Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_715.27d1741749111e-127
KLLA0E04477g1551283632e-44
Kwal_47.181531711373582e-43
ADL117W1731163191e-37
CAGL0J02838g1601153172e-37
YER050C (RSM18)2021192882e-32
Kwal_23.6394137444632.4
Kwal_8.59962646622.9
Kwal_14.71676746623.4
ADL033W191638598.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_715.27d
         (174 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_715.27d                                                          355   e-127
KLLA0E04477g complement(409814..410281) some similarities with s...   144   2e-44
Kwal_47.18153                                                         142   2e-43
ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH] complement...   127   1e-37
CAGL0J02838g complement(275124..275606) similar to sp|P40033 Sac...   126   2e-37
YER050C (RSM18) [1478] chr5 complement(253970..254578) Component...   115   2e-32
Kwal_23.6394                                                           29   2.4  
Kwal_8.599                                                             28   2.9  
Kwal_14.716                                                            28   3.4  
ADL033W [1709] [Homologous to ScYLR305C (STT4) - SH] complement(...    27   8.1  

>Scas_715.27d
          Length = 174

 Score =  355 bits (911), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 174/174 (100%), Positives = 174/174 (100%)

Query: 1   MMINTFTRVRKIPFSPRQLRSSFHTSGQCCAAKGLLQPTIKKNINLRESQAKSKTNSSVK 60
           MMINTFTRVRKIPFSPRQLRSSFHTSGQCCAAKGLLQPTIKKNINLRESQAKSKTNSSVK
Sbjct: 1   MMINTFTRVRKIPFSPRQLRSSFHTSGQCCAAKGLLQPTIKKNINLRESQAKSKTNSSVK 60

Query: 61  AIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSLIGTSKTYNISYNINPLDLYSSPSEL 120
           AIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSLIGTSKTYNISYNINPLDLYSSPSEL
Sbjct: 61  AIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSLIGTSKTYNISYNINPLDLYSSPSEL 120

Query: 121 NKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSKTHKHVDALPRRSL 174
           NKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSKTHKHVDALPRRSL
Sbjct: 121 NKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSKTHKHVDALPRRSL 174

>KLLA0E04477g complement(409814..410281) some similarities with
           sp|P40033 Saccharomyces cerevisiae YER050c RSM18
           component of the mitochondrial ribosomal small subunit
           singleton, hypothetical start
          Length = 155

 Score =  144 bits (363), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 97/128 (75%), Gaps = 1/128 (0%)

Query: 46  LRESQAKSKTNSSVKAIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSLIGTSKTYNIS 105
           L+E  +++ +  ++K ++   +K FQ GS+Y+PFDFS+ +++LD+K     G+   +N  
Sbjct: 25  LKEGMSEANSKPTIKKLESKLIKNFQPGSVYNPFDFSLERIHLDKKFGVRPGSFDPFN-K 83

Query: 106 YNINPLDLYSSPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSKTHKH 165
             INPLDLY++P  L++F++STGKILHRDVTGLSAKNQRRL+KAIKR Q+IGL+SK HK 
Sbjct: 84  LKINPLDLYTNPEFLSRFVTSTGKILHRDVTGLSAKNQRRLTKAIKRCQAIGLMSKVHKD 143

Query: 166 VDALPRRS 173
           +  LP+R+
Sbjct: 144 ISVLPQRT 151

>Kwal_47.18153
          Length = 171

 Score =  142 bits (358), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 101/137 (73%), Gaps = 2/137 (1%)

Query: 36  LQPTIKKNINLRESQAKSKTNSSVKAIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSL 95
           L P  K  IN++  ++ S + S  K ID   VKKFQ G+ YDPFDFS+A+++LD+K  S 
Sbjct: 32  LTPNEKSQINVKAKESGS-SASQNKKIDPRLVKKFQSGTTYDPFDFSLARLHLDKKFSSK 90

Query: 96  IGTSKTYNISYNINPLDLYSSPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQS 155
             ++  +  +  ++PLDLY++P  L++F++S+GKILHRDVTGLSAKNQRRLSKAI+R Q+
Sbjct: 91  NSSNDLFEKN-GVDPLDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQA 149

Query: 156 IGLLSKTHKHVDALPRR 172
           IGL+SKTH+ V  LP R
Sbjct: 150 IGLMSKTHRDVSFLPSR 166

>ADL117W [1624] [Homologous to ScYER050C (RSM18) - SH]
           complement(480459..480980) [522 bp, 173 aa]
          Length = 173

 Score =  127 bits (319), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 88/116 (75%), Gaps = 5/116 (4%)

Query: 56  NSSVKAIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSLIGTSKTYNI--SYNINPLDL 113
           N  VK +    +KKF  GS+YDPFDFSMA+++L++K +     ++  +I    N++PLDL
Sbjct: 53  NDQVKKVPPEMMKKFATGSLYDPFDFSMARLHLEKKHRK---NARKVDIFEELNLDPLDL 109

Query: 114 YSSPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSKTHKHVDAL 169
           Y+SP+ L++F+ +TGKILHRDVTGLS ++Q+R+S+A++R Q+IGL+SKTHK V  L
Sbjct: 110 YTSPAILSRFVGNTGKILHRDVTGLSVRSQKRMSRAVRRCQAIGLMSKTHKDVSLL 165

>CAGL0J02838g complement(275124..275606) similar to sp|P40033
           Saccharomyces cerevisiae YER050c RSM18, hypothetical
           start
          Length = 160

 Score =  126 bits (317), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 83/115 (72%)

Query: 55  TNSSVKAIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSLIGTSKTYNISYNINPLDLY 114
           +  ++K I+  FV +FQ+ ++YDPFDFS++++NLDRK              Y +NPL+ Y
Sbjct: 45  SRENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLNFY 104

Query: 115 SSPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSKTHKHVDAL 169
           + P  L+ ++ STGKILHRDVTGLSAKNQRR++KAI+R Q+IGL+SKTH+  + L
Sbjct: 105 ARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHRFTNFL 159

>YER050C (RSM18) [1478] chr5 complement(253970..254578) Component of
           the mitochondrial ribosomal small subunit [609 bp, 202
           aa]
          Length = 202

 Score =  115 bits (288), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 84/119 (70%), Gaps = 5/119 (4%)

Query: 41  KKNINLRESQAKSKTNSSVKAIDEVFVKKFQQGSIYDPFDFSMAKVNLDRKTKSLIGTSK 100
           KK++N+   + +       K ID+   KK  +G+IYDPFDFSM +++LDRK ++   +++
Sbjct: 89  KKSVNIEMGRTQQ-----TKKIDQSLSKKLPKGTIYDPFDFSMGRIHLDRKYQANKNSNR 143

Query: 101 TYNISYNINPLDLYSSPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLL 159
              +    NPL+ Y+ P  L+++++STG+I HRD+TGLSAKNQRRLSKAI+R Q+IGL+
Sbjct: 144 NDIMKSGANPLEFYARPRILSRYVTSTGRIQHRDITGLSAKNQRRLSKAIRRCQAIGLM 202

>Kwal_23.6394
          Length = 1374

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 10/44 (22%), Positives = 25/44 (56%)

Query: 1   MMINTFTRVRKIPFSPRQLRSSFHTSGQCCAAKGLLQPTIKKNI 44
           ++  T+  V K+P+S + + S ++ +  C    G+L+   +K++
Sbjct: 647 LLSGTYDFVEKVPYSVKLMASEWYLNLICSPVDGMLRSVARKDV 690

>Kwal_8.599
          Length = 626

 Score = 28.5 bits (62), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 116 SPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSK 161
           S S + +  S +GK+L +D   L + N RR+     R +S GL ++
Sbjct: 552 STSGVERLFSISGKVLSKDRRSLHSDNTRRIMLMRNRFKSFGLFNR 597

>Kwal_14.716
          Length = 767

 Score = 28.5 bits (62), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 116 SPSELNKFISSTGKILHRDVTGLSAKNQRRLSKAIKRAQSIGLLSK 161
           S S + +  S +GK+L +D   L + N RR+     R +S GL ++
Sbjct: 693 STSGVERLFSISGKVLSKDRRSLHSDNTRRIMLMRNRFKSFGLFNR 738

>ADL033W [1709] [Homologous to ScYLR305C (STT4) - SH]
           complement(636325..642075) [5751 bp, 1916 aa]
          Length = 1916

 Score = 27.3 bits (59), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 87  NLDRKTKSL-----IGTSKTYNISYNINPLDLYSSPSE 119
           NLDR T+SL       TSK Y I   +N L++  S SE
Sbjct: 44  NLDRITRSLPVAYSADTSKLYTIPLTVNELEILLSVSE 81

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.130    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,262,112
Number of extensions: 212868
Number of successful extensions: 796
Number of sequences better than 10.0: 28
Number of HSP's gapped: 791
Number of HSP's successfully gapped: 28
Length of query: 174
Length of database: 16,596,109
Length adjustment: 95
Effective length of query: 79
Effective length of database: 13,307,399
Effective search space: 1051284521
Effective search space used: 1051284521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 58 (26.9 bits)