Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.28d95953919e-51
Sklu_2174.593862112e-23
KLLA0E04389g91892042e-22
Kwal_47.1814299942033e-22
CAGL0J02794g103771922e-20
YER048W-A94871894e-20
ADL113C108831766e-18
YMR246W (FAA4)69451630.55
CAGL0I09878g69652601.4
KLLA0D15158g66658582.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.28d
         (95 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.28d                                                          155   9e-51
Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement       86   2e-23
KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyce...    83   2e-22
Kwal_47.18142                                                          83   3e-22
CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237 S...    79   2e-20
YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of un...    77   4e-20
ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)...    72   6e-18
YMR246W (FAA4) [4202] chr13 (759806..761890) Acyl-CoA synthase (...    29   0.55 
CAGL0I09878g 943496..945586 highly similar to sp|P30624 Saccharo...    28   1.4  
KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces...    27   2.7  

>Scas_715.28d
          Length = 95

 Score =  155 bits (391), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 80/95 (84%), Positives = 80/95 (84%)

Query: 1  MPATPSRLQVLSLYKXXXXXXXXXXXXXXXEYFLRISREKFKENAPIQDKEKVAKLYEAA 60
          MPATPSRLQVLSLYK               EYFLRISREKFKENAPIQDKEKVAKLYEAA
Sbjct: 1  MPATPSRLQVLSLYKQFIRNSNQFNNFNFREYFLRISREKFKENAPIQDKEKVAKLYEAA 60

Query: 61 QRDLGVLKRQKLISQMYTFDKLVVESAKDQGDSRS 95
          QRDLGVLKRQKLISQMYTFDKLVVESAKDQGDSRS
Sbjct: 61 QRDLGVLKRQKLISQMYTFDKLVVESAKDQGDSRS 95

>Sklu_2174.5 YER048W-A, Contig c2174 5568-5849 reverse complement
          Length = 93

 Score = 85.9 bits (211), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 56/86 (65%), Gaps = 1/86 (1%)

Query: 1  MPAT-PSRLQVLSLYKXXXXXXXXXXXXXXXEYFLRISREKFKENAPIQDKEKVAKLYEA 59
          M AT P+R QVL+LY+               EYFLR +R  FKE+  +QD  KV   +E 
Sbjct: 1  MTATVPTRPQVLALYRQFVKNANNFNNYNFREYFLRKARTTFKESKQLQDSTKVNAAWEE 60

Query: 60 AQRDLGVLKRQKLISQMYTFDKLVVE 85
          AQR+LGVLKRQ +ISQMYTFDKLVVE
Sbjct: 61 AQRELGVLKRQSVISQMYTFDKLVVE 86

>KLLA0E04389g 403312..403587 similar to sgd|S0007237 Saccharomyces
          cerevisiae YER048wa, start by similarity
          Length = 91

 Score = 83.2 bits (204), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 57/89 (64%), Gaps = 1/89 (1%)

Query: 1  MPAT-PSRLQVLSLYKXXXXXXXXXXXXXXXEYFLRISREKFKENAPIQDKEKVAKLYEA 59
          MPAT  S+ Q+L +YK               EYFLR +RE F+ N  +++ EK+++L   
Sbjct: 1  MPATGASKTQILHMYKEFIRNASKIQNYNFREYFLRRARESFRANKNVENPEKISELLSE 60

Query: 60 AQRDLGVLKRQKLISQMYTFDKLVVESAK 88
          A++DLGVLKRQ +IS MYTFDKLVVE  K
Sbjct: 61 AEKDLGVLKRQSVISNMYTFDKLVVEPLK 89

>Kwal_47.18142
          Length = 99

 Score = 82.8 bits (203), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 55/94 (58%)

Query: 2  PATPSRLQVLSLYKXXXXXXXXXXXXXXXEYFLRISREKFKENAPIQDKEKVAKLYEAAQ 61
          PA P+R QVL+LYK               EYFLR +R  F+E+  + D   V   +E A 
Sbjct: 4  PAGPTRAQVLALYKQFIKNANGFNNYNYREYFLRKARTTFREHKTLTDPASVETAWEIAN 63

Query: 62 RDLGVLKRQKLISQMYTFDKLVVESAKDQGDSRS 95
          ++LGVLKRQ +ISQMYTFDK VVE    + +SR 
Sbjct: 64 KELGVLKRQSVISQMYTFDKQVVEPLDRKHNSRG 97

>CAGL0J02794g 272273..272584 similar to gi|6320889|sgd|S0007237
          Saccharomyces cerevisiae YER048wa, hypothetical start
          Length = 103

 Score = 78.6 bits (192), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 40/77 (51%), Positives = 48/77 (62%)

Query: 6  SRLQVLSLYKXXXXXXXXXXXXXXXEYFLRISREKFKENAPIQDKEKVAKLYEAAQRDLG 65
          +R QVL LYK               EYFLR +R +FK N  + D  K+  L++ AQRDLG
Sbjct: 3  ARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALTDAAKIESLFQGAQRDLG 62

Query: 66 VLKRQKLISQMYTFDKL 82
          VLKRQ +ISQMYTFDKL
Sbjct: 63 VLKRQSIISQMYTFDKL 79

>YER048W-A (YER048W-A) [1476] chr5 (250717..251001) Protein of
          unknown function [285 bp, 94 aa]
          Length = 94

 Score = 77.4 bits (189), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 1  MPA--TPSRLQVLSLYKXXXXXXXXXXXXXXXEYFLRISREKFKENAPIQDKEKVAKLYE 58
          MP    P+R QVLSLYK               EYFL  +R  F++N   QD + +  L++
Sbjct: 1  MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFK 60

Query: 59 AAQRDLGVLKRQKLISQMYTFDKLVVE 85
           A+ DLGVLKRQ +ISQMYTFD+LVVE
Sbjct: 61 EAKNDLGVLKRQSVISQMYTFDRLVVE 87

>ADL113C [1628] [Homologous to ScYER048W-A - SH] (486497..486823)
           [327 bp, 108 aa]
          Length = 108

 Score = 72.4 bits (176), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 38/83 (45%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 3   ATPSRLQVLSLYKXXXXXXXXXXXXXXXEYFLRISREKFKENAPIQDKEKVAKLYEAAQR 62
           A P+R  VL LY+               EYF+R SR+ F+++      E++ +L+E AQ+
Sbjct: 23  AGPTRAGVLHLYREFVRSARQFNNYNFREYFMRHSRDTFRKHREA-SGEELQQLWERAQQ 81

Query: 63  DLGVLKRQKLISQMYTFDKLVVE 85
           ++GVLKRQ +ISQMYTFDKLVVE
Sbjct: 82  EVGVLKRQSVISQMYTFDKLVVE 104

>YMR246W (FAA4) [4202] chr13 (759806..761890) Acyl-CoA synthase
           (long-chain fatty acid CoA ligase); contributes to
           activation of imported myristate [2085 bp, 694 aa]
          Length = 694

 Score = 28.9 bits (63), Expect = 0.55,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 4/51 (7%)

Query: 44  NAPI--QDKEKVAKLYEAAQRDLGVLKRQKLISQMYTFDKLVV--ESAKDQ 90
           N PI   DK +  KLY+AA+  +  +K  +   ++Y+FD+++   + AKD+
Sbjct: 203 NEPIDPSDKRQNGKLYKAAKDAVDKIKEVRPDIKIYSFDEIIEIGKKAKDE 253

>CAGL0I09878g 943496..945586 highly similar to sp|P30624
           Saccharomyces cerevisiae YOR317w FAA1 or sp|P47912
           Saccharomyces cerevisiae YMR246w FAA4 or sp|P39002
           Saccharomyces cerevisiae YIL009w FAA3, hypothetical
           start
          Length = 696

 Score = 27.7 bits (60), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 28/52 (53%)

Query: 41  FKENAPIQDKEKVAKLYEAAQRDLGVLKRQKLISQMYTFDKLVVESAKDQGD 92
           + +N   +DK +  KLY  AQ  +  +K  +   ++ +FD+L+    K +G+
Sbjct: 201 YYDNISAEDKRQGGKLYREAQEAVDKIKEVRPDIKLVSFDELLELGQKAKGE 252

>KLLA0D15158g 1281895..1283895 similar to sp|P53038 Saccharomyces
          cerevisiae YGR099w TEL2 involved in controlling
          telomere length and position effect singleton, start by
          similarity
          Length = 666

 Score = 26.9 bits (58), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 37 SREKFKENAPIQDKEKVAKLYEAAQRDLGVLKRQKLISQMYTFDKLVVESAKDQGDSR 94
          S+++   N  +   + V  +Y +  R+L +  R +L    Y F  LV+E AK+ G +R
Sbjct: 27 SKKQHSSNEILPIIKNVVPIYPSLPRELKMALR-RLCGNNYIFISLVIEYAKELGKNR 83

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.131    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 2,266,185
Number of extensions: 66659
Number of successful extensions: 229
Number of sequences better than 10.0: 14
Number of HSP's gapped: 228
Number of HSP's successfully gapped: 14
Length of query: 95
Length of database: 16,596,109
Length adjustment: 66
Effective length of query: 29
Effective length of database: 14,311,321
Effective search space: 415028309
Effective search space used: 415028309
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (25.4 bits)