEAT 109
              KE     G+   + GV    +G     A   G +   K+ Y       T L +DE  
Sbjct: 364 QTAKEMYQQGGIRLFYRGVHIGVMGIFPYAALDLGTFSALKKWYIKKEAKKTGLPEDEVI 423

Query: 110 AYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQT----TMPPWCNNVIEGWKKMYAKE 165
                  I L   A +      ++ P   ++ + Q       P   N   +  KK   +E
Sbjct: 424 ISNL---IVLPMGAFSGTVGATLVYPINLLRTRLQAQGTYAHPHTYNGFSDVLKKTIQRE 480

Query: 166 GLNGFYKGITPLWCRQIPYTMCKFTSFERI 195
           G  G +KG+ P   +  P     +  +E +
Sbjct: 481 GYQGLFKGLVPNLAKVCPAVSISYLCYENL 510

>KLLA0E18810g 1663220..1664353 some similarities with sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), hypothetical start
          Length = 377

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 78/177 (44%), Gaps = 14/177 (7%)

Query: 33  SVTPLDLIKCRLQVDPTL----YRSNTSGII----QILKKEGLGKLFTGVGATCIGYSLQ 84
           +VTP + IK  L  D       Y++N  G++    ++L  +G   L+ GV    +  +  
Sbjct: 204 AVTPFEAIKTALIDDKQAAVPKYQNNGKGMVSNYAKLLSDQGFSGLYRGVLPVSMRQAAN 263

Query: 85  GAGKYGGYELFKRLYS--THLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVK 142
            A + G Y   K L    T++ KD+  +    + +  +  A +         P + +K +
Sbjct: 264 QAVRLGCYNKIKTLVQDYTNVPKDKPLS----SGLTFIVGAFSGIVTVYTTMPIDTVKTR 319

Query: 143 QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
            Q+      ++ I  +  ++ +EGL  F+KG TP   R I      FT +E+++  +
Sbjct: 320 MQSLNAGQYSSTINCFATIFKEEGLKTFWKGATPRLGRLILSGGIVFTIYEKVLTVL 376

>YFR045W (YFR045W) [1727] chr6 (242129..242986) Member of the
           mitochondrial carrier family (MCF) family of membrane
           transporters [858 bp, 285 aa]
          Length = 285

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/166 (20%), Positives = 67/166 (40%), Gaps = 13/166 (7%)

Query: 140 KVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
           KV  ++T       ++   K MY   G   F +G T    RQI  T  +FT++       
Sbjct: 129 KVATKSTPVARIEKLLPAVKHMYQTRGPAAFVQGTTATIFRQIANTSIQFTAY-----TA 183

Query: 200 YARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNV--A 257
           + RL   +++ ++      S + G         ++ P DV+ +++ ++    E  N    
Sbjct: 184 FKRLLQARNDKAS------SVITGLATSFTLVAMTQPIDVVKTRMMSQNAKTEYKNTLNC 237

Query: 258 LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGLPT 303
           + RI+ + G    W G   R + +G      + +Y+     +G  +
Sbjct: 238 MYRIFVQEGMATFWKGSIFRFMKVGISGGLTFTVYEQVSLLLGFSS 283

>CAGL0D04774g complement(467712..468680) similar to tr|Q06497
           Saccharomyces cerevisiae YPR128c, start by similarity
          Length = 322

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 61/274 (22%), Positives = 112/274 (40%), Gaps = 26/274 (9%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQV-----------DPTLYRSNTSGIIQILKKEGLGKLF 71
           G VA     ++V PLDL K  +Q            +   Y++    II+I KK G   L+
Sbjct: 10  GAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSKEEEKYKNVIDCIIKIFKKRGFLGLY 69

Query: 72  TGVGATCIGYSLQGAGKYGGYELFKRLYSTH-----LVKDEATAYKYRTSIYLLSSATAE 126
            G+        +Q    +  Y L +  Y         +KD++   +  T   L    +A 
Sbjct: 70  QGLATNVAANFVQNFIYFFWYSLIRSNYFVFKAGRLQLKDDSKFIELSTIEELALGMSAG 129

Query: 127 FFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEG--LNGFYKGI-TPLWCRQIP 183
               ++  P   I  +QQ T      ++    K++Y +    L  F+KG    L     P
Sbjct: 130 AMTQVVTNPISVISTRQQLTKDGEDASLKAVIKQIYEESNGDLTAFWKGFKVALVLSTNP 189

Query: 184 YTMCKFTSFERIVEAIY-ARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242
                + S++++   I  A+  +   ++S       +F+ G  + ++   V+ P  ++V+
Sbjct: 190 --AITYGSYQKLKSMILTAKGLSGSQKISTQLSAGENFLLGMFSKMISTFVTQP--LIVA 245

Query: 243 KINNERKVNE--SMNVALKRIYSRIGFVGLWNGL 274
           KI  + K ++  +    L+ IY   GF+ LW G+
Sbjct: 246 KITLQGKGSKFKTFQEVLQHIYQNEGFLSLWKGV 279

>Kwal_0.232
          Length = 274

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 55/268 (20%), Positives = 115/268 (42%), Gaps = 30/268 (11%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIG 80
           L G  A   T     P+D +K RLQ     + +   G + + +  G   + +   A+   
Sbjct: 11  LAGAAAGTSTDLFFFPIDTLKTRLQAAGGFFANG--GYLGVYRGLGSAVVASAPSASLFF 68

Query: 81  YSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIK 140
            +  G   Y      + +++  +   +  A    T+ ++ SS+  E  A ++  P E IK
Sbjct: 69  VTYDGMKSYS-----RPIFNNLITSSDQVA---ETATHMFSSSAGEIAACMVRVPAEVIK 120

Query: 141 VKQQTTMPPWCNNVIEGWKKMYAKEGLNG----FYKGITPLWCRQIPYTMCKFTSFERIV 196
            + QT      ++ ++  KK+   E   G     Y+G +    R+IP+T  +F  +E + 
Sbjct: 121 QRTQTHK---SDSSLQTLKKLLQNENGEGIRRNLYRGWSTTVMREIPFTCIQFPLYEFL- 176

Query: 197 EAIYARLPTKKSEMSALQQISVSFVGGY---MAGILCAIVSHPADVMVSKINNERKVNES 253
                    K+  +S  ++    + G +   +AG + A  + P DV+ +++         
Sbjct: 177 --------KKQWAISGGREQVAPWQGAFCGCVAGGIAAATTTPLDVLKTRLMLSHTSVPV 228

Query: 254 MNVALKRIYSRIGFVGLWNGLPVRILMI 281
           +++A ++IY+  G+   ++G+  R + I
Sbjct: 229 LHLA-RQIYATEGWKVFFSGVGPRTVWI 255

 Score = 37.7 bits (86), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 40/89 (44%), Gaps = 14/89 (15%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVD----PTLYRSNTSGIIQILKKEGLGKLF 71
           +  C  GGI A     ++ TPLD++K RL +     P L+ +      QI   EG    F
Sbjct: 196 FCGCVAGGIAA-----ATTTPLDVLKTRLMLSHTSVPVLHLAR-----QIYATEGWKVFF 245

Query: 72  TGVGATCIGYSLQGAGKYGGYELFKRLYS 100
           +GVG   +  S  GA   G YE    + S
Sbjct: 246 SGVGPRTVWISAGGAIFLGVYETVHSILS 274

>AFR131C [3323] [Homologous to ScYGR257C - SH] (672999..674033)
           [1035 bp, 344 aa]
          Length = 344

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 60/301 (19%), Positives = 112/301 (37%), Gaps = 38/301 (12%)

Query: 8   IELYTKEYYAACTLGGIVA--CGPTHSSVTPLDLIKCRLQVDPTLYRSNT-SGIIQILKK 64
           + L+ +E   +CT  G ++   G           + CR   +P      T  G+ +I + 
Sbjct: 37  VRLHQQEMLPSCTCTGQLSKPAGKVFWQDECFANVGCR---EPAARLQGTLEGLRKIAQL 93

Query: 65  EGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSAT 124
           EGL  L+ G+G T +         + GYE  +         +   A +   +  L+  A 
Sbjct: 94  EGLPTLWRGLGITLVMAVPANVVYFSGYEALR--------DNSPLASRLPVANPLVCGAF 145

Query: 125 AEFFADIMLCPFEAIKVKQQTTMPP--------WCNNVIEGWKKMYAKEGLNGFYKGITP 176
           A   A   + P E ++ + Q+               +++   +   +  G    +KG+  
Sbjct: 146 ARILAATTIAPLELLRTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEI 205

Query: 177 LWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHP 236
              R +P++   + ++E      +AR     +  S       SF  G M G + A+++HP
Sbjct: 206 TLWRDVPFSAIYWGTYEFCKTQFWARHAATHNA-SNWDHFIGSFACGSMGGAVAALLTHP 264

Query: 237 ADVMVSKIN-------------NERKVNES--MNVALKRIYSRIGFVGLWNGLPVRILMI 281
            DV  +++                 K ++S  M   L  I    G   L+ GL  R++ I
Sbjct: 265 FDVGKTRMQIAIASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMKI 324

Query: 282 G 282
            
Sbjct: 325 A 325

>AFR253W [3445] [Homologous to ScYFR045W - SH]
           complement(892939..892986,893047..894033) [1035 bp, 344
           aa]
          Length = 344

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 60/125 (48%), Gaps = 13/125 (10%)

Query: 160 KMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVS 219
           ++Y   G+ GF +G  P   RQ+  ++ +FT++  IV+++        S   AL +   +
Sbjct: 201 EIYRTRGVRGFLQGAMPTIFRQLGNSVVRFTTYAWIVQSL--------SPHKALDEYQ-A 251

Query: 220 FVGGYMAGILCAIVSHPADVMVSKINNERK---VNESMNVALKRIYSRIGFVGLWNGLPV 276
           F  G ++      ++ P DV+ +++ ++        S+N A  RI+   GF  +W G   
Sbjct: 252 FAAGALSSAAVVALTQPIDVIKTRMQSKTAWFTYKSSLNCAY-RIFVEEGFRYMWKGWVP 310

Query: 277 RILMI 281
           R+  +
Sbjct: 311 RLFKV 315

 Score = 28.5 bits (62), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 36  PLDLIKCRLQVDPT--LYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           P+D+IK R+Q       Y+S+ +   +I  +EG   ++ G        SL G   +G Y+
Sbjct: 268 PIDVIKTRMQSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQ 327

Query: 94  LFKRL 98
             + L
Sbjct: 328 YVENL 332

>ADL264C [1477] [Homologous to ScYOR100C (CRC1) - SH]
           (241532..242521) [990 bp, 329 aa]
          Length = 329

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 116/273 (42%), Gaps = 40/273 (14%)

Query: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK--------EGLG 68
           AA  +GG+ A    H    P DL+K R Q +        SG +  ++K         GL 
Sbjct: 52  AAGAVGGVCAVLTGH----PFDLLKVRCQSN------QASGTVDAVRKILVEARAQSGLS 101

Query: 69  KL------FTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSS 122
            +      + GV    +G +   A  + GY++ K+L + +    + T  +  T+ ++ + 
Sbjct: 102 AVNMMRGFYKGVIPPLLGVTPIFAVSFWGYDVGKKLVTWNDNSGKLTTAQLATAGFISAI 161

Query: 123 ATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQI 182
            T      +++ P E +KV  QT      +++    K + A  G+   ++G      R  
Sbjct: 162 PTT-----LVMAPTERVKVVLQTQS---NHSLGSAAKHILATGGVRSLFRGSLATLARDG 213

Query: 183 PYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVS 242
           P +   F S+E     + AR  T +     L   +V   GG MAG+   +   P D + +
Sbjct: 214 PGSALYFASYEATKAYLNARSGTNE-----LSIKNVCLAGG-MAGVSMWVGVFPIDTIKT 267

Query: 243 KINNERKVNESMNVALKRIY-SRIGFVGLWNGL 274
           ++ +     ++M  A ++IY +R G  G + G+
Sbjct: 268 ELQSS-NTRQTMMEATRKIYNTRGGIKGFFPGI 299

>YEL006W (YEL006W) [1417] chr5 (144326..145333) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1008 bp, 335 aa]
          Length = 335

 Score = 44.3 bits (103), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 86/201 (42%), Gaps = 15/201 (7%)

Query: 5   KSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVD------PTLYRSNTSGI 58
           K  ++++    + +     I A   +  +  P+ ++K RL +        T Y+      
Sbjct: 127 KYSVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKYSTHYKGTIDTF 186

Query: 59  IQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLY---STHLVKDEATAYKYRT 115
            +I+++EG   L+ G+    +G  L  A ++  YE  K  +    +  V  + T+  ++ 
Sbjct: 187 RKIIQQEGAKALYAGLVPALLGM-LNVAIQFPLYENLKIRFGYSESTDVSTDVTSSNFQK 245

Query: 116 SIYLLSSATAEFFADIMLCPFEAIKVKQQ--TTMPPWCN-NVIEGWKKMYAKEGLNGFYK 172
            I  L+S  ++  A  +  P E ++ + Q  + +P     +++   K  Y +EG  GFY 
Sbjct: 246 LI--LASMLSKMVASTVTYPHEILRTRMQLKSDLPNTVQRHLLPLIKITYRQEGFAGFYS 303

Query: 173 GITPLWCRQIPYTMCKFTSFE 193
           G      R +P  +    SFE
Sbjct: 304 GFATNLVRTVPAAVVTLVSFE 324

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 36/81 (44%), Gaps = 7/81 (8%)

Query: 120 LSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWK-------KMYAKEGLNGFYK 172
           +S A +   + +++CPF+  K + Q        +  + +K        ++  EG  G YK
Sbjct: 43  ISGALSGALSAMLVCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYK 102

Query: 173 GITPLWCRQIPYTMCKFTSFE 193
           G+ P     IP  M  F+ ++
Sbjct: 103 GLQPTVLGYIPTLMIYFSVYD 123

>CAGL0F08305g complement(827705..828829) similar to sp|P53320
           Saccharomyces cerevisiae YGR257c, start by similarity
          Length = 374

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 95/247 (38%), Gaps = 33/247 (13%)

Query: 60  QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYK-YRTSIY 118
           +I K EG+  L+ G+  T +         + GYE          V+D +     Y T   
Sbjct: 119 KIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEY---------VRDRSPLNGLYPTINP 169

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNN--------VIEGWKKMYAKEGL-NG 169
           L+  A A   A   + P E IK K Q+       N        +    K   A  G+   
Sbjct: 170 LICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQT 229

Query: 170 FYKGITPLWCRQIPYTMCKFTSFERI-VEAIYARLPTKKSEMSALQQISVSFVGGYMAGI 228
            +KG+     R +P++   + S+E    +  Y    T     S     + SF+GG+++G 
Sbjct: 230 MFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNSFLGGFISGS 289

Query: 229 LCAIVSHPADV-----MVSKINNERKVNESMNVA--------LKRIYSRIGFVGLWNGLP 275
           L AI +HP DV      +S + +++  N ++           L  I    G   L+ GL 
Sbjct: 290 LAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLA 349

Query: 276 VRILMIG 282
            R+  I 
Sbjct: 350 PRVAKIA 356

 Score = 33.1 bits (74), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 13/98 (13%)

Query: 15  YYAACTLGGIVACGPTHSSVTPLDLIKCRLQV----DPTLYRSNTS--------GIIQIL 62
           ++    LGG ++         P D+ K R Q+    D  L  SN          G +  +
Sbjct: 276 HFTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYI 335

Query: 63  KK-EGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLY 99
           +K EG+G L+TG+       +   A     YEL KRL+
Sbjct: 336 RKTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKRLF 373

 Score = 32.0 bits (71), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 43/188 (22%), Positives = 74/188 (39%), Gaps = 28/188 (14%)

Query: 32  SSVTPLDLIKCRLQVDPT---------LYRSNTSGIIQILKKEGLGK-LFTGVGATCIGY 81
           +SV PL+LIK +LQ  P+         +YR   + I   +   G+ + +F G+  T    
Sbjct: 182 TSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIKSEIAMRGVAQTMFKGLEITLWRD 241

Query: 82  SLQGAGKYGGYELFKR----LYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFE 137
               A  +  YE +K     L  +   K+ +  + +  S   L    +   A I   PF+
Sbjct: 242 VPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFHFTNS--FLGGFISGSLAAICTHPFD 299

Query: 138 AIKVKQQ-----------TTMPPWCNNVIEGWKKMYAK-EGLNGFYKGITPLWCRQIPYT 185
             K +QQ           + +    +N + G+     K EG+   Y G+ P   +  P  
Sbjct: 300 VGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNYIRKTEGIGALYTGLAPRVAKIAPSC 359

Query: 186 MCKFTSFE 193
               +S+E
Sbjct: 360 AIMISSYE 367

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 9/95 (9%)

Query: 152 NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMS 211
           N  +E ++K+   EG+   ++GI+      IP  +  FT +E      Y R    +S ++
Sbjct: 111 NGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYE------YVR---DRSPLN 161

Query: 212 ALQQISVSFVGGYMAGILCAIVSHPADVMVSKINN 246
            L       + G  A  L A    P +++ +K+ +
Sbjct: 162 GLYPTINPLICGAFARTLAATSVAPLELIKTKLQS 196

>CAGL0D01606g complement(169066..169983) highly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, start by
           similarity
          Length = 305

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 131 IMLCPFEAIKVKQQT---TMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187
           +M+ P + +K   QT     P    N+I+  + +YA+EGL  F+KG  P   R  P    
Sbjct: 233 LMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGG 292

Query: 188 KFTSFE 193
            F +FE
Sbjct: 293 TFATFE 298

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 108/269 (40%), Gaps = 31/269 (11%)

Query: 36  PLDLIKCRLQVD--PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           P D  K RLQ    PT   S    +  +LK EG    + G     +G     + ++G  E
Sbjct: 45  PFDTTKVRLQTSKVPT---SAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNE 101

Query: 94  LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNN 153
             KR +    V   AT      S Y L   T       +  P E ++++ QT        
Sbjct: 102 AMKRFFHARNVDHNAT---LSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQA 158

Query: 154 VIEG----WKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIV-EAIYARLPTKKS 208
             +G     KK+ +++GL    +G+ P   R+       F  +E +V + I   L  K++
Sbjct: 159 EFKGPIDCIKKLRSQKGL---MRGLIPTMLREGHGCGTYFLVYEALVSKQINQGL--KRT 213

Query: 209 EMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKIN----NERKVNESMNVALKRIYSR 264
           E+   +      + G ++G    ++ +P DV+ S +     N+ +  ++M    + +Y+R
Sbjct: 214 EIPPWKLC----LYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAR 269

Query: 265 IGFVGLWNGLPVRILMI-----GTLTSFQ 288
            G    + G    +L       GT  +F+
Sbjct: 270 EGLKAFFKGFGPTMLRAAPANGGTFATFE 298

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 34  VTPLDLIKCRLQVDPTLYRSNTSGIIQILK----KEGLGKLFTGVGATCIGYSLQGAGKY 89
           V P+D++K  +Q D      N   +IQ+ +    +EGL   F G G T +  +    G +
Sbjct: 235 VYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFFKGFGPTMLRAAPANGGTF 294

Query: 90  GGYELFKRL 98
             +EL  RL
Sbjct: 295 ATFELAMRL 303

>Scas_578.3*
          Length = 524

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 70/329 (21%), Positives = 123/329 (37%), Gaps = 58/329 (17%)

Query: 15  YYAACTLGGIVACGPTHSSVTPLDLIK----CRLQVDPTLYRSNTSGIIQIL-------- 62
           Y+ A  L G++    + +   PLD IK     R  +  TL        IQ L        
Sbjct: 211 YFIAGGLSGVI----SRTCTAPLDRIKVFLIARTDLSSTLLNPKMHLRIQGLNLAKIRSP 266

Query: 63  ---------KKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYST----HLVKDEAT 109
                    ++ GL   + G G +      + + K+G +EL KRL +      LV D + 
Sbjct: 267 IIKAIRSLYRQGGLRAFYVGNGLSVFKICPESSIKFGTFELAKRLMANLSGDKLVNDLSK 326

Query: 110 AYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNN------VIEGWKKMYA 163
              Y      ++   A   A I + P + +K + Q    P   N      +I   K+MY 
Sbjct: 327 LQTY------VAGGIAGVMAQISIYPIDTLKFRIQCA--PLEGNLKGNALLISTAKEMYK 378

Query: 164 KEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYAR------LPTKKSEMSALQQIS 217
           + G+  FY+G+        PY      +F  + +    R      +P K   +S L  + 
Sbjct: 379 EGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVMLSYLLVLP 438

Query: 218 VSFVGGYMAGILCAIVSHPADVMVSKINNERKVNE-----SMNVALKRIYSRIGFVGLWN 272
           +    G  +G + A   +P +++ +++  +                 +   R G  G + 
Sbjct: 439 M----GAFSGTVGATAVYPINLLRTRLQAQGTYAHPYTYTGFRDVFMQTLKREGVPGFYK 494

Query: 273 GLPVRILMIGTLTSFQWLIYDSFKAYVGL 301
           GL   ++ +    S  +L Y+ FKA + L
Sbjct: 495 GLVPTLVKVCPAVSIGYLCYEKFKAAMSL 523

 Score = 33.9 bits (76), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 84/214 (39%), Gaps = 22/214 (10%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII- 59
           +S  K   +L   + Y A  + G++A      S+ P+D +K R+Q  P       + ++ 
Sbjct: 315 LSGDKLVNDLSKLQTYVAGGIAGVMA----QISIYPIDTLKFRIQCAPLEGNLKGNALLI 370

Query: 60  ----QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRT 115
               ++ K+ G+   + GV    +G     A   G +   K+ Y     K      K   
Sbjct: 371 STAKEMYKEGGIRVFYRGVLLGALGIFPYAALDLGTFSALKKWYIKRQSKKLNIPEKDVM 430

Query: 116 SIYLLSSATAEFFADI---MLCPFEAIKVK---QQTTMPPWCNNVIEGWKKMY----AKE 165
             YLL      F   +    + P   ++ +   Q T   P+      G++ ++     +E
Sbjct: 431 LSYLLVLPMGAFSGTVGATAVYPINLLRTRLQAQGTYAHPYT---YTGFRDVFMQTLKRE 487

Query: 166 GLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
           G+ GFYKG+ P   +  P     +  +E+   A+
Sbjct: 488 GVPGFYKGLVPTLVKVCPAVSIGYLCYEKFKAAM 521

>CAGL0H03839g 359987..360835 highly similar to sp|P38921
           Saccharomyces cerevisiae YNL003c PET8, start by
           similarity
          Length = 282

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 109/264 (41%), Gaps = 23/264 (8%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATC-- 78
           L G  A   T     P+D +K RLQ     +R+   G   + +  G   + +  GA+   
Sbjct: 10  LSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNG--GYRGVYRGLGSAVVASAPGASLFF 67

Query: 79  IGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEA 138
           I Y    A   G    F+ L  +  V D  T        ++ SS+  E  A ++  P E 
Sbjct: 68  ITYDTCKAETRG---FFRGLLPSSNVADVVT--------HMFSSSMGEIAACMVRVPAEV 116

Query: 139 IKVKQQTTMPPWCNNVIEGWKKMYAKEGLN-GFYKGITPLWCRQIPYTMCKFTSFERIVE 197
           +K + QT         +    K    EG+    Y+G +    R+IP+T  +F  +E  ++
Sbjct: 117 VKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMREIPFTCIQFPLYE-YMK 175

Query: 198 AIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVA 257
            ++A L     + S   +     V G +AG + A  + P D + +++   +K +  +   
Sbjct: 176 KVWAEL-----DESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLMLCKK-SIPLGTL 229

Query: 258 LKRIYSRIGFVGLWNGLPVRILMI 281
           +  IY   GF   ++G+  R + I
Sbjct: 230 VSTIYKEEGFKVFFSGVGPRTMWI 253

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 38/80 (47%), Gaps = 1/80 (1%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYS 82
           G +A G   ++ TPLD +K RL +        T  +  I K+EG    F+GVG   +  S
Sbjct: 196 GSIAGGIAAATTTPLDFLKTRLMLCKKSIPLGTL-VSTIYKEEGFKVFFSGVGPRTMWIS 254

Query: 83  LQGAGKYGGYELFKRLYSTH 102
             GA   G YE    L ST+
Sbjct: 255 AGGAIFLGIYETVHSLLSTN 274

>YMR241W (YHM2) [4197] chr13 (751960..752904) Suppressor of abf1
           mutant that affects mitochondrial HMG-like DNA-binding
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [945 bp, 314 aa]
          Length = 314

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 4/124 (3%)

Query: 158 WKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLP---TKKSEMSALQ 214
           +K +Y KEG+ G  KG+  +  RQ+     +F    R+VE    ++     K  +++  +
Sbjct: 159 FKNIYKKEGIRGINKGVNAVAIRQMTNWGSRF-GLSRLVEDGIRKITGKTNKDDKLNPFE 217

Query: 215 QISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGFVGLWNGL 274
           +I  S +GG ++     I     ++   K +  R  N ++    K IY   G  GL+ G+
Sbjct: 218 KIGASALGGGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGV 277

Query: 275 PVRI 278
             RI
Sbjct: 278 TPRI 281

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 74/177 (41%), Gaps = 23/177 (12%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII---------QILKKEG 66
           +A+  LGG+   G T + +T +    C   V+ T ++S ++G +          I KKEG
Sbjct: 110 FASGILGGVTG-GVTQAYLT-MGFCTCMKTVEITRHKSASAGGVPQSSWSVFKNIYKKEG 167

Query: 67  LGKLFTGVGATCIGYSLQGAGKYGGYELFK---RLYSTHLVKDEATAYKYRTSIYLLSSA 123
           +  +  GV A  I        ++G   L +   R  +    KD+      +     L   
Sbjct: 168 IRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKITGKTNKDDKLNPFEKIGASALGGG 227

Query: 124 TAEFFADIMLCPFEAIKVKQQTTM--PPWCNNVIEG--WKKMYAKEGLNGFYKGITP 176
            + +       P E I+V+ Q+    P    N+  G  +K +Y   GL G Y+G+TP
Sbjct: 228 LSAWNQ-----PIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTP 279

>Scas_558.2
          Length = 289

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/279 (20%), Positives = 118/279 (42%), Gaps = 37/279 (13%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVG 75
           +    L G  A   T     P+D +K RLQ     +++            G   ++ G+G
Sbjct: 6   FVMSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFQNG-----------GYHGIYRGLG 54

Query: 76  ATCIGYSLQGAGKYGGYELFK---RLYSTHLVKDEAT--AYKYRTSIYLLSSATAEFFAD 130
           +  +  +   +  +  Y+  K   R +   ++    T   +   T +++++S+  E  A 
Sbjct: 55  SAVVASAPSASLFFVTYDSMKVRVRPHVERVINSSGTRSPHSVDTIVHMIASSMGELAAC 114

Query: 131 IMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNG----FYKGITPLWCRQIPYTM 186
           ++  P E IK + Q       N+  + ++ +   E   G     Y+G +    R+IP+T 
Sbjct: 115 LVRVPAEVIKQRTQVHS---TNSSWQTFRTILKNENQEGIIRNLYRGWSTTIMREIPFTC 171

Query: 187 CKFTSFERIVE--AIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSK- 243
            +F  +E + +  A+Y       +E+  L+    +  G  +AG + A  + P D + ++ 
Sbjct: 172 IQFPLYEFMKKEWALY------DNEVGHLKPWKGAICGS-IAGGIAAATTTPLDFLKTRL 224

Query: 244 -INNERKVNESMNVALKRIYSRIGFVGLWNGLPVRILMI 281
            +N +    +S+   ++ IY   GF   ++G+  R + I
Sbjct: 225 MLNKDSIPIKSL---IRNIYKEEGFKIFFSGIYPRTMWI 260

 Score = 32.3 bits (72), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYS 82
           G +A G   ++ TPLD +K RL ++        S I  I K+EG    F+G+    +  S
Sbjct: 203 GSIAGGIAAATTTPLDFLKTRLMLNKDSIPIK-SLIRNIYKEEGFKIFFSGIYPRTMWIS 261

Query: 83  LQGAGKYGGYE 93
             GA   G YE
Sbjct: 262 AGGAIFLGVYE 272

>Scas_667.22
          Length = 306

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 94/210 (44%), Gaps = 28/210 (13%)

Query: 102 HLVKDEATAYKYRTS--IYLLSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIEGW 158
            L+ D     K+  +  I  L + TA   A +++  PF+  KV+ QT+  P     +E  
Sbjct: 9   QLIDDLENHPKHDNARVIKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTP--TTAMEVI 66

Query: 159 KKMYAKEGLNGFYKG-ITPLWCRQIPYTMC---KFTSFERIVEAIYARLPTKKSEMSALQ 214
           +K+   EG  GFYKG +TPL    I    C   +F   E +    ++R P   S++ +L 
Sbjct: 67  RKLLKNEGPKGFYKGTLTPL----IGVGACVSLQFGVNEAMKRFFHSRNPDSTSQILSLP 122

Query: 215 QISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALK-------RIYSRIGF 267
           Q    ++ G   GI  + ++ P + +  +I  + +     NV  K       ++ ++ GF
Sbjct: 123 QY---YICGLTGGITNSFLASPIEHV--RIRLQTQTGSGPNVEFKGPLDCIRKLRAQGGF 177

Query: 268 VGLWNGLPVRILMIGTLTSFQWLIYDSFKA 297
           +    GL   +L  G      +L+Y++  A
Sbjct: 178 M---RGLTPTMLREGHGCGTYFLVYEAMVA 204

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 131 IMLCPFEAIKVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187
           +M+ P + IK   QT     P + N++    K +YAK GL  F+KG  P   R  P    
Sbjct: 234 MMVYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGA 293

Query: 188 KFTSFE 193
            F +FE
Sbjct: 294 TFATFE 299

 Score = 32.7 bits (73), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 4/69 (5%)

Query: 34  VTPLDLIKCRLQVD----PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKY 89
           V PLD+IK  +Q D    P    S +S    +  K GLG  F G G T +  +      +
Sbjct: 236 VYPLDVIKSVMQTDNLKSPKYGNSISSVAKTLYAKGGLGAFFKGFGPTMLRAAPANGATF 295

Query: 90  GGYELFKRL 98
             +EL  RL
Sbjct: 296 ATFELAMRL 304

>Scas_671.1*
          Length = 123

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 44/95 (46%), Gaps = 1/95 (1%)

Query: 5   KSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK 64
           K  ++  T       ++  I +     +   P D IK R+Q+ P ++ +  + ++ I K 
Sbjct: 28  KEDMKFSTSTSTVVNSVSAIASASLATAITAPFDTIKTRMQLKPKVFTNFFTTLVLITKN 87

Query: 65  EGLGKLFTGVGATCIGYSLQGAGKYGGYE-LFKRL 98
           E + +LF+G+       +L     +G YE L KR+
Sbjct: 88  ESIFQLFSGLSMRLTRKALSAGIAWGIYEDLIKRI 122

>Sklu_2442.8 YNL003C, Contig c2442 12309-13136
          Length = 275

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 63/265 (23%), Positives = 111/265 (41%), Gaps = 28/265 (10%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYS 82
           G  A   T  +  P+D +K RLQ     + +            G   ++ G+G+  I  +
Sbjct: 13  GAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG-----------GYKGVYRGLGSAVIASA 61

Query: 83  LQGAGKYGGYELFKRLYSTHLVKDEATAYKY--RTSIYLLSSATAEFFADIMLCPFEAIK 140
              +  +  Y+  K +YS  ++    T+      T  ++ SS+  E  A ++  P E IK
Sbjct: 62  PSASLFFVSYDSMK-VYSKPVISKYVTSNNQMADTLSHMFSSSIGEVSACLVRVPAEVIK 120

Query: 141 VKQQTTMPPWCNNVIEGWKKMYAKEG----LNGFYKGITPLWCRQIPYTMCKFTSFERIV 196
            + QT      N+  + + K+   E     L   Y+G      R+IP+T  +F  +E + 
Sbjct: 121 QRTQTHK---TNSSWQTFTKILQNENGEGVLRNLYRGWNTTIMREIPFTCIQFPLYEFLK 177

Query: 197 EAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNV 256
           +    R      +  A  Q SV    G +AG + A  + P DV+ +++    K      +
Sbjct: 178 KTWAKR---NGQDHVAPWQGSVC---GSVAGAIAAATTTPLDVLKTRLMLSHKSIPVAQL 231

Query: 257 ALKRIYSRIGFVGLWNGLPVRILMI 281
           A K IY+  GF   ++G+  R + I
Sbjct: 232 A-KNIYAEEGFKVFFSGVGPRTMWI 255

>Sklu_1275.1 , Contig c1275 314-1249
          Length = 311

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 82/190 (43%), Gaps = 22/190 (11%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTL-----YRSNTSGIIQILKKEGLGKLFTGVGAT 77
           G V+        TP++ ++ RLQ+         YR +   + ++LK++ L + FT   AT
Sbjct: 125 GFVSGSANAFLATPIEHVRIRLQLQTKALAKAEYRGSLDCMKKLLKQKALMRGFT---AT 181

Query: 78  CIGYSLQGAGKYG-GYE-LFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
            +  S  G G Y   YE L        +++ +   +K    + +  + +  FF   M  P
Sbjct: 182 LMRTS-HGFGVYFLTYEALIMNQNKNGVLRKDIPPWK----VCVFGAFSGAFFW-AMTYP 235

Query: 136 FEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSF 192
           F+ +K   Q      P    NV +  K ++A  G   F KG  P   R +P     F +F
Sbjct: 236 FDVVKSIMQADRLVSPVHGKNVFQVAKSIHATRGWGAFVKGFVPTMLRSLPVNGATFATF 295

Query: 193 E---RIVEAI 199
           E   R++E++
Sbjct: 296 EVTMRLLESL 305

 Score = 41.2 bits (95), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 61/141 (43%), Gaps = 5/141 (3%)

Query: 97  RLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVI 155
            L +  +V D + A ++R +I  + S T+   A +++  PF+  KV+ QT+        I
Sbjct: 4   ELTTPQVVDDLSDAPEFRKAIKDIISGTSGGIAQVLVGQPFDITKVRMQTS--SGSPTAI 61

Query: 156 EGWKKMYAKEGLNGFYKG-ITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQ 214
           E  K +   EGL  FYKG + PL       + C+F   E +          K   +S LQ
Sbjct: 62  EVIKNLVKNEGLLAFYKGTLVPLIGVGACVS-CQFGVNEAMKRYFLRVNGYKDQHLSLLQ 120

Query: 215 QISVSFVGGYMAGILCAIVSH 235
             +  FV G     L   + H
Sbjct: 121 YYTCGFVSGSANAFLATPIEH 141

>KLLA0D09889g complement(834904..835998) similar to sp|Q03829
           Saccharomyces cerevisiae YMR166c, start by similarity
          Length = 364

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 62/300 (20%), Positives = 118/300 (39%), Gaps = 36/300 (12%)

Query: 19  CTLGGIVACGPTHSSVTPLDLIKCRLQVDPTL--YRSNTSGIIQILKKEGLGK-LFTGVG 75
           C L G +      S++  LD +K R Q  P+   Y++       I+ +EGL K L+ G  
Sbjct: 58  CMLAGGIGGAIGDSAMHSLDTVKTRQQGAPSTVKYKNMIGAYRTIILEEGLRKGLYGGYS 117

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
              +G     A  +  YE  KR        +E   + + T+ +L      +F +  +  P
Sbjct: 118 GAMLGSFPSAAIFFATYEYTKRKMIGEWGINET--FSHLTAGFL-----GDFISSFVYVP 170

Query: 136 FEAIKVKQQTT---MPPWCN------NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTM 186
            E +K + Q       P+        N+ +    +  +EG    + G      R +P++ 
Sbjct: 171 SEVLKTRLQLQGRYNNPFFRSGYNYKNLTDAVTTIVRREGWPTLFFGYKATLSRDLPFSG 230

Query: 187 CKFTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINN 246
            +F  +E+  +  +A    +         +S   + G  AG L  I++ P DV+ ++I  
Sbjct: 231 LQFAFYEKFRQLAFA---VENKTFDEDLSLSNEIITGAAAGGLAGIITTPLDVVKTRIQT 287

Query: 247 E--------------RKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIY 292
           +              + +  S+   +  +Y   G  GL++G+  R +     +S   L+Y
Sbjct: 288 QLPDIPENSSQNLKQQTLTNSITKGMMTVYKTEGLAGLFSGVGPRFIWTSIQSSIMLLLY 347

>Sklu_1926.2 YPR058W, Contig c1926 347-1264 reverse complement
          Length = 305

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 131 IMLCPFEAIKVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMC 187
           +M+ P + IK   QT     P    N+++  K +Y+  GL+ F+KG  P   R  P    
Sbjct: 233 LMIYPLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGA 292

Query: 188 KFTSFE 193
            F +FE
Sbjct: 293 TFATFE 298

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 101 THLVKDEATAYKYRTSIYL-LSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIEGW 158
           T L+ D+       T ++  L + TA   + +++  PF+  KV+ QT+  P     ++  
Sbjct: 7   TPLIIDDLDGAHDSTRVFKDLLAGTAGGVSQVLIGQPFDTTKVRLQTSSVP--TTALDVV 64

Query: 159 KKMYAKEGLNGFYKG-ITPL 177
           KK+   EG  GFYKG +TPL
Sbjct: 65  KKLVKNEGFRGFYKGTLTPL 84

 Score = 32.0 bits (71), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 4/67 (5%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQILK----KEGLGKLFTGVGATCIGYSLQGAGKYGG 91
           PLD+IK  +Q D  L       ++Q+ K      GL   F G G T +  +      +  
Sbjct: 237 PLDVIKSVMQTDSLLQPKQGKNMLQVAKTIYSTRGLSSFFKGFGPTMLRAAPANGATFAT 296

Query: 92  YELFKRL 98
           +EL  R+
Sbjct: 297 FELAMRV 303

>Kwal_27.12599
          Length = 304

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 61/144 (42%), Gaps = 15/144 (10%)

Query: 100 STHLVKDEATAYKYRTSIYL--LSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIE 156
           S+ L+ D+     + +   L  L + TA   A +++  PF+  KV+ QT+  P     +E
Sbjct: 6   SSPLLIDDIDQQPHDSGRVLKDLLAGTAGGMAQVLVGQPFDTTKVRLQTSTTP--TTAVE 63

Query: 157 GWKKMYAKEGLNGFYKG-ITPL----WCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMS 211
             KK+   EGL GFYKG +TPL     C       C+F   E +              ++
Sbjct: 64  VVKKLVKNEGLRGFYKGTLTPLVGVGAC-----VSCQFGVNEAMKRFFRGSSADPHKTLT 118

Query: 212 ALQQISVSFVGGYMAGILCAIVSH 235
             Q     FVGG     L + + H
Sbjct: 119 LPQYYICGFVGGVANSFLASPIEH 142

 Score = 33.5 bits (75), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 3/62 (4%)

Query: 135 PFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
           P + IK   QT     P    N+I+  + + AK G   F+KG  P   R  P     F +
Sbjct: 236 PLDVIKSLMQTDNLKNPVRGKNIIQVARLVNAKYGWKSFFKGFGPTMLRAAPANGATFAT 295

Query: 192 FE 193
           FE
Sbjct: 296 FE 297

>YBR104W (YMC2) [293] chr2 (449624..450613) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [990 bp, 329 aa]
          Length = 329

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 80/193 (41%), Gaps = 21/193 (10%)

Query: 14  EYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ-------ILKKEG 66
           +YY     GG+V         +P++ I+ RLQ      +++  G  +       I K + 
Sbjct: 144 QYYVCGLTGGVV----NSFLASPIEQIRIRLQT-----QTSNGGDREFKGPWDCIKKLKA 194

Query: 67  LGKLFTGVGATCIGYSLQGAGKYG-GYE-LFKRLYSTHLVKDEATAYKYRTSIYLLSSAT 124
            G L  G+  T I  +  G G Y   YE L  R   T L ++E   +K    ++   S T
Sbjct: 195 QGGLMRGLFPTMI-RAGHGLGTYFLVYEALVAREIGTGLTRNEIPPWKL--CLFGAFSGT 251

Query: 125 AEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184
             +     L   ++I        P + N++    K +YAKEG+  F+KG  P   R  P 
Sbjct: 252 MLWLTVYPLDVVKSIIQNDDLRKPKYKNSISYVAKTIYAKEGIRAFFKGFGPTMVRSAPV 311

Query: 185 TMCKFTSFERIVE 197
               F +FE ++ 
Sbjct: 312 NGATFLTFELVMR 324

>Kwal_33.12988
          Length = 303

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 132 MLCPFEAIKVKQQTT---MPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCK 188
           M+ PF+ IK   Q+     P +  NV +  K +Y + G   F KG  P   R +P     
Sbjct: 232 MVYPFDVIKSVMQSDKLRTPVYGTNVFQVAKNIYNERGPKAFVKGFGPTMLRSLPVNGAT 291

Query: 189 FTSFE 193
           FT+FE
Sbjct: 292 FTAFE 296

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 59/139 (42%), Gaps = 11/139 (7%)

Query: 102 HLVKDEATAYKYRTSIYLLSSATAEFFADIMLC-PFEAIKVKQQTTMPPWCNNVIEGWKK 160
            +V D       R ++  +++ T    A +++  PF+  KV+ QT+  P     +   + 
Sbjct: 9   QVVDDLTDKSDIRRTLKDITAGTTGGIAQVLVGQPFDITKVRLQTSSTP--TTALRVVQD 66

Query: 161 MYAKEGLNGFYKGIT-PLWCRQIPYTMC---KFTSFERIVEAIYARLPTKKSEMSALQQI 216
           +   EGL GFYKG T PL    I   +C   +F + E +    + R   + + +   +  
Sbjct: 67  LVKNEGLRGFYKGTTLPL----IGVGLCVSSQFGTNEAMKRYFHKRNNFQSTSLRLPEYY 122

Query: 217 SVSFVGGYMAGILCAIVSH 235
           +  FV G     L   + H
Sbjct: 123 ACGFVSGCANAFLATPIEH 141

>Kwal_56.23011
          Length = 303

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 81/194 (41%), Gaps = 23/194 (11%)

Query: 10  LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVD-----PTLYRSNTSGIIQILKK 64
           L  ++YYA     G V+        TP++ ++ RLQ+         Y  +     ++LK+
Sbjct: 116 LALRQYYAC----GFVSGTANAFLATPIEHVRIRLQLQTASSSAAEYHGSLDCARKLLKQ 171

Query: 65  EGLGKLFTGVGATCIGYSLQGAGKYG-GYELFKRLYSTH-LVKDEATAYKYRTSIYLLSS 122
              G L  G  AT +  S  G G Y   YE      + H ++++   A+K    + +  +
Sbjct: 172 ---GALMRGFTATTLRTS-HGFGIYFLTYETLIANQAHHGVLRENIPAWK----VCVYGA 223

Query: 123 ATAEFFADIMLCPFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWC 179
            +  FF   M  PF+ +K   Q      P +  N +   K +Y + G   F KG TP   
Sbjct: 224 FSGAFFW-AMTYPFDVVKSVMQADKLKNPVYGRNPLAVAKAIYRERGPRAFTKGFTPTML 282

Query: 180 RQIPYTMCKFTSFE 193
           R +P     F +FE
Sbjct: 283 RSLPVNGATFAAFE 296

 Score = 32.3 bits (72), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 56/142 (39%), Gaps = 5/142 (3%)

Query: 96  KRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLC-PFEAIKVKQQTT-MPPWCNN 153
           + L S  +V D    + ++ ++  +   T    A +++  PF+  KV+ QT+ +P     
Sbjct: 3   EELTSPQVVDDLVDTHDFKQALKDVFCGTVGGVAQVLVGQPFDITKVRLQTSPVPTTAAQ 62

Query: 154 VIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSAL 213
           VI   K +   EGL  FYKG             C+F   E + +    +       ++  
Sbjct: 63  VI---KSLVKNEGLLAFYKGTLAPLAGVGACVSCQFGVNEALKKWFRKKDGNFDQPLALR 119

Query: 214 QQISVSFVGGYMAGILCAIVSH 235
           Q  +  FV G     L   + H
Sbjct: 120 QYYACGFVSGTANAFLATPIEH 141

>CAGL0K12210g 1193771..1194706 similar to sp|P38087 Saccharomyces
           cerevisiae YBR104w YMC2 or sp|P32331 Saccharomyces
           cerevisiae YPR058w YMC1, start by similarity
          Length = 311

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 3/62 (4%)

Query: 135 PFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
           P + +K   QT     P + N++I+  + +Y + G+  F+KG  P   R  P     F S
Sbjct: 243 PVDVVKSVLQTDSIENPKYKNSIIKATRALYKQHGIPAFFKGFVPTMIRAAPANAATFVS 302

Query: 192 FE 193
           FE
Sbjct: 303 FE 304

>AAL014C [173] [Homologous to ScYNL003C (PET8) - SH]
           (317388..318203) [816 bp, 271 aa]
          Length = 271

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/239 (21%), Positives = 100/239 (41%), Gaps = 23/239 (9%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVG 75
           + A  + G  A   T     P+D +K RLQ     + +            G   ++ G+G
Sbjct: 5   FLASLVSGAAAGTSTDVVFFPIDTLKTRLQAKGGFFHNG-----------GYRGIYRGLG 53

Query: 76  ATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
           +  +  +   +  +  Y+  K+     + +  A+        ++LSS+  E  A ++  P
Sbjct: 54  SAVVASAPGASLFFVTYDSMKQQLRPVMGRWTASEQLAEVLTHMLSSSLGEMSACLVRVP 113

Query: 136 FEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGL-NGFYKGITPLWCRQIPYTMCKFTSFER 194
            E IK + QT         +    +    EG+  G Y+G      R+IP+T  +F     
Sbjct: 114 AEVIKQRTQTHHTNSSLQTLRLILRDPTGEGVVRGLYRGWWTTIMREIPFTCIQF----- 168

Query: 195 IVEAIYARLPTKKSEMSALQQISV--SFVGGYMAGILCAIVSHPADVMVSKIN-NERKV 250
               +Y  L  K +  + ++++S     V G +AG + A  + P DV+ +++  +ER+V
Sbjct: 169 ---PLYEYLKKKWAAYAEIERVSAWQGAVCGSLAGGIAAAATTPLDVLKTRMMLHERRV 224

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 9/68 (13%)

Query: 36  PLDLIKCRLQVD----PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGG 91
           PLD++K R+ +     P L+ + T     + ++EG    F G+G   +  S  GA   G 
Sbjct: 209 PLDVLKTRMMLHERRVPMLHLART-----LFREEGARVFFRGIGPRTMWISAGGAIFLGV 263

Query: 92  YELFKRLY 99
           YE    L+
Sbjct: 264 YEAVHSLF 271

>Kwal_27.11419
          Length = 298

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 77/172 (44%), Gaps = 15/172 (8%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK-EGLGKLFTGVGATCI 79
           +GG V    +   + P DL+K RLQ      ++ +S ++ +++  E  G+L+ G   + +
Sbjct: 12  IGGFVGGLTSAVILQPFDLLKTRLQ------QNKSSNLLDVVRSIETPGQLWKGTLPSAL 65

Query: 80  GYSLQGAGKYGGYELFKRLYSTHLVK-----DEATAYKYRTSIY--LLSSATAEFFADIM 132
             S+  A       + +   +   VK     + ++++  + S+Y  L+S A       + 
Sbjct: 66  RTSVGSALFLSTLNIVRSAIADKRVKGIAGKNGSSSFLPQLSMYENLISGAITRAAVGVA 125

Query: 133 LCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPY 184
             P   +KV+ ++TM  +  ++ E    +Y  EG+ G + G      R  PY
Sbjct: 126 TMPITVLKVRFESTMYNY-KSLGEAATHIYRSEGIRGLFSGCGATVMRDAPY 176

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 72/172 (41%), Gaps = 16/172 (9%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIG 80
           + G +       +  P+ ++K R +     Y+S       I + EG+  LF+G GAT   
Sbjct: 113 ISGAITRAAVGVATMPITVLKVRFESTMYNYKSLGEAATHIYRSEGIRGLFSGCGATV-- 170

Query: 81  YSLQGAGKYGGYELF--------KRLYSTHLVK-DEATAYKYRTSIYLLSSA--TAEFFA 129
             ++ A   G Y LF         R+    +V+ +E+  +  +TS  + S A  ++   A
Sbjct: 171 --MRDAPYAGLYVLFYEQSKLQLPRILPVWMVEHNESGVFSTKTSTIINSIAAFSSASLA 228

Query: 130 DIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQ 181
             +  PF+ IK + Q   P      I+ +K +   E     + G++    R+
Sbjct: 229 TTITSPFDTIKTRMQLN-PSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRK 279

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 27/59 (45%)

Query: 35  TPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGYE 93
           +P D IK R+Q++P+ Y         I++ E    LF G+       +L     +G YE
Sbjct: 233 SPFDTIKTRMQLNPSQYYGFIQTFKSIIRYERPRNLFDGLSLRLSRKALSAGIAWGIYE 291

 Score = 29.6 bits (65), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 8/32 (25%), Positives = 20/32 (62%)

Query: 220 FVGGYMAGILCAIVSHPADVMVSKINNERKVN 251
           F+GG++ G+  A++  P D++ +++   +  N
Sbjct: 11  FIGGFVGGLTSAVILQPFDLLKTRLQQNKSSN 42

>CAGL0B03883g 383602..384522 weakly similar to sp|P32331
           Saccharomyces cerevisiae YPR058w YMC1 or sp|P38087
           Saccharomyces cerevisiae YBR104w YMC2, hypothetical
           start
          Length = 306

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 83/203 (40%), Gaps = 27/203 (13%)

Query: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKK------------ 64
           + C + G++A         P++L K +LQV      +  +G I +++K            
Sbjct: 112 SGCIISGVMAGWTVSFIAAPVELAKAKLQVQYDAKTTKYTGPIDVVQKVFKQGMATNGIL 171

Query: 65  EGLGKLFTGVGATCIGYSLQGAGKYGGYELFKRLY--STHLVKDEATAYKYRTSI---YL 119
            G+  L+ G+ +T I +       +G YEL  + +  +T+L       +    S    + 
Sbjct: 172 GGVRSLYKGLISTLI-FRSNFVFWWGSYELITQWFQKNTNLSAPAINFWAGGLSASFGFW 230

Query: 120 LSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWC 179
            S+  ++    ++LC       K   +   W   V +    +Y + G++GF+KG  P + 
Sbjct: 231 TSAYPSDVVKQVVLC-----NDKYDGSFKSWRTAVSD----IYRQRGIHGFFKGFLPSFL 281

Query: 180 RQIPYTMCKFTSFERIVEAIYAR 202
           R  P       +FE ++    A+
Sbjct: 282 RSFPANAAALAAFEFVLRTSGAK 304

>AGL064W [4247] [Homologous to ScYBR291C (CTP1) - SH]
           complement(587623..588513) [891 bp, 296 aa]
          Length = 296

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 108/258 (41%), Gaps = 28/258 (10%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGII---QILKKEGLGKLFTGVGATCIGYSLQGAGKYGGY 92
           P +  K RLQ+       + + ++   +  + +G G L+ G  A  +G + +   ++ G+
Sbjct: 30  PFEFAKTRLQLAQQGSGESRNPLVLLYRTARTQGAGALYVGCPAFVVGNTCKAGVRFLGF 89

Query: 93  ELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIM-LCPFEAIKV----KQQTTM 147
           +  +R      ++DE  A        +L+   A     ++ + PFEA+K      +Q   
Sbjct: 90  DALRR-----ALQDERGALSGPRG--MLAGLGAGLLESVLAVTPFEAVKTALIDDRQAAR 142

Query: 148 PPWCNNVIEGWKKMYA----KEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI--YA 201
           P + +N   G  + YA    + GL G Y G+ P+  RQ      +F  + ++ +A+  YA
Sbjct: 143 PRYQHNG-RGAARNYALLLRELGLRGLYGGLVPVALRQASNQAVRFGCYTQLKQAVQRYA 201

Query: 202 RLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRI 261
             P  +   S       +F+ G ++GI+    + P D + +++           V   R 
Sbjct: 202 GTPADQPLGS-----GQTFLVGALSGIVTVYATMPVDTVKTRMQALDAARYGSTVGCFRA 256

Query: 262 YSR-IGFVGLWNGLPVRI 278
             R  G   LW G   R+
Sbjct: 257 VVREEGVRALWRGATPRL 274

 Score = 29.3 bits (64), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 12/62 (19%), Positives = 30/62 (48%)

Query: 135 PFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFER 194
           P + +K + Q        + +  ++ +  +EG+   ++G TP   R +      FT++E+
Sbjct: 231 PVDTVKTRMQALDAARYGSTVGCFRAVVREEGVRALWRGATPRLGRLVLSGGIVFTAYEK 290

Query: 195 IV 196
           ++
Sbjct: 291 LL 292

>YDL119C (YDL119C) [751] chr4 complement(246689..247612) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [924 bp, 307 aa]
          Length = 307

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 1/64 (1%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKYGGY-EL 94
           P D IK R+Q++P+ + ++ +    I+K E + KLF+G+       +      +G Y EL
Sbjct: 243 PFDTIKTRMQLEPSKFTNSFNTFTSIVKNENVLKLFSGLSMRLARKAFSAGIAWGIYEEL 302

Query: 95  FKRL 98
            KR 
Sbjct: 303 VKRF 306

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 67/309 (21%), Positives = 124/309 (40%), Gaps = 31/309 (10%)

Query: 9   ELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVD--PTLYRS--NTSGIIQILKK 64
           E  TK   ++  +GG      +  ++ PLDL+K R+Q D   TL+++       +Q+ + 
Sbjct: 3   EQATKPRNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKATLWKNLKEIDSPLQLWRG 62

Query: 65  EGLGKLFTGVGA----TCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSI--- 117
                L T +G+    +C+        K       +R     L  D    Y   +S+   
Sbjct: 63  TLPSALRTSIGSALYLSCLNLMRSSLAK-------RRNAVPSLTNDSNIVYNKSSSLPRL 115

Query: 118 ----YLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKG 173
                LL+ A A      +  P   IKV+ ++T+  + +++ E    +Y KEGL GF++G
Sbjct: 116 TMYENLLTGAFARGLVGYITMPITVIKVRYESTLYNY-SSLKEAITHIYTKEGLFGFFRG 174

Query: 174 ITPLWCRQIPYTMCKFTSFERIVEAIYARLPTK------KSEMSALQQISVSFVGGYMAG 227
                 R  PY       +E+  + +   LP++      +   +     +V+     ++ 
Sbjct: 175 FGATCLRDAPYAGLYVLLYEKSKQLLPMVLPSRFIHYNPEGGFTTYTSTTVNTTSAVLSA 234

Query: 228 ILCAIVSHPADVMVSKINNE-RKVNESMNVALKRIYSRIGFVGLWNGLPVRILMIGTLTS 286
            L   V+ P D + +++  E  K   S N     I      + L++GL +R+        
Sbjct: 235 SLATTVTAPFDTIKTRMQLEPSKFTNSFNT-FTSIVKNENVLKLFSGLSMRLARKAFSAG 293

Query: 287 FQWLIYDSF 295
             W IY+  
Sbjct: 294 IAWGIYEEL 302

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 5/66 (7%)

Query: 208 SEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRIGF 267
           +E +   + S   +GG+  G+  A+   P D++ ++I  ++K     N  LK I S +  
Sbjct: 2   TEQATKPRNSSHLIGGFFGGLTSAVALQPLDLLKTRIQQDKKATLWKN--LKEIDSPL-- 57

Query: 268 VGLWNG 273
             LW G
Sbjct: 58  -QLWRG 62

>YMR056C (AAC1) [4016] chr13 complement(387314..388243) ADP/ATP
           carrier protein of the mitochondrial carrier family
           (MCF) of membrane transporters [930 bp, 309 aa]
          Length = 309

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 67/159 (42%), Gaps = 6/159 (3%)

Query: 143 QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI-YA 201
           +Q ++      +++ +K+    EG+  F++G T    R  P     F   ++I   + Y 
Sbjct: 49  KQGSLDTRYKGILDCFKRTATHEGIVSFWRGNTANVLRYFPTQALNFAFKDKIKSLLSYD 108

Query: 202 RLPTKKSEMSALQQISVSFVGG----YMAGILCAIVSHPADVMVSKINNERKVNESMNVA 257
           R     ++  A    S    GG    ++  +  A     AD   SK  ++R+ N  ++V 
Sbjct: 109 RERDGYAKWFAGNLFSGGAAGGLSLLFVYSLDYARTRLAADARGSKSTSQRQFNGLLDV- 167

Query: 258 LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296
            K+     G +GL+ G    +L I       + +YDSFK
Sbjct: 168 YKKTLKTDGLLGLYRGFVPSVLGIIVYRGLYFGLYDSFK 206

>AAR036W [222] [Homologous to ScYGR096W - SH]
           complement(406887..407840) [954 bp, 317 aa]
          Length = 317

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/176 (17%), Positives = 80/176 (45%), Gaps = 18/176 (10%)

Query: 102 HLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWC--NNVIEGWK 159
           HL K EA +  +     +++ + +   A  +  P + +K+++Q  +      + ++  ++
Sbjct: 15  HLRKGEAVSGLH----AVVAGSVSGLVARSVTAPMDTVKIRRQLQLASEHKYHGILHTFR 70

Query: 160 KMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERI-VEAIYARLPTKKSEMSALQQISV 218
            +  +EG+   +KG  P     + Y   +F ++  +   A  A LP +   ++       
Sbjct: 71  TVAREEGVRALWKGNVPASAMYVLYGSLQFGTYAWLNTAAASAGLPPQAHSLAV------ 124

Query: 219 SFVGGYMAGILCAIVSHPADVMVSKINNERKVN-ESMNVALKRIYSRIGFVGLWNG 273
               G +AG++ +++++P D++ +++   R  +  S+    + I+   G  G + G
Sbjct: 125 ----GALAGLVSSLLTYPLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRG 176

 Score = 32.0 bits (71), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 39/193 (20%), Positives = 73/193 (37%), Gaps = 29/193 (15%)

Query: 36  PLDLIKCRLQVDPTLYRSNTSGIIQIL-KKEGLGKLFTGVGATCIGYSLQGAGKYGGYEL 94
           PLDL++ RL  + + +  +     +++   EG    F G        +L     +G YE 
Sbjct: 138 PLDLLRTRLVANRSAHFFSLRRQARVIWDTEGPAGFFRGGAWAIAATTLTTGLIFGIYET 197

Query: 95  FKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVKQQT--------- 145
                 T+ +   A A          +S TA   +   + P + ++ + Q          
Sbjct: 198 CTIAADTYGLPWLAAA----------ASPTAGLVSKAAVFPLDTVRRRLQIVDAKHIPFF 247

Query: 146 TMPPWCNNVIEGWK------KMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAI 199
           T  P   + + G +       M   EG+   YKG+T   C+  P T+     ++R +  +
Sbjct: 248 TRDPGAYSALRGTRFLGLAVHMVRAEGIASLYKGLTMALCKSTPTTVITLWVYQRCLRLL 307

Query: 200 YARLPTKKSEMSA 212
               PT+  ++ A
Sbjct: 308 E---PTRAPQLPA 317

>KLLA0D04950g 424550..425374 similar to sp|P38921 Saccharomyces
           cerevisiae YNL003c PET8 member of the mitochondrial
           carrier (MCF) family, start by similarity
          Length = 274

 Score = 37.0 bits (84), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/186 (22%), Positives = 77/186 (41%), Gaps = 20/186 (10%)

Query: 14  EYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTG 73
           + + A  + G  A   T  +  P+D +K RLQ     + +            G   ++ G
Sbjct: 4   QMFIASLVSGAAAGTSTDLAFFPIDTLKTRLQAKGGFFANG-----------GYKGVYRG 52

Query: 74  VGATCIGYSLQGAGKYGGYELFK---RLYSTHLVK--DEATAYKYRTSIYLLSSATAEFF 128
           +G+  +  +   +  +  Y+  K   R     L+   ++ TA    T  +++SS+  E  
Sbjct: 53  LGSAVVASAPSASLFFVAYDSMKCWSRPVIGQLLPKGEDQTA---DTLSHMVSSSFGEIS 109

Query: 129 ADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGL-NGFYKGITPLWCRQIPYTMC 187
           A ++  P E IK + QT         ++   +    EGL    Y+G +    R+IP+T  
Sbjct: 110 ACMVRVPAEVIKQRTQTHRTNSSLQTLQALLRNENGEGLRRNLYRGWSTTIMREIPFTCI 169

Query: 188 KFTSFE 193
           +F  +E
Sbjct: 170 QFPLYE 175

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 35  TPLDLIKCRLQVDPTLYRSNTSGII---QILKKEGLGKLFTGVGATCIGYSLQGAGKYGG 91
           TPLD++K R+     L+  + S +     +L++EG+   F+GVG   +  S  GA   G 
Sbjct: 211 TPLDVLKTRIM----LHHKSVSALHLAKTMLQEEGVKVFFSGVGPRTMWISAGGAIFLGV 266

Query: 92  YELFKRLY 99
           YE    L+
Sbjct: 267 YETVHSLF 274

>Scas_705.9
          Length = 323

 Score = 36.6 bits (83), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/180 (21%), Positives = 75/180 (41%), Gaps = 19/180 (10%)

Query: 120 LSSATAEFFADIMLCPFEAIK-VKQQTTMPPWCN-------------NVIEGWKKMYAKE 165
           ++ A A   A++++ P +  K V Q  T     +             NVI    +++ K 
Sbjct: 8   ITGAIASTMANVIVYPLDVAKTVIQSETKAKETDELSEKDKRILRQENVIRCLIRIFRKR 67

Query: 166 GLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISV--SFVGG 223
           GL G Y+G++     +   + C F  +  +    ++    + ++   +  IS     + G
Sbjct: 68  GLRGLYQGMSTSVFSKFVQSFCYFFWYSFLRRKYFSLKLLRNTQARPINSISTVEELIVG 127

Query: 224 YMAGILCAIVSHPADVMVSKIN-NERKVNESMNVALKRIY--SRIGFVGLWNGLPVRILM 280
             A  L  +V++P +V+++K    + K N      LK+IY  S       W G  V +++
Sbjct: 128 VGAAALTQVVNNPIEVILTKQQTTDDKDNVDFYSVLKQIYVESNGKLSSYWKGFKVSLIL 187

>AFR147C [3339] [Homologous to NOHBY] (703270..704217) [948 bp, 315
           aa]
          Length = 315

 Score = 36.2 bits (82), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 72/162 (44%), Gaps = 9/162 (5%)

Query: 139 IKVKQQTTMP-PWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVE 197
           ++V +Q   P     + +E  +++Y KEG+ GFY G+          ++  +  +E    
Sbjct: 44  MQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYYYFYELAAR 103

Query: 198 AIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVA 257
           A      T +   S     S + +   +AG + AI S+P  V+ +++   +    ++ V 
Sbjct: 104 A------TMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQSTLAVL 157

Query: 258 LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           L  I  + G   L+NGL   ++++      Q+ +++  K  V
Sbjct: 158 LD-IVRKDGVTALFNGLRPALMLVSN-PIIQYTVFEQLKNVV 197

 Score = 34.7 bits (78), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 54/260 (20%), Positives = 106/260 (40%), Gaps = 37/260 (14%)

Query: 36  PLDLIKCRLQVDP------TLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGKY 89
           PL  +  R+QV        T  +S    + +I +KEG+   + G+ +   G +      Y
Sbjct: 36  PLVTLATRMQVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYYGLESAMYGMAANSLNYY 95

Query: 90  GGYELFKRLYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCPFEAIKVK------Q 143
             YEL  R  +T  V+    + +  TS  +LSSA A     I   P   +  +      +
Sbjct: 96  YFYELAAR--ATMRVRG---SRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSE 150

Query: 144 QTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARL 203
           Q+T+    + V         K+G+   + G+ P     +   + ++T FE++   +    
Sbjct: 151 QSTLAVLLDIV--------RKDGVTALFNGLRPA-LMLVSNPIIQYTVFEQLKNVVL--- 198

Query: 204 PTKKSEMSALQQISVSFVGGYMAGILCAIVSHP-----ADVMVSKINNERKVNESMNVAL 258
              K   S +   S +F+ G +  +     ++P       + ++K   +    +SM   +
Sbjct: 199 ---KWSGSDVLLPSWAFLLGAVGKLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLM 255

Query: 259 KRIYSRIGFVGLWNGLPVRI 278
             I  + G  GL++G+ V++
Sbjct: 256 VDIVKKEGIQGLYHGIGVKL 275

>Sklu_2398.4 , Contig c2398 9476-10405
          Length = 309

 Score = 35.4 bits (80), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 48/203 (23%), Positives = 85/203 (41%), Gaps = 26/203 (12%)

Query: 10  LYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDP-----TLYRSNTSGIIQILKK 64
           L  K+YY      G+ +        TP++ ++ RLQ+         Y+ +   + ++LK+
Sbjct: 116 LSLKQYYVC----GVASGCANAFLATPIEHVRIRLQLQTKSLANAEYQGSLDCMRKLLKQ 171

Query: 65  EGLGKLFTG-VGATCIGYSLQGAGKYGGYE-LFKRLYSTHLVKDEATAYKYRTSIYLLSS 122
             L + FT  +  TC G+ +     +  YE L    +   + + +   +K    I+   S
Sbjct: 172 GALMRGFTATLMRTCHGFGIY----FSTYEALIANQHKKGIPRKDIAPWK--VCIFGAFS 225

Query: 123 ATAEFFADIMLCPFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWC 179
             A ++A  M  P + +K   Q+     P    NV +  K +Y   G   F KG  P   
Sbjct: 226 G-ACYWA--MAYPIDVVKSIMQSDRLVSPVHGTNVWQVAKSIYTTRGKRAFIKGFMPAML 282

Query: 180 RQIPYTMCKFTSFE---RIVEAI 199
           R +P     F +FE   R++E +
Sbjct: 283 RSLPVNGATFATFEMTMRLLERV 305

>Scas_718.5
          Length = 324

 Score = 35.4 bits (80), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 135 PFEAIKVKQQTTM---PPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
           P + +K   QT     P + N++      +Y ++G++ F+KG  P   R  P     F +
Sbjct: 256 PLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGATFVT 315

Query: 192 FERIVEAI 199
           FE ++  +
Sbjct: 316 FELVMRLL 323

 Score = 29.3 bits (64), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/70 (24%), Positives = 32/70 (45%), Gaps = 4/70 (5%)

Query: 33  SVTPLDLIKCRLQVD----PTLYRSNTSGIIQILKKEGLGKLFTGVGATCIGYSLQGAGK 88
           ++ PLD++K  +Q D    P    S  + I  + +++G+   F G   T +  +      
Sbjct: 253 AIYPLDVVKSMIQTDTLRNPRFKNSMKNVINHLYREQGISAFFKGFAPTMLRAAPVNGAT 312

Query: 89  YGGYELFKRL 98
           +  +EL  RL
Sbjct: 313 FVTFELVMRL 322

>KLLA0E18788g complement(1661093..1662238) similar to sp|P38702
           Saccharomyces cerevisiae YHR002w, start by similarity
          Length = 381

 Score = 35.4 bits (80), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 70/344 (20%), Positives = 123/344 (35%), Gaps = 69/344 (20%)

Query: 14  EYYAACTLGGIVACGPTHSSVTPLDLIKCRLQV-DPTL--YRSNTSGI----IQILKKEG 66
           +Y     L G VA     + + PLD IK   Q  +P    Y  +  G+    + I  ++ 
Sbjct: 51  DYILKSGLAGGVAGSCAKTLIAPLDRIKILFQTSNPHYVKYAGSFQGLLNAGVHIWSRDR 110

Query: 67  LGKLFTGVGATCIGYSLQGAGKYGGYELFKRL------YSTHLVKDEATAYKYRTSIYLL 120
           L  +F G  AT +      A K+  YE  + +      Y TH  +             L 
Sbjct: 111 LRGVFQGHSATLLRIFPYAAVKFIAYEQIRNVIIPSKEYETHFRR-------------LC 157

Query: 121 SSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMY---AKEGLN--------- 168
           S + A   +     P + I+V+           V    K++Y   A E L+         
Sbjct: 158 SGSLAGLCSVFCTYPLDLIRVRLAYVTEHHKVRVWPLVKQIYSEPASEALSSKAYVPKWF 217

Query: 169 ----GFYKGITPLWCRQIPYTMCKFTS---FERIVE----AIYARLPTKKSEMSALQ--- 214
                FY+G  P     IPY    F +   F  I+     A Y+ L     +   L+   
Sbjct: 218 AQWCNFYRGYIPTVIGMIPYAGVSFFAHDLFHDILRHPVIAPYSVLRVDDLDADDLKVDV 277

Query: 215 -----------QISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN------ESMNVA 257
                            + G +AG+     ++P +++  ++      N       SM+  
Sbjct: 278 QTTRTGKRIPLNTWAELLAGGLAGMASQTAAYPFEIIRRRLQVGAVTNPLEHKFTSMSEM 337

Query: 258 LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYVGL 301
            K I+   G+ G + GL +  + +  + +  + +Y+  K Y+G+
Sbjct: 338 AKIIFHERGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWYMGI 381

>KLLA0A00979g complement(92561..93592) weakly similar to sp|P38152
           Saccharomyces cerevisiae YBR291c CTP1 citrate transport
           protein, mitochondrial (MCF), start by similarity
          Length = 343

 Score = 35.0 bits (79), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 56/135 (41%), Gaps = 17/135 (12%)

Query: 153 NVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSA 212
           N+    ++M    G   F++G  P   RQ+  +  +FT++  + + I    P        
Sbjct: 192 NIFTTVREMVQTRGFTTFFQGSMPTIFRQVGNSAVRFTTYTTLKQMISPNKP-------- 243

Query: 213 LQQISVSFVGGYMAGILCAIV--SHPADVMVSKINNERK---VNESMNVALKRIYSRIGF 267
              +S  +  G      CA+V  + P DV+ +++ ++        S+N  + R +   G 
Sbjct: 244 ---LSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQSKYTWSLYRNSLN-CVYRTFIEEGL 299

Query: 268 VGLWNGLPVRILMIG 282
             LW G   R+  +G
Sbjct: 300 TSLWKGWVPRLFKVG 314

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 4/87 (4%)

Query: 14  EYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPT--LYRSNTSGIIQILKKEGLGKLF 71
           EYYA   +G   +C    +   P+D++K R+Q   T  LYR++ + + +   +EGL  L+
Sbjct: 246 EYYA-FGIGVFSSCAVV-ALTQPIDVVKTRMQSKYTWSLYRNSLNCVYRTFIEEGLTSLW 303

Query: 72  TGVGATCIGYSLQGAGKYGGYELFKRL 98
            G         L G   +G Y+    L
Sbjct: 304 KGWVPRLFKVGLSGGVSFGVYQYVDNL 330

>KLLA0E02750g 260854..261768 similar to ca|CA6127|IPF149 Candida
           albicans peroxisomal membrane protein (by homology),
           start by similarity
          Length = 304

 Score = 33.5 bits (75), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 7/62 (11%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRL---QVDPTLYRSNTSGIIQILKKEGLGKLFTGVGAT 77
           +G + A G T+  +T    +K R+   Q DP   +S  S I++I+KK+G+  L+ GV   
Sbjct: 206 IGKLAATGTTYPYIT----LKTRMHLMQNDPKHQKSMWSLIVEIVKKDGVSGLYNGVAVK 261

Query: 78  CI 79
            +
Sbjct: 262 LV 263

>YGR257C (MTM1) [2204] chr7 complement(1006210..1007310) Member of
           the mitochondrial carrier family (MCF) of membrane
           transporters [1101 bp, 366 aa]
          Length = 366

 Score = 33.5 bits (75), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 13/97 (13%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQV------DP---TLYRSNTSGIIQILKKEG 66
           +A+  + G++A   TH    P D+ K R Q+      DP      R+    +  I + EG
Sbjct: 272 FASGCISGMIAAICTH----PFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEG 327

Query: 67  LGKLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHL 103
           L  L+TG+ A  I      A     YE+ K+++   L
Sbjct: 328 LAALYTGLAARVIKIRPSCAIMISSYEISKKVFGNKL 364

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 74/210 (35%), Gaps = 57/210 (27%)

Query: 1   MSKTKSPIELYTKEYYAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQ 60
           MS   +   L  KE   +   G ++    T   +TP+D+++ RLQ    +   +  G  +
Sbjct: 1   MSDRNTSNSLTLKERMLSAGAGSVL----TSLILTPMDVVRIRLQQQQMIPDCSCDGAAE 56

Query: 61  ILKKEGLG---KLFTGVGATCIGYSLQGAGKYGGYELFKRLYSTHLVKDEATAYKYRTSI 117
           +      G   K FT VG    G +L  A  +     F+ L+                  
Sbjct: 57  VPNAVSSGSKMKTFTNVG----GQNLNNAKIFWESACFQELH------------------ 94

Query: 118 YLLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPL 177
                           C   ++K           N  +E + K+ + EG+   ++GI+  
Sbjct: 95  ----------------CKNSSLKF----------NGTLEAFTKIASVEGITSLWRGISLT 128

Query: 178 WCRQIPYTMCKFTSFE--RIVEAIYARLPT 205
               IP  M  F+ +E  R V  I +  PT
Sbjct: 129 LLMAIPANMVYFSGYEYIRDVSPIASTYPT 158

 Score = 32.7 bits (73), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 76/192 (39%), Gaps = 23/192 (11%)

Query: 23  GIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII---------QILKKEGLGK-LFT 72
           G +A     +S+ PL+L+K +LQ  P   +S  + ++         Q +K  G  + LF 
Sbjct: 165 GAIARVFAATSIAPLELVKTKLQSIPRSSKSTKTWMMVKDLLNETRQEMKMVGPSRALFK 224

Query: 73  GVGATCIGYSLQGAGKYGGYELFKR---LYSTHLVKDEATAYKYRTSIYLLSSATAEFFA 129
           G+  T        A  +  YEL K    L ST     +A    +  S    S   +   A
Sbjct: 225 GLEITLWRDVPFSAIYWSSYELCKERLWLDSTRFASKDANWVHFINS--FASGCISGMIA 282

Query: 130 DIMLCPFEAIKVKQQTTM-----PPWCN---NVIEGWKKMYAKEGLNGFYKGITPLWCRQ 181
            I   PF+  K + Q +M     P   N   N+ +  + ++  EGL   Y G+     + 
Sbjct: 283 AICTHPFDVGKTRWQISMMNNSDPKGGNRSRNMFKFLETIWRTEGLAALYTGLAARVIKI 342

Query: 182 IPYTMCKFTSFE 193
            P      +S+E
Sbjct: 343 RPSCAIMISSYE 354

>Scas_613.24
          Length = 177

 Score = 32.3 bits (72), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 119 LLSSATAEFFADIMLCPFEAIKVKQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLW 178
           LL+ A A      +  P   +KV+ ++T   +  ++ E  K +Y  EG++GF+KG  P  
Sbjct: 110 LLTGAMARGLVGYITMPITILKVRYESTYYSY-KSMNEAIKDIYKMEGISGFFKGFGPTV 168

Query: 179 CRQIP 183
              IP
Sbjct: 169 GIGIP 173

 Score = 28.1 bits (61), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 25/58 (43%)

Query: 21  LGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGATC 78
           L G +A G       P+ ++K R +     Y+S    I  I K EG+   F G G T 
Sbjct: 111 LTGAMARGLVGYITMPITILKVRYESTYYSYKSMNEAIKDIYKMEGISGFFKGFGPTV 168

>KLLA0E12353g complement(1092303..1093220)
           gi|1351895|sp|P49382|ADT_KLULA Kluyveromyces lactis ADP,
           ATP carrier protein (ADP/ATP translocase) (Adenine
           nucleotide translocator) (ANT), start by similarity
          Length = 305

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 68/162 (41%), Gaps = 13/162 (8%)

Query: 143 QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYAR 202
           +Q ++      ++E +K+  A EG+  F++G T    R  P     F +F+  ++A++  
Sbjct: 46  KQGSLDRRYTGIVECFKRTAADEGVASFWRGNTANVIRYFPTQALNF-AFKDKIKAMFG- 103

Query: 203 LPTKKSEMSA--------LQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESM 254
              KK E  A           ++      ++  +  A     AD   +K   ER+ N  +
Sbjct: 104 --FKKEEGYAKWFAGNLASGGLAGGLSLLFVYSLDYARTRLAADSKSAKKGGERQFNGLV 161

Query: 255 NVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFK 296
           +V  K+  +  G  GL+ G    ++ I       + +YDS K
Sbjct: 162 DV-YKKTLASDGVAGLYRGFLPSVVGIVVYRGLYFGLYDSLK 202

>YNL083W (YNL083W) [4507] chr14 (471377..473014) Member of the
           mitochondrial carrier (MCF) family of membrane
           transporters [1638 bp, 545 aa]
          Length = 545

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 78/198 (39%), Gaps = 28/198 (14%)

Query: 16  YAACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGII-----QILKKEGLGKL 70
           Y A  L G+ A      SV P+D +K R+Q  P   +   + ++      + ++ GL   
Sbjct: 351 YIAGGLAGMAA----QFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLF 406

Query: 71  FTGVGATCIGYSLQGAGKYGGYELFKRLY------STHLVKDEATAYKYRTSIYLLSSAT 124
           + GV    +G     A   G +   K+ Y      + +L +D+ T       + L   A 
Sbjct: 407 YRGVTVGIVGIFPYAALDLGTFSALKKWYIAKQAKTLNLPQDQVT---LSNLVVLPMGAF 463

Query: 125 AEFFADIMLCPFEAIKVK---QQTTMPPWCNNVIEGWK----KMYAKEGLNGFYKGITPL 177
           +      ++ P   ++ +   Q T   P+   V  G+K    K   +EG  G +KG+ P 
Sbjct: 464 SGTVGASVVYPINLLRTRLQAQGTYAHPY---VYNGFKDVLLKTLEREGYQGLFKGLVPT 520

Query: 178 WCRQIPYTMCKFTSFERI 195
             +  P     +  +E +
Sbjct: 521 LAKVCPAVSISYLCYENL 538

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 57/128 (44%), Gaps = 8/128 (6%)

Query: 159 KKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMSALQQISV 218
           K +Y + G+  FY G      +  P +  KF SFE + + I  +L   + +   L + S 
Sbjct: 293 KSLYRQGGIKAFYVGNGLNVIKVFPESSIKFGSFE-VTKKIMTKLEGCR-DTKDLSKFS- 349

Query: 219 SFVGGYMAGILCAIVSHPAD-----VMVSKINNERKVNESMNVALKRIYSRIGFVGLWNG 273
           +++ G +AG+      +P D     V  + ++ + K N  +    K ++   G    + G
Sbjct: 350 TYIAGGLAGMAAQFSVYPIDTLKFRVQCAPLDTKLKGNNLLFQTAKDMFREGGLRLFYRG 409

Query: 274 LPVRILMI 281
           + V I+ I
Sbjct: 410 VTVGIVGI 417

>Sklu_2127.4 , Contig c2127 6322-7293
          Length = 323

 Score = 32.7 bits (73), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 71/172 (41%), Gaps = 19/172 (11%)

Query: 135 PFEAIKVKQQTTMPPWCNNV---IEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTS 191
           P   I  K QT      N V   +E  K++Y K+GL GFY G+              +  
Sbjct: 33  PLVTITTKLQTQGNDENNQVKSKLETIKEIYRKDGLLGFYAGLESAIYGMALTNFVYYYF 92

Query: 192 FERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVN 251
           +E     +      KK  ++ L+    S + G +AG + AI S+P  V     N    V 
Sbjct: 93  YELTSRNVLKVRKHKK--LNTLE----SMLTGCVAGSVTAIASNPIWVA----NTRMTVT 142

Query: 252 ESMNVALK---RIYSRIGFVGLWNGL-PVRILMIGTLTSFQWLIYDSFKAYV 299
           +S   AL     I  +     L+NGL P  +L++  +   Q+ +++  K  V
Sbjct: 143 KSEKTALATIIEIVKKDSAKTLFNGLKPALVLVMNPIV--QYTVFEQLKNLV 192

>YBR085W (AAC3) [275] chr2 (415940..416863) ADP/ATP transporter
           protein, member of the mitochondrial carrier family
           (MCF) of membrane transporters [924 bp, 307 aa]
          Length = 307

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 14  EYYAACTLGGIVACGPTHSSVTPLDLIKCRLQV---DPTLYRSNTSGIIQILKKEGLGKL 70
            + A+  LG +V  G +  S  PLD ++ R+ +       Y      + +I+  EG+G L
Sbjct: 215 SFLASFLLGWVVTTGASTCSY-PLDTVRRRMMMTSGQAVKYNGAIDCLKKIVASEGVGSL 273

Query: 71  FTGVGATCIGYSLQGAG 87
           F G GA  +  S+ GAG
Sbjct: 274 FKGCGANIL-RSVAGAG 289

>Kwal_55.21338
          Length = 323

 Score = 31.2 bits (69), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 68/167 (40%), Gaps = 19/167 (11%)

Query: 17  AACTLGGIVACGPTHSSVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLGKLFTGVGA 76
           A   L G +A     ++  PL +   R+ V  +  R   S I  I+K EG+  LF G+  
Sbjct: 119 AESMLVGSIAGSLNATAANPLWVANTRMTVQKS-DRGTLSTIFDIVKDEGISGLFKGLNP 177

Query: 77  TCIGYSLQGAGKYGGYELFKR-LYSTHLVKDEATAYKYRTSIYLLSSATAEFFADIMLCP 135
             I   +    +Y  YE  K  + S+   +  + ++ +      +  A  +  A     P
Sbjct: 178 ALI-LVINPIIQYTVYEQLKNWILSSRQTRTLSPSWAF------ILGAVGKLAATGSTYP 230

Query: 136 FEAIKV--------KQQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGI 174
           +  +K         K  T  PP   +++    ++  K+G+ G Y+GI
Sbjct: 231 YVTMKARMHLLGEHKSSTAAPP--RSLLSLMAEIIKKDGILGLYRGI 275

 Score = 30.0 bits (66), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 62/150 (41%), Gaps = 26/150 (17%)

Query: 159 KKMYAKEGLNGFYKGITPLW----CRQIPYTMCKFTSFERIVEAIYA-RLPTKKSEMSAL 213
           K +Y K+G  GF+ G+             Y  C   S   ++ A +  RL T +S +   
Sbjct: 67  KDIYRKDGAMGFFAGLESALFGTTLSNFVYYYCYEASSRCVLRARHTQRLTTAESMLV-- 124

Query: 214 QQISVSFVGGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRIYSRI---GFVGL 270
                    G +AG L A  ++P  V     N    V +S    L  I+  +   G  GL
Sbjct: 125 ---------GSIAGSLNATAANPLWVA----NTRMTVQKSDRGTLSTIFDIVKDEGISGL 171

Query: 271 WNGL-PVRILMIGTLTSFQWLIYDSFKAYV 299
           + GL P  IL+I  +   Q+ +Y+  K ++
Sbjct: 172 FKGLNPALILVINPI--IQYTVYEQLKNWI 199

>CAGL0F04213g 419473..420393 highly similar to sp|P18239
           Saccharomyces cerevisiae YBL030c AAC2 ADP/ATP carrier
           protein, hypothetical start
          Length = 306

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 15  YYAACTLGGIVACGPTHSSVTPLDLIKCRLQV---DPTLYRSNTSGIIQILKKEGLGKLF 71
           + A+  LG +V  G + +S  PLD ++ R+ +       Y+     + +I+  EG+  LF
Sbjct: 215 FIASFLLGWVVTTGASTASY-PLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLF 273

Query: 72  TGVGATCIGYSLQGAG 87
            G GA  +   + GAG
Sbjct: 274 KGCGANIL-RGVAGAG 288

>Scas_667.4
          Length = 308

 Score = 29.6 bits (65), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 67/166 (40%), Gaps = 15/166 (9%)

Query: 143 QQTTMPPWCNNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYAR 202
           +Q ++      +IE +++    EG+  F++G T    R  P     F +F+  ++A++  
Sbjct: 49  KQGSLDSKYKGIIECFQRTAKTEGIIAFWRGNTANVIRYFPTQALNF-AFKDKIKAMFGF 107

Query: 203 LPTKKSEMSALQQISVSFVGGYMAGILCAIVSH---------PADVMVSKINNERKVNES 253
               K E    +  + +   G  AG L  +  +          AD   SK    R+    
Sbjct: 108 ----KKEEGYGKWFAGNLASGGAAGGLSLLFVYSLDYARTRLAADAKSSKKGGSRQYKGL 163

Query: 254 MNVALKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIYDSFKAYV 299
           ++V  K+  +  G  GL+ G    ++ I       + +YDS K  V
Sbjct: 164 IDV-YKQTLATDGMAGLYRGFLPSVVGIIVYRGLYFGLYDSLKPAV 208

>KLLA0E22880g complement(2033077..2034387) similar to
           ca|CA2800|IPF11366 Candida albicans unknown function,
           hypothetical start
          Length = 436

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 7/78 (8%)

Query: 203 LPTKKSEMSALQQISVSFV-GGYMAGILCAIVSHPADVMVSKINNERKVNESMNVALKRI 261
            P + ++  A Q     F+  G++AG   AIVS P D + ++ N +  ++ +       +
Sbjct: 147 FPLRATD-QAFQHNMFDFLRAGFLAGAAQAIVSAPIDAIYTRANIDELLSSAKKYDNLWL 205

Query: 262 YSR-----IGFVGLWNGL 274
           YSR     IG +G + G 
Sbjct: 206 YSRDKIREIGLIGCFGGF 223

>Kwal_27.12481
          Length = 304

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 56/132 (42%), Gaps = 13/132 (9%)

Query: 152 NNVIEGWKKMYAKEGLNGFYKGITPLWCRQIPYTMCKFTSFERIVEAIYARLPTKKSEMS 211
           N +++ +KK  A +G+ G Y+G  P     + Y    F  +    +++   L T   E S
Sbjct: 158 NGLVDVYKKTLASDGIAGLYRGFLPSVVGIVVYRGLYFGGY----DSLKPLLLTGSLEGS 213

Query: 212 ALQQISVSFVGGYMAGILCAIVSHPADVMVSKI----NNERKVNESMNVALKRIYSRIGF 267
            L     SF+ G+      +  S+P D +  ++        K N + + A ++I +  G 
Sbjct: 214 FL----ASFLLGWAVTTGASTASYPLDTVRRRMMMTSGQAVKYNGAFD-AFRKIVAAEGI 268

Query: 268 VGLWNGLPVRIL 279
             L+ G    IL
Sbjct: 269 KSLFKGCGANIL 280

>ACL205C [844] [Homologous to ScYPR194C (OPT2) - NSH] (1169..3841)
           [2673 bp, 890 aa]
          Length = 890

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 50/119 (42%), Gaps = 14/119 (11%)

Query: 189 FTSFERIVEAIYARLPTKKSEMSALQQISVSFVGGYMAGILCAIVSHPADVMVSKINNER 248
           + ++  + + I+ R P   +    L  I + F+G  +AGI+   V +PA  M   I    
Sbjct: 252 YANYNILTQHIHYRSPMPYA-YQLLLSIPLQFLGFGLAGIMRKYVVYPATAMWPSIMTTI 310

Query: 249 KVNESMNVA--------LKRIYSRIGFVGLWNGLPVRILMIGTLTSFQWLIY---DSFK 296
            +N++M            K  Y     + ++N  P    +   L++F W+ +   D+F 
Sbjct: 311 ALNKAMMSDEHSGGFGRKKMFYLTFAIIFVYNWFPT--YLFEALSTFNWITWIKPDNFN 367

>YIL116W (HIS5) [2560] chr9 (142925..144082) Histidinol-phosphate
           aminotransferase (imidazole acetol phosphate
           aminotransferase), eighth step in histidine biosynthesis
           pathway [1158 bp, 385 aa]
          Length = 385

 Score = 28.1 bits (61), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 18  ACTLGG---IVACGPTHS------SVTPLDLIKCRLQVDPTLYRSNTSGIIQILKKEGLG 68
           AC + G   I+   PT+S      ++  +++++C L V    ++ +T  ++ ILK + L 
Sbjct: 106 ACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGSFQMDTEAVLTILKNDSLI 165

Query: 69  KLF 71
           KL 
Sbjct: 166 KLM 168

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.322    0.137    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,489,279
Number of extensions: 378526
Number of successful extensions: 1747
Number of sequences better than 10.0: 210
Number of HSP's gapped: 1296
Number of HSP's successfully gapped: 446
Length of query: 305
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 204
Effective length of database: 13,099,691
Effective search space: 2672336964
Effective search space used: 2672336964
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)