Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.4452852828210.0
YER052C (HOM3)52752623450.0
CAGL0J02882g53052922990.0
Sklu_2260.352352921350.0
Kwal_47.1816352253320630.0
KLLA0F27599g52252920450.0
ADL086C55252919420.0
Scas_34.1*2392408111e-106
YDL010W23164790.094
CAGL0D03894g485101790.14
AAL061C420100790.15
CAGL0H01441g42740780.19
ADR116C26177740.43
KLLA0A08844g62171750.43
CAGL0M03377g70673740.68
YHR033W42340720.85
Scas_588.1442353692.1
YML112W (CTK3)29656673.8
KLLA0F25102g43647656.7
CAGL0K03795g129559649.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.44
         (528 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.44                                                          1091   0.0  
YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate ...   907   0.0  
CAGL0J02882g complement(277395..278987) highly similar to sp|P10...   890   0.0  
Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement        827   0.0  
Kwal_47.18163                                                         799   0.0  
KLLA0F27599g 2558178..2559746 highly similar to sp|P10869 Saccha...   792   0.0  
ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH] (533181..53...   752   0.0  
Scas_34.1*                                                            317   e-106
YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted ...    35   0.094
CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces c...    35   0.14 
AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - ...    35   0.15 
CAGL0H01441g complement(140740..142023) highly similar to sp|P32...    35   0.19 
ADR116C [1857] [Homologous to ScYDR486C (VPS60) - SH] (910611..9...    33   0.43 
KLLA0A08844g complement(774642..776507) similar to sp|P22336 Sac...    33   0.43 
CAGL0M03377g complement(385581..387701) highly similar to sp|P32...    33   0.68 
YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with simi...    32   0.85 
Scas_588.14                                                            31   2.1  
YML112W (CTK3) [3859] chr13 (45063..45953) C-terminal domain (RN...    30   3.8  
KLLA0F25102g 2333488..2334798 similar to sp|P06842 Saccharomyces...    30   6.7  
CAGL0K03795g 349549..353436 similar to sp|Q04217 Saccharomyces c...    29   9.8  

>Scas_715.44
          Length = 528

 Score = 1091 bits (2821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/528 (100%), Positives = 528/528 (100%)

Query: 1   MLSPPSNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEG 60
           MLSPPSNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEG
Sbjct: 1   MLSPPSNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEG 60

Query: 61  TTSRLLRCCDLASQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKY 120
           TTSRLLRCCDLASQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKY
Sbjct: 61  TTSRLLRCCDLASQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKY 120

Query: 121 LDASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNATVLD 180
           LDASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNATVLD
Sbjct: 121 LDASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNATVLD 180

Query: 181 NSFYTFLFQAFKEKLQPFIESKERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVAV 240
           NSFYTFLFQAFKEKLQPFIESKERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVAV
Sbjct: 181 NSFYTFLFQAFKEKLQPFIESKERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVAV 240

Query: 241 NADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAKI 300
           NADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAKI
Sbjct: 241 NADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAKI 300

Query: 301 PIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIVV 360
           PIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIVV
Sbjct: 301 PIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIVV 360

Query: 361 INIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVEK 420
           INIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVEK
Sbjct: 361 INIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVEK 420

Query: 421 LRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVI 480
           LRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVI
Sbjct: 421 LRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVI 480

Query: 481 DETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLEQIKRLDL 528
           DETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLEQIKRLDL
Sbjct: 481 DETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLEQIKRLDL 528

>YER052C (HOM3) [1480] chr5 complement(256374..257957) Aspartate
           kinase (L-aspartate 4-P-transferase), catalyzes the
           first step in the common pathway for methionine and
           threonine biosynthesis [1584 bp, 527 aa]
          Length = 527

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/526 (83%), Positives = 478/526 (90%), Gaps = 7/526 (1%)

Query: 3   SPPSNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGTT 62
           S  SNWVVQKFGGTSVGKFPVQIVDDI+K YS P     NNNVAVVCSARSSYTKAEGTT
Sbjct: 9   SSHSNWVVQKFGGTSVGKFPVQIVDDIVKHYSKPDGP--NNNVAVVCSARSSYTKAEGTT 66

Query: 63  SRLLRCCDLASQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYLD 122
           SRLL+CCDLASQE EF DIIEVI+ DHIDNA+R++ +P LQ KL+ DT KEL LVKKYL+
Sbjct: 67  SRLLKCCDLASQESEFQDIIEVIRQDHIDNADRFILNPALQAKLVDDTNKELELVKKYLN 126

Query: 123 ASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNATVLDNS 182
           ASK+LGEVS+RT+DLVMS GEKLSCLFMTAL NDRGCKAKYVDL+HIVPSD++A+ LDNS
Sbjct: 127 ASKVLGEVSSRTVDLVMSCGEKLSCLFMTALCNDRGCKAKYVDLSHIVPSDFSASALDNS 186

Query: 183 FYTFLFQAFKEKLQPFIESKERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVAVNA 242
           FYTFL QA KEKL PF+ +KER++PVFTGFFGLVP GLLNGVGRGYTDLCAALIAVAVNA
Sbjct: 187 FYTFLVQALKEKLAPFVSAKERIVPVFTGFFGLVPTGLLNGVGRGYTDLCAALIAVAVNA 246

Query: 243 DELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAKIPI 302
           DELQVWKEVDGIFTADPRKVP+ARLL SVTPEEASELTYYGSEVIHPFTMEQVI+AKIPI
Sbjct: 247 DELQVWKEVDGIFTADPRKVPEARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIPI 306

Query: 303 RIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIVVIN 362
           RIKNVQNP G GTIIYPDN+AKKGESTPPHPPE LSSSF+E+RKRGATAITTKNDI VIN
Sbjct: 307 RIKNVQNPLGNGTIIYPDNVAKKGESTPPHPPENLSSSFYEKRKRGATAITTKNDIFVIN 366

Query: 363 IHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVEKLR 422
           IHSNKKTLSHGFLAQIFTILDK+KLVVDLISTSEVHVSMALPIPD++S KSLRQA EKLR
Sbjct: 367 IHSNKKTLSHGFLAQIFTILDKYKLVVDLISTSEVHVSMALPIPDADSLKSLRQAEEKLR 426

Query: 423 VLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVIDE 482
           +LG VD+TKK++IVSLVGK MKQ+IGIAGTMFTTLAE+GINIEMISQGANEINISCVI+E
Sbjct: 427 ILGSVDITKKLSIVSLVGKHMKQYIGIAGTMFTTLAEEGINIEMISQGANEINISCVINE 486

Query: 483 TDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLEQIKRLDL 528
           +DS+KALQ IHAKLL     S    T+  FEHAI+ERLEQ+KRL +
Sbjct: 487 SDSIKALQCIHAKLL-----SERTNTSNQFEHAIDERLEQLKRLGI 527

>CAGL0J02882g complement(277395..278987) highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3, hypothetical
           start
          Length = 530

 Score =  890 bits (2299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/529 (80%), Positives = 475/529 (89%), Gaps = 7/529 (1%)

Query: 3   SPPSNWVVQKFGGTSVGKFPVQIVDDIIKFYSDP-SNKTYNNNVAVVCSARSSYTKAEGT 61
           S  SNWVVQKFGGTSVGKFPVQIVD+I+K+YS    +  ++N+VAVVCSARSSYTK EGT
Sbjct: 6   SATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGFDNDVAVVCSARSSYTKQEGT 65

Query: 62  TSRLLRCCDLASQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYL 121
           TSRLL+CCDLASQ+ E++DIIE I+ DH+ NAER+++D  L  KLI DT KEL LV KYL
Sbjct: 66  TSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLEDSPLVAKLIDDTNKELALVDKYL 125

Query: 122 DASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNATVLDN 181
            ASK+LGEVS RTIDLVMS GEKLSCLF+TAL NDRGCKAKYVDL+++VPSDY  T LD 
Sbjct: 126 SASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGCKAKYVDLSNVVPSDYQTTTLDT 185

Query: 182 SFYTFLFQAFKEKLQPFIESKERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVAVN 241
           SFYTFL QA KEKL+PF+ SKER++PVFTGFFG +PMGLLNGVGRGYTDLCAALIAVA+N
Sbjct: 186 SFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPMGLLNGVGRGYTDLCAALIAVALN 245

Query: 242 ADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAKIP 301
           ADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQVI+AKIP
Sbjct: 246 ADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEASELTYYGSEVIHPFTMEQVIRAKIP 305

Query: 302 IRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIVVI 361
           IRIKNVQNP+G GTIIYPDN+AKKGESTPPHPPE LSS+FFE+++RGATAITTKNDIVV+
Sbjct: 306 IRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEALSSTFFEKKRRGATAITTKNDIVVL 365

Query: 362 NIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVEKL 421
           N+HSNKKTLSHGFLAQIFT+LDK+KLVVDLISTSEVHVSMALPIPDS+S K+LR AVEKL
Sbjct: 366 NVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTSEVHVSMALPIPDSDSMKALRSAVEKL 425

Query: 422 RVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVID 481
           + LG VD+ KKM+IVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVID
Sbjct: 426 KPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCVID 485

Query: 482 ETDSLKALQSIHAKLLDAHEASLEEMTTGN--FEHAINERLEQIKRLDL 528
           E DS+KALQSIH KLLD     L E  +G+  FE A++ERLEQIKRL+L
Sbjct: 486 EMDSIKALQSIHKKLLD----ELPENGSGSEQFEKAVDERLEQIKRLNL 530

>Sklu_2260.3 YER052C, Contig c2260 3320-4891 reverse complement
          Length = 523

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/529 (75%), Positives = 456/529 (86%), Gaps = 16/529 (3%)

Query: 6   SNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGTTSRL 65
           SNW+VQKFGGTSVGKFP QIV+ I+K Y+      Y NNVAVVCSARSSYTKAEGTTSRL
Sbjct: 5   SNWIVQKFGGTSVGKFPEQIVEQIVKVYT----TQYENNVAVVCSARSSYTKAEGTTSRL 60

Query: 66  LRCCDLASQ-EMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYLDAS 124
           L  C+LA+  +  F D++++++ DH+ NA+  ++D  LQ KL+ DT  EL LV+KYL AS
Sbjct: 61  LNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKYLSAS 120

Query: 125 KILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT--VLDNS 182
           +ILGEVS+RT+DLVMS GEKLSCLFM AL ND G  A+YVDL+ +VP+DY      LDN+
Sbjct: 121 QILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGSLDNN 180

Query: 183 FYTFLFQAFKEKLQPFIESK---ERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVA 239
           FYTFL  AFKE LQP ++S    + V+PV TGFFGLVPMGLLNGVGRGYTDLCAALIAV 
Sbjct: 181 FYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAALIAVG 240

Query: 240 VNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAK 299
           +NADELQVWKEVDGIFTADPRKVPQARLL+SVTPEEASELTYYGSEVIHPFTMEQVI+AK
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLSSVTPEEASELTYYGSEVIHPFTMEQVIRAK 300

Query: 300 IPIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIV 359
           IPIRIKNVQNP GEGT+IYPDNIAKKGESTPPHPP TL+SSFFE ++RGATAITTKNDIV
Sbjct: 301 IPIRIKNVQNPTGEGTVIYPDNIAKKGESTPPHPPVTLTSSFFETKRRGATAITTKNDIV 360

Query: 360 VINIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVE 419
           V+NIHSNKKTLSHGFLAQIF++LDK+KLVVDLISTSEVHVSMALP+PD+ES ++L+ AVE
Sbjct: 361 VLNIHSNKKTLSHGFLAQIFSVLDKYKLVVDLISTSEVHVSMALPVPDAESSRALKSAVE 420

Query: 420 KLRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 479
           +L  LG +D+TKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQ INIEMISQGANEINISCV
Sbjct: 421 ELNRLGSIDLTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQNINIEMISQGANEINISCV 480

Query: 480 IDETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLEQIKRLDL 528
           IDE DS+KALQSIHAKLLD +  SL+      FEHA+NERLEQIKRLD 
Sbjct: 481 IDEQDSIKALQSIHAKLLDENSGSLD------FEHAVNERLEQIKRLDF 523

>Kwal_47.18163
          Length = 522

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/533 (73%), Positives = 453/533 (84%), Gaps = 17/533 (3%)

Query: 2   LSPPSNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGT 61
           +S  +NW+VQKFGGTSVGKFP QIV++I+K Y+      Y NNVAVVCSARSS TKAEGT
Sbjct: 1   MSSQTNWIVQKFGGTSVGKFPEQIVNEIVKVYT----TKYKNNVAVVCSARSSDTKAEGT 56

Query: 62  TSRLLRCCDL-ASQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKY 120
           TSRLLR CDL  + +  F D+++ ++ DHI NA++ +  P LQ KLI DT  EL LV+KY
Sbjct: 57  TSRLLRACDLVCNSDPAFADVLQKVRDDHISNAKQRITSPDLQQKLIHDTNAELDLVEKY 116

Query: 121 LDASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT--V 178
           L+AS++LGEVS RT+DLVMS GEKLSCLFM AL N+ G +A+YVDL+ ++P DY      
Sbjct: 117 LNASQVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEYGVRAQYVDLSSVIPHDYECRQGT 176

Query: 179 LDNSFYTFLFQAFKEKLQPFIESKER---VIPVFTGFFGLVPMGLLNGVGRGYTDLCAAL 235
           LD SFYTFL +AFKEKL P +E+  +   V+PV TGFFGLVPMGLLNGVGRGYTDLCAAL
Sbjct: 177 LDTSFYTFLVRAFKEKLAPVLEAHSQGTPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 236

Query: 236 IAVAVNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQV 295
           IAV +NADELQVWKEVDGIFTADPRKVPQARLL SVTPEEASELTYYGSEVIHPFTMEQV
Sbjct: 237 IAVGLNADELQVWKEVDGIFTADPRKVPQARLLGSVTPEEASELTYYGSEVIHPFTMEQV 296

Query: 296 IQAKIPIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTK 355
           I+AKIPIRIKNVQNP G+GT+IYPDNIAKKGESTPPHPP TLS+SFFE++KRGATAIT+K
Sbjct: 297 IRAKIPIRIKNVQNPTGDGTVIYPDNIAKKGESTPPHPPVTLSNSFFEQKKRGATAITSK 356

Query: 356 NDIVVINIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLR 415
           +DIVV++IHSNKKTLSHGFLAQIFT LDK+KLVVDLISTSEVHVSMALP+PD +S K+L+
Sbjct: 357 SDIVVVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDLISTSEVHVSMALPVPDVDSSKALK 416

Query: 416 QAVEKLRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN 475
           +AVE+L+VLG V++TKK+ IVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN
Sbjct: 417 KAVEELKVLGAVELTKKLVIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEIN 476

Query: 476 ISCVIDETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLEQIKRLDL 528
           ISCVIDE D+LKALQSIH+KLLD         +      A+NE+LEQIKRL+L
Sbjct: 477 ISCVIDEEDALKALQSIHSKLLDLD-------SDVGLGKAVNEKLEQIKRLEL 522

>KLLA0F27599g 2558178..2559746 highly similar to sp|P10869
           Saccharomyces cerevisiae YER052c HOM3 L-aspartate
           4-P-transferase singleton, start by similarity
          Length = 522

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/529 (72%), Positives = 452/529 (85%), Gaps = 17/529 (3%)

Query: 6   SNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGTTSRL 65
           SNWVVQKFGGTS+GKF  QIV++IIK YS    + Y+NNVAVVCSARSSYTKAEGTTSRL
Sbjct: 5   SNWVVQKFGGTSIGKFSKQIVNEIIKVYS----QEYDNNVAVVCSARSSYTKAEGTTSRL 60

Query: 66  LRCCDLASQE-MEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYLDAS 124
           L  CDLAS    E+ +++++++ DH+ NAE  V+D  +Q  LI DT +E+ +V++YLDAS
Sbjct: 61  LLACDLASNNNYEYKNVLDLVERDHVANAEESVKDITIQETLIEDTKREINIVRRYLDAS 120

Query: 125 KILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT--VLDNS 182
           ++LGEVSTRT+DLVMS+GEKLSCL++TAL  D G  A+YVDL+ IVPSDY      LDNS
Sbjct: 121 QVLGEVSTRTLDLVMSLGEKLSCLYVTALCQDNGVNARYVDLSFIVPSDYECKEGTLDNS 180

Query: 183 FYTFLFQAFKEKLQPFIESKE---RVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVA 239
           FYTFL  AF+EKL P ++  E   ++IPV TGFFG+VPMGLLNGVGRGYTDLCAALIAVA
Sbjct: 181 FYTFLVTAFREKLSPILKETENGTKIIPVITGFFGVVPMGLLNGVGRGYTDLCAALIAVA 240

Query: 240 VNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAK 299
           +NADELQVWKEVDGIFTADPRKVPQARLL +VTP+EA+ELTYYGSEVIHPFTMEQVI+  
Sbjct: 241 LNADELQVWKEVDGIFTADPRKVPQARLLDTVTPDEAAELTYYGSEVIHPFTMEQVIRTH 300

Query: 300 IPIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIV 359
           IPIRIKNVQNP+G GTIIYP + AKKGESTPPHPP  L+SS FE +K+GATAITTK+DIV
Sbjct: 301 IPIRIKNVQNPKGNGTIIYPSDQAKKGESTPPHPPVALTSSIFESKKKGATAITTKSDIV 360

Query: 360 VINIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVE 419
           V+NIHSNKKTLSHGFLA++F+ LDK+KLVVDLISTSEVHVSMALP+PDS+S K+LR AVE
Sbjct: 361 VVNIHSNKKTLSHGFLAEMFSTLDKYKLVVDLISTSEVHVSMALPVPDSDSLKALRCAVE 420

Query: 420 KLRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 479
           +L+ LG VDV KKMAIVSLVGKQMKQF+GIAGTMFTTLAEQ INIEMISQGANEINISCV
Sbjct: 421 ELKRLGTVDVIKKMAIVSLVGKQMKQFVGIAGTMFTTLAEQHINIEMISQGANEINISCV 480

Query: 480 IDETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLEQIKRLDL 528
           IDE+++++ALQSIHAKLLD+ +         NFE A+NERLEQIK++ L
Sbjct: 481 IDESNAVRALQSIHAKLLDSPQNE-------NFESAVNERLEQIKQMSL 522

>ADL086C [1655] [Homologous to ScYER052C (HOM3) - SH]
           (533181..534839) [1659 bp, 552 aa]
          Length = 552

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/529 (71%), Positives = 441/529 (83%), Gaps = 17/529 (3%)

Query: 6   SNWVVQKFGGTSVGKFPVQIVDDIIKFYSDPSNKTYNNNVAVVCSARSSYTKAEGTTSRL 65
           +NWVVQKFGGTS+GKFP  IV+DI+K +S      Y  NVAVVCSARSSYTK+EGTTSRL
Sbjct: 34  TNWVVQKFGGTSIGKFPTNIVNDIVKVFS----HDYGKNVAVVCSARSSYTKSEGTTSRL 89

Query: 66  LRCCDLA-SQEMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKYLDAS 124
           L  CD A S +  F DI+ VI+ DH++NA  +++D  ++ +L+  T  EL  V++YL AS
Sbjct: 90  LMACDAAASYDETFQDIVRVIREDHVENASHHIKDAEIRVRLVEQTNDELDQVERYLQAS 149

Query: 125 KILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT--VLDNS 182
           +ILGEVS RT+DLVMSVGEKLSCLF+TAL  D G  A+YVD + IVP+D+      LDNS
Sbjct: 150 QILGEVSNRTMDLVMSVGEKLSCLFLTALCEDCGVTAEYVDFSSIVPTDFRCAEGSLDNS 209

Query: 183 FYTFLFQAFKEKLQPFIESKE---RVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVA 239
           FY  L  AFKE+L   +++ +   R++PV TGFFGL+PMGLLNGVGRGYTDLCAAL+AVA
Sbjct: 210 FYALLVVAFKERLAQIVQANKEGKRIVPVITGFFGLLPMGLLNGVGRGYTDLCAALVAVA 269

Query: 240 VNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAK 299
           +NADELQVWKEVDGIFTADPRKVPQARLL +VTPEEA+ELTYYGSEVIHPFTMEQVI+AK
Sbjct: 270 LNADELQVWKEVDGIFTADPRKVPQARLLETVTPEEAAELTYYGSEVIHPFTMEQVIRAK 329

Query: 300 IPIRIKNVQNPRGEGTIIYPDNIAKKGESTPPHPPETLSSSFFERRKRGATAITTKNDIV 359
           IPIRIKNVQNP G+GT+IY DNIAKKGESTPPHPP ++SSSFFE+RKRGATAITTKNDIV
Sbjct: 330 IPIRIKNVQNPTGDGTVIYADNIAKKGESTPPHPPISVSSSFFEQRKRGATAITTKNDIV 389

Query: 360 VINIHSNKKTLSHGFLAQIFTILDKFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAVE 419
           V+NIHSNKKTLSHGFLAQIFTILD +KL+VDLISTSEVHVSMALP+PDS+S +SLR AVE
Sbjct: 390 VLNIHSNKKTLSHGFLAQIFTILDNYKLIVDLISTSEVHVSMALPVPDSDSQRSLRNAVE 449

Query: 420 KLRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMISQGANEINISCV 479
           +L+ LG VD+ KKMAIVSLVGKQMK FIGIAG MFTTL+EQ INIEMISQGANEINISCV
Sbjct: 450 ELKKLGTVDLIKKMAIVSLVGKQMKHFIGIAGAMFTTLSEQNINIEMISQGANEINISCV 509

Query: 480 IDETDSLKALQSIHAKLLDAHEASLEEMTTGNFEHAINERLEQIKRLDL 528
           IDE +S++ALQSIHAKLL+     L   ++G     +N RLEQ+K LDL
Sbjct: 510 IDEKNSVRALQSIHAKLLEP----LAPTSSG---AVLNGRLEQLKSLDL 551

>Scas_34.1*
          Length = 239

 Score =  317 bits (811), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 188/240 (78%), Gaps = 7/240 (2%)

Query: 62  TSRLLRCCDLASQ-EMEFNDIIEVIKADHIDNAERYVQDPVLQTKLIADTTKELTLVKKY 120
           TSRLL  C+LA+  +  F D++++++ DH+ NA+  ++D  LQ KL+ DT  EL LV+KY
Sbjct: 1   TSRLLNACELAANNDPTFTDVLQLVRNDHVSNAQEKIKDSTLQQKLVKDTNAELDLVEKY 60

Query: 121 LDASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT--V 178
           L AS+ILGEVS+RT+DLVMS GEKLSCLFM AL ND G  A+YVDL+ +VP+DY      
Sbjct: 61  LSASQILGEVSSRTMDLVMSCGEKLSCLFMAALCNDLGVPAQYVDLSFVVPTDYECKDGS 120

Query: 179 LDNSFYTFLFQAFKEKLQPFIESK---ERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAAL 235
           LDN+FYTFL  AFKE LQP ++S    + V+PV TGFFGLVPMGLLNGVGRGYTDLCAAL
Sbjct: 121 LDNNFYTFLVNAFKEALQPVLKSHSIGKPVVPVITGFFGLVPMGLLNGVGRGYTDLCAAL 180

Query: 236 IAVAVNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQV 295
           IAV +NADELQVWKEVDGIFTADPR+  +   L+SVTPE A  LTYYGS VIHPFTMEQV
Sbjct: 181 IAVGLNADELQVWKEVDGIFTADPRRFLKQDCLSSVTPERAL-LTYYGSGVIHPFTMEQV 239

>YDL010W (YDL010W) [848] chr4 (432327..433022) Protein predicted to
           have structural similarity to disulfide oxidoreductases
           [696 bp, 231 aa]
          Length = 231

 Score = 35.0 bits (79), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 200 ESKERVIPVFTGFFGLVPMGLLNGVGRGYTDLCAALIAVAVNADELQVWKEVDGIFTADP 259
           E  +  I + TG  G VP  L+NGV RG  +    L       + LQVW   DG F+ + 
Sbjct: 168 EELQEYIKLVTGR-GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWS--DGKFSVEQ 224

Query: 260 RKVP 263
           R+ P
Sbjct: 225 REKP 228

>CAGL0D03894g 389509..390966 similar to sp|P32264 Saccharomyces
           cerevisiae YDR300c PRO1 or sp|P38690 Saccharomyces
           cerevisiae YHR033w, hypothetical start
          Length = 485

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 19/101 (18%)

Query: 184 YTFLFQAFKEKLQPFIESKERVIPVFTGF-------FGLVPMGLLNGVGR---------- 226
           ++ LFQ + EK+   + ++  ++  +T +         L+ MG++  V            
Sbjct: 86  WSMLFQQYGEKIAQILITRNDILG-WTQYKNAQNTILQLLEMGVVPIVNENDTLSISEIK 144

Query: 227 -GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQAR 266
            G  D  +A+ A  V+AD L +  +VD ++T +PR  P A+
Sbjct: 145 FGDNDTLSAITAALVSADHLFLLTDVDCLYTENPRTNPDAK 185

>AAL061C [126] [Homologous to ScYDR300C (PRO1) - SH; ScYHR033W - SH]
           (239518..240780) [1263 bp, 420 aa]
          Length = 420

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 17/100 (17%)

Query: 184 YTFLFQAFKEKLQPFIESKERVIP------VFTGFFGLVPMGL-----------LNGVGR 226
           +  LF+ F EK+   + ++  ++           F  L+ MG+           ++GV  
Sbjct: 91  WDSLFRPFNEKIAQILLTRNDIVDWSQYKNAQNTFHELLAMGVTPIVNENDTLSISGVKF 150

Query: 227 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQAR 266
           G  D  +A+ A  + AD L +  +VD ++T +PR  P A+
Sbjct: 151 GDNDTLSAITAGLIGADYLFLMTDVDCLYTDNPRTNPDAK 190

>CAGL0H01441g complement(140740..142023) highly similar to sp|P32264
           Saccharomyces cerevisiae YDR300c PRO1 glutamate
           5-kinase, hypothetical start
          Length = 427

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 227 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQAR 266
           G  D  +A+ A  ++AD L +  +VD ++TADPR  P A+
Sbjct: 154 GDNDTLSAITAGLIHADYLFLLTDVDCLYTADPRSDPDAK 193

>ADR116C [1857] [Homologous to ScYDR486C (VPS60) - SH]
           (910611..911396) [786 bp, 261 aa]
          Length = 261

 Score = 33.1 bits (74), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/77 (22%), Positives = 42/77 (54%)

Query: 408 SESHKSLRQAVEKLRVLGHVDVTKKMAIVSLVGKQMKQFIGIAGTMFTTLAEQGINIEMI 467
           ++++K+LRQ  +++ V     +  +MA +   G++++Q + + GT    ++E  ++ E+ 
Sbjct: 158 AQTNKALRQQYKQINVERLQTMQDEMADLMEQGEELQQVLAMGGTEIDDISESELDAELE 217

Query: 468 SQGANEINISCVIDETD 484
           + G  E++     D  D
Sbjct: 218 ALGDGELDFGAEADPVD 234

>KLLA0A08844g complement(774642..776507) similar to sp|P22336
           Saccharomyces cerevisiae YAR007c RFA1 DNA replication
           factor A, 69 KD subunit singleton, start by similarity
          Length = 621

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 259 PRKVPQARLLASVTPEEASELTYYGSEVIHPFTMEQVIQAKIPIR--IKNVQNPRGEGTI 316
           PR VP+A+   S      +    +  E I P+     I+A++  +  +K  QN RGEG I
Sbjct: 169 PRSVPKAK---SNNGSSQNSRPIFAIEQISPYQNNWTIKARVSFKGDLKKWQNNRGEGHI 225

Query: 317 IYPDNIAKKGE 327
           +  + +   GE
Sbjct: 226 LNVNLLDSSGE 236

>CAGL0M03377g complement(385581..387701) highly similar to sp|P32775
           Saccharomyces cerevisiae YEL011w GLC3, hypothetical
           start
          Length = 706

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 384 KFKLVVDLISTSEVHVSMALPIPDSESHKSLRQAV-EKLRVLGHVDVTKKMAIV-----S 437
           KF L  D I   E H+ ++ P P   S+K   Q V  +++ LG+ D  + MAI+     +
Sbjct: 188 KFNLANDSIKIYEAHIGISSPEPKVASYKEFTQNVLPRIKHLGY-DAIQLMAIMEHAYYA 246

Query: 438 LVGKQMKQFIGIA 450
             G Q+  F  I+
Sbjct: 247 SFGYQVTNFFAIS 259

>YHR033W (YHR033W) [2320] chr8 (175540..176811) Protein with
           similarity to Pro1p [1272 bp, 423 aa]
          Length = 423

 Score = 32.3 bits (72), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 227 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQAR 266
           G  D  +A+ A  V AD L +  +VD ++T +PR  P AR
Sbjct: 148 GDNDTLSAITAALVGADFLFLLTDVDCLYTDNPRTNPDAR 187

>Scas_588.14
          Length = 423

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 227 GYTDLCAALIAVAVNADELQVWKEVDGIFTADPRKVPQARLLASVTPEEASEL 279
           G  D  +A+ +  V AD L +  +VD ++T +PR  P+A+ +  V P+ A  L
Sbjct: 150 GDNDTLSAITSALVGADYLFLLTDVDCLYTDNPRTNPEAKPIL-VVPDLAKGL 201

>YML112W (CTK3) [3859] chr13 (45063..45953) C-terminal domain (RNA
           polymerase II CTD) kinase gamma subunit, associates with
           Ctk1p and Ctk2p [891 bp, 296 aa]
          Length = 296

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 122 DASKILGEVSTRTIDLVMSVGEKLSCLFMTALLNDRGCKAKYVDLTHIVPSDYNAT 177
           + +K+L EV    IDLV  +   L C    +L N   CK  ++DL+ ++   Y+AT
Sbjct: 101 NVTKVLNEVLLMDIDLVFELC--LPCQDWKSLTNQATCKELFLDLSKLIH--YDAT 152

>KLLA0F25102g 2333488..2334798 similar to sp|P06842 Saccharomyces
           cerevisiae YFL026w STE2 pheromone alpha-factor receptor
           singleton, start by similarity
          Length = 436

 Score = 29.6 bits (65), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 9   VVQKFGGTSVGKFPVQIVDDIIKFYSDPSNK--TYNNNVAVVCSARS 53
           V   FG  +V  + +  +  II  Y  P NK  TY  N+AV+  A S
Sbjct: 169 VSASFGAATVAMWMITAIKSIIVVYDSPLNKVDTYYYNIAVILLACS 215

>CAGL0K03795g 349549..353436 similar to sp|Q04217 Saccharomyces
           cerevisiae YMR128w ECM16, start by similarity
          Length = 1295

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 388 VVDLISTSEVHVSMALPIPDSESHKSLRQAVEKLRVLGHVDVTKKMAIVSLVGKQMKQF 446
           VV  + +  +H  +  P P     +SL++A+E L+ LG +D  +K   V+  GK+M  F
Sbjct: 885 VVLQMKSMAIHNIVNFPFPTPPDKESLKKAIELLQYLGALDDKEK---VTEDGKKMSLF 940

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,528,238
Number of extensions: 696177
Number of successful extensions: 2405
Number of sequences better than 10.0: 30
Number of HSP's gapped: 2438
Number of HSP's successfully gapped: 30
Length of query: 528
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 422
Effective length of database: 12,926,601
Effective search space: 5455025622
Effective search space used: 5455025622
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 64 (29.3 bits)