Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_712.2182882839470.0
CAGL0C02145g77777318720.0
YFR040W (SAP155)100274718810.0
Kwal_47.1919179078418450.0
AFR245W89990317720.0
Sklu_2433.1791469317280.0
KLLA0A01155g99363516160.0
Scas_687.1995654910141e-123
KLLA0F14124g11005998791e-103
YGL229C (SAP4)8185388441e-100
AFR089W10316228284e-96
CAGL0L03586g11236008281e-95
Scas_711.22*10186058092e-93
YKR028W (SAP190)10986027771e-88
Kwal_26.73467475307424e-86
YJL098W (SAP185)10583196024e-65
Scas_675.365573373432e-33
Kwal_26.734328262740.69
CAGL0J00693g1884211722.3
KLLA0E05247g109899694.1
KLLA0C07128g106671694.5
Sklu_2186.2822132685.3
CAGL0L03047g715141669.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_712.21
         (828 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_712.21                                                          1524   0.0  
CAGL0C02145g complement(216905..219238) similar to sp|P43612 Sac...   725   0.0  
YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated p...   729   0.0  
Kwal_47.19191                                                         715   0.0  
AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C...   687   0.0  
Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement     670   0.0  
KLLA0A01155g complement(104687..107668) some similarities with s...   627   0.0  
Scas_687.19                                                           395   e-123
KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces...   343   e-103
YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of th...   329   e-100
AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W...   323   4e-96
CAGL0L03586g complement(408095..411466) similar to sp|P40856 Sac...   323   1e-95
Scas_711.22*                                                          316   2e-93
YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that asso...   303   1e-88
Kwal_26.7346                                                          290   4e-86
YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that asso...   236   4e-65
Scas_675.36                                                           136   2e-33
Kwal_26.7343                                                           33   0.69 
CAGL0J00693g complement(61246..66900) similar to sp|P08964 Sacch...    32   2.3  
KLLA0E05247g complement(472583..475879) similar to sp|Q12749 Sac...    31   4.1  
KLLA0C07128g 617725..620925 weakly similar to sp|Q03660 Saccharo...    31   4.5  
Sklu_2186.2 YHR028C, Contig c2186 1993-4461 reverse complement         31   5.3  
CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces c...    30   9.5  

>Scas_712.21
          Length = 828

 Score = 1524 bits (3947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 761/828 (91%), Positives = 761/828 (91%)

Query: 1   MSFWPFPQDSTSNVSKILDEYFDILNSLRKANLIEDDDNDVPLRGEEQIHDSYGSSKFQP 60
           MSFWPFPQDSTSNVSKILDEYFDILNSLRKANLIEDDDNDVPLRGEEQIHDSYGSSKFQP
Sbjct: 1   MSFWPFPQDSTSNVSKILDEYFDILNSLRKANLIEDDDNDVPLRGEEQIHDSYGSSKFQP 60

Query: 61  XXXXXXXXXXXXXLAVTSEESSCDRDTEXXXXXXXXXXXXXXXXXFIERILDELDLMDEL 120
                        LAVTSEESSCDRDTE                 FIERILDELDLMDEL
Sbjct: 61  RKHKHRTRKRKRKLAVTSEESSCDRDTESKKSNDVVVSKVSLDNSFIERILDELDLMDEL 120

Query: 121 GKKNNVLLDFLCFGYFFDSDSKKIMNMQYLIDQLISCVQYLTNASITSVDEDKANDNMRS 180
           GKKNNVLLDFLCFGYFFDSDSKKIMNMQYLIDQLISCVQYLTNASITSVDEDKANDNMRS
Sbjct: 121 GKKNNVLLDFLCFGYFFDSDSKKIMNMQYLIDQLISCVQYLTNASITSVDEDKANDNMRS 180

Query: 181 QEGPNFLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLK 240
           QEGPNFLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLK
Sbjct: 181 QEGPNFLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLK 240

Query: 241 VNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLD 300
           VNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLD
Sbjct: 241 VNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLD 300

Query: 301 DQRVIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLLSRALASPDV 360
           DQRVIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLLSRALASPDV
Sbjct: 301 DQRVIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLLSRALASPDV 360

Query: 361 VDHLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYL 420
           VDHLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYL
Sbjct: 361 VDHLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYL 420

Query: 421 LKKFSDKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMG 480
           LKKFSDKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMG
Sbjct: 421 LKKFSDKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMG 480

Query: 481 LMNSKRAEHIALKRDHLRLQLPHQLQDALQDLEINKTEHXXXXXXXXXXXXXLTTGSVTD 540
           LMNSKRAEHIALKRDHLRLQLPHQLQDALQDLEINKTEH             LTTGSVTD
Sbjct: 481 LMNSKRAEHIALKRDHLRLQLPHQLQDALQDLEINKTEHSDIISDNNSINNDLTTGSVTD 540

Query: 541 EDEDVLIENVSEHPERSFXXXXXXXXXXXXXVAEIDDSFEIPYINEKQNSKLRNGPTIGD 600
           EDEDVLIENVSEHPERSF             VAEIDDSFEIPYINEKQNSKLRNGPTIGD
Sbjct: 541 EDEDVLIENVSEHPERSFIDSDSDDDLDTIDVAEIDDSFEIPYINEKQNSKLRNGPTIGD 600

Query: 601 RFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLE 660
           RFKINLYDNQ           NPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLE
Sbjct: 601 RFKINLYDNQIIIKILILFLKNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLE 660

Query: 661 KASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEE 720
           KASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEE
Sbjct: 661 KASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEE 720

Query: 721 VVKFSKLYKVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILGGGSFVDDGNGNVVP 780
           VVKFSKLYKVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILGGGSFVDDGNGNVVP
Sbjct: 721 VVKFSKLYKVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILGGGSFVDDGNGNVVP 780

Query: 781 QFIESSDPYEEHLETNDETSESLLTELDIHLKVGEIWKPGPESTPPNQ 828
           QFIESSDPYEEHLETNDETSESLLTELDIHLKVGEIWKPGPESTPPNQ
Sbjct: 781 QFIESSDPYEEHLETNDETSESLLTELDIHLKVGEIWKPGPESTPPNQ 828

>CAGL0C02145g complement(216905..219238) similar to sp|P43612
           Saccharomyces cerevisiae YFR040w SAP155 SIT4P-associated
           protein, hypothetical start
          Length = 777

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/773 (50%), Positives = 515/773 (66%), Gaps = 73/773 (9%)

Query: 106 FIERILDELDLMDELGKKNNVLLDFLCFGYFFDSDSK-KIMNMQYLIDQLISCVQYLTNA 164
           FI+R+L E +L++EL  +N  L+DF+CFG+FF  + K ++ N+ YL+DQL+ CV      
Sbjct: 28  FIDRMLKEGELLNELAAQNKGLIDFICFGFFFKENEKERVENIDYLLDQLLFCVDQFKMV 87

Query: 165 SITSVDEDKAN----------------DNMRSQEGPNFLHKATIISNILSFDEWLISESL 208
              +V+  + N                DN   ++   +L +A +I+ I S D WLI+ESL
Sbjct: 88  EADTVNVTRENSPADEGIEMDFNKVIEDNAEDED--EYLSRANLIAEIFSLDIWLITESL 145

Query: 209 IKNMNYLNEIWSVLSNVKLETEDSPLLPIFLKVNESLLLSRKDQYLNFIRTRKTLVDEFF 268
           +KN  +L++IW++L N   + E SPL+PIFLK+N++LL++R+DQYLNFIR++ +LVD+  
Sbjct: 146 VKNKEHLSKIWNLLHNPNFKFERSPLIPIFLKMNQNLLITRQDQYLNFIRSQSSLVDDML 205

Query: 269 KHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRVIQKCLKFFKNDQYSADVQACASDF 328
            H++I +L+DF LKLI+TDK + PTG+IEL+ DQ++I K LKF  N+ YSAD+QAC  DF
Sbjct: 206 MHIDIALLMDFFLKLISTDKIESPTGVIELVSDQKLIDKLLKFLNNNLYSADIQACVCDF 265

Query: 329 LKALIGISANVPLDEMSVGPNLLSRALASPDVVDHLINIILNENGTALNHTISVVIELIR 388
           LKALI ISAN PLDE+S+GPN L+R LASP  +D +I I+LNE G ALN TIS+VIELIR
Sbjct: 266 LKALIVISANAPLDELSIGPNSLTRRLASPKSIDKMIKIVLNERGAALNSTISIVIELIR 325

Query: 389 KNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKKFSDKIENIFALVDDMADK--TIMKR 446
           KNNSDYD++NLL+TT  +H PS+RDPI+LGYLL++F+  +  +F ++DD+ D   T    
Sbjct: 326 KNNSDYDQVNLLDTTLETHPPSDRDPIFLGYLLRRFAANLPKLFEIIDDIYDNNDTNDDM 385

Query: 447 IRINQINQEFQPLGFERIKIVELIAELLHCSNMGLMNSKRAEHIALKRDHLRLQLPHQLQ 506
           +  NQ+N++F P+GFER KIVELIAELLHCSNMGL+N+KRAE IA  RD +R Q+  QLQ
Sbjct: 386 LLTNQMNEKFIPIGFERFKIVELIAELLHCSNMGLLNTKRAERIARVRDKVRKQVSFQLQ 445

Query: 507 DALQDLEINKTEHXXXXXXXXXXXXXLTTGSVTDEDEDVLIENVSEHPERSFXXXXXXXX 566
           DAL DL IN +                      D  + +  EN S H E           
Sbjct: 446 DALNDLTINPS------VDNKRKSDTAQQNDKHDAFDGIQSENES-HDEFEHINQDEND- 497

Query: 567 XXXXXVAEIDDSFEIPYINEKQNSKLRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNN 626
                  EID++FEIPYINE QNSKLR  PTIGD FKI LYD Q           +PWNN
Sbjct: 498 -------EIDETFEIPYINENQNSKLRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNN 550

Query: 627 FWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNIT 686
           FWHNVIFDIIQQ+FNGRMDFSYNSF+V+SLFNLE + Q+  +++  ++     L +F+IT
Sbjct: 551 FWHNVIFDIIQQIFNGRMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAK----LKDFSIT 606

Query: 687 KDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIQKILQEKEW 746
           KDFIL GY KSY+FYE+  TNLG+MGHLVLIAEEVVKFSKLYKVELIS DIQ  LQE +W
Sbjct: 607 KDFILEGYHKSYKFYEEKNTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDSLQEDDW 666

Query: 747 IFYMDEVLHSTRIMYSKILGGGSFVDDGNGNVVPQFIESSDPYEEHLETND--------- 797
            +Y +EVL+ TR+MYSKILGGG+FV+D NGN+VPQ  + +  Y ++ + ND         
Sbjct: 667 QYYSEEVLNRTRLMYSKILGGGNFVEDANGNIVPQMNDGN--YLDYDDENDVSGGKLINV 724

Query: 798 ---ETSESLLTELDIHLKV-------------------GEIWKPGPESTPPNQ 828
              E   SL TE D+HLK+                   G I   GPE  P NQ
Sbjct: 725 ENLEEQLSLSTESDLHLKLRDMLVVKAQQEVDAKNAANGVIILGGPEEIPDNQ 777

>YFR040W (SAP155) [1722] chr6 (234229..237237) Sit4p-associated
           protein [3009 bp, 1002 aa]
          Length = 1002

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/747 (51%), Positives = 499/747 (66%), Gaps = 91/747 (12%)

Query: 106 FIERILDELDLMDELGKKNNVLLDFLCFGYFFDSDS-KKIMNMQYLIDQLISCVQYLTNA 164
           FIER+L E +L++EL ++N  LLDF+CFG+FFD  + KK+ NM+YL+DQL+ C+  +  A
Sbjct: 141 FIERMLVETELLNELSRQNKTLLDFICFGFFFDKKTNKKVNNMEYLVDQLMECISKIKTA 200

Query: 165 SI----------------------------TSVDEDKANDN-----MRSQEGPN------ 185
           +                             T  +E+K +DN      R + G +      
Sbjct: 201 TTVDLNNLIDYQEQQQLDDSSQEDVYVESDTEQEEEKEDDNNSNNKKRRKRGSSSFGNDD 260

Query: 186 -----------------FLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLE 228
                            +L KATIIS I S D WLISESL+KN +YLN+IWS+++     
Sbjct: 261 INNNDDDDDANEDDESAYLTKATIISEIFSLDIWLISESLVKNQSYLNKIWSIINQPNFN 320

Query: 229 TEDSPLLPIFLKVNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDK 288
           +E+SPL+PIFLK+N++LLL+R+DQYLNFIRT ++ VD+  KH++I +L+DF LK+I+TDK
Sbjct: 321 SENSPLVPIFLKINQNLLLTRQDQYLNFIRTERSFVDDMLKHVDISLLMDFFLKIISTDK 380

Query: 289 PDYPTGIIELLDDQRVIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGP 348
            + PTGIIEL+ DQ +I KCL F  N +  AD+QAC  DFLKALI ISAN PLD++S+GP
Sbjct: 381 IESPTGIIELVYDQNLISKCLSFLNNKESPADIQACVGDFLKALIAISANAPLDDISIGP 440

Query: 349 NLLSRALASPDVVDHLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHL 408
           N L+R LASP+ +  L++I++N+ G ALN T+S+VIELIRKNNSDYD++NLL TT ++H 
Sbjct: 441 NSLTRQLASPESIAKLVDIMINQRGAALNTTVSIVIELIRKNNSDYDQVNLLTTTIKTHP 500

Query: 409 PSNRDPIYLGYLLKKFSDKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVE 468
           PSNRDPIYLGYLL+KFS+ + + F ++ D+ +   +  +  NQ++++F+PLGFER K+VE
Sbjct: 501 PSNRDPIYLGYLLRKFSNHLSDFFQIILDIENDANIP-LHENQLHEKFKPLGFERFKVVE 559

Query: 469 LIAELLHCSNMGLMNSKRAEHIALKRDHLRLQLPHQLQDALQDLEINKTEHXXXXXXXXX 528
           LIAELLHCSNMGLMNSKRAE IA +RD +R QL H LQDAL DL I + E          
Sbjct: 560 LIAELLHCSNMGLMNSKRAERIARRRDKVRSQLSHHLQDALNDLSIEEKEQLK------- 612

Query: 529 XXXXLTTGSVT-DEDEDVLIENVSEHPERSFXXXXXXXXXXXXXVAEIDDSFEIPYINEK 587
                T  S T D D D+      ++                    EID+SFEIPYIN K
Sbjct: 613 -----TKHSPTRDTDHDL------KNNNGKIDNDNNDNDDESDYGDEIDESFEIPYINMK 661

Query: 588 QNSKLRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFS 647
           Q  KLR  PT+GD FKI LYD +           +PWNNFWHNVIFDIIQQ+FNGRMDFS
Sbjct: 662 QTIKLRTDPTVGDLFKIKLYDTRIVSKIMELFLTHPWNNFWHNVIFDIIQQIFNGRMDFS 721

Query: 648 YNSFIVYSLFNLEKASQF---------KKTDSNANSNNQILLG---NFNITKDFILLGYQ 695
           YNSF+V SLFNL+ + QF         K TD +  S   ++     +F IT DFIL GYQ
Sbjct: 722 YNSFLVLSLFNLKSSYQFMTDIVISDEKGTDVSRFS--PVIRDPNFDFKITTDFILRGYQ 779

Query: 696 KSYEFYEKWKTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIQKILQEKEWIFYMDEVLH 755
            SY+FYE  K NLGYMGH+VLIAEEVVKFSKLYKVELISPDIQ ILQ +EW +Y +EVL+
Sbjct: 780 DSYKFYELRKMNLGYMGHIVLIAEEVVKFSKLYKVELISPDIQVILQTEEWQYYSEEVLN 839

Query: 756 STRIMYSKILGGGSFVDDGNGNVVPQF 782
            TR+MYSKILGGGS++DDGNGN++PQ 
Sbjct: 840 ETRMMYSKILGGGSYIDDGNGNIIPQL 866

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 26/33 (78%), Gaps = 1/33 (3%)

Query: 1  MSFWPFPQD-STSNVSKILDEYFDILNSLRKAN 32
          MSFWPF Q+ + SN++KILDEYF +L+ L + N
Sbjct: 1  MSFWPFGQNLNHSNINKILDEYFHVLHELERIN 33

>Kwal_47.19191
          Length = 790

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/784 (47%), Positives = 508/784 (64%), Gaps = 82/784 (10%)

Query: 1   MSFWPFPQDSTSNVSKILDEYFDILNSLRKANLIEDDDNDVPLRGEEQIHDSYGSSKFQP 60
           MSFWPF Q+  SN++++L+EYF +L+SL K                    +  G    + 
Sbjct: 1   MSFWPFGQNEHSNINRVLEEYFQVLHSLEK-------------------REETGEEIIRL 41

Query: 61  XXXXXXXXXXXXXLAVTSEESSCDRDTEXXXXXXXXXXXXXXXXXFIERILDELDLMDEL 120
                        + VT E      + E                 +I+ IL E +L++EL
Sbjct: 42  EADEGEEEEDRGSVKVTQETGPEGENVEGGTAALSSK--------YIDGILAESELLNEL 93

Query: 121 GKKNNVLLDFLCFGYFFDSDSKKIMNMQYLIDQLISCVQYLTNASI-----TSVDEDKAN 175
            ++N+ LLDF+CFGYF+ +D  K+ N++YLIDQL++CV+ L  A       +S     A 
Sbjct: 94  TRQNSTLLDFVCFGYFYGADGGKVQNIEYLIDQLMACVERLGAAEAGQEQNSSASTPAAE 153

Query: 176 DNMRSQEGPN--FLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSP 233
           D++   E P    L++ATIIS I + D WLISESL+KN +YLN+IWS+L      +E S 
Sbjct: 154 DSVEGTEDPQQPVLNRATIISEIFALDIWLISESLVKNASYLNKIWSILKQQNFASEKSA 213

Query: 234 LLPIFLKVNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPT 293
           L+PIFLK+N++LL +R+DQYLNFIR++ TLVD+  +H+ I VL+DFLLK+I+TDK + P+
Sbjct: 214 LIPIFLKINQNLLATRQDQYLNFIRSKDTLVDDLLEHIQISVLMDFLLKIISTDKQESPS 273

Query: 294 GIIELLDDQRVIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLLSR 353
           GIIEL+ +QR+  K L +  ND+Y  D+QACA+D LKA++ ISAN PLD+MS+GPN L+R
Sbjct: 274 GIIELVHEQRLPNKLLSYLDNDRYEPDIQACAADLLKAIVAISANAPLDDMSIGPNSLTR 333

Query: 354 ALASPDVVDHLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRD 413
            LAS D V  L++ I+++ G AL + +S+VIELIRKNNSDYD++NLL TT  SH PS RD
Sbjct: 334 HLASEDCVSFLLDTIIDKRGNALINAVSIVIELIRKNNSDYDQVNLLTTTLTSHPPSMRD 393

Query: 414 PIYLGYLLKKFSDKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVELIAEL 473
           PIYLG +LK F++++ +IF ++ D+   +  K +  NQ+ ++++PLGFER K+VELIAEL
Sbjct: 394 PIYLGVMLKLFTERLPSIFQILTDIELDSTTKELE-NQLGEKYKPLGFERFKVVELIAEL 452

Query: 474 LHCSNMGLMNSKRAEHIALKRDHLRLQLPHQLQDALQDLEINKTEHXXXXXXXXXXXXXL 533
           LHCSNMGL+NSK+AE I  +R++ R  +  QLQDAL DL++   E+             +
Sbjct: 453 LHCSNMGLLNSKKAERIVKERNNARGAVVKQLQDALADLDLQDNEY---------ASNVV 503

Query: 534 TTGSVTDEDEDVLIENVSEHPERSFXXXXXXXXXXXXXVAEIDDSFEIPYINEKQNSKLR 593
               V +ED                                +D+SF+IPY+N  QN+KLR
Sbjct: 504 DNNGVDEED--------------------------------VDESFDIPYVNPNQNAKLR 531

Query: 594 NGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIV 653
             PTIGD FKI LYDNQ            PWNNFWHNV+FDIIQQLFNGRMDFSYNSF++
Sbjct: 532 ENPTIGDLFKITLYDNQIIPRIVHLFLQYPWNNFWHNVVFDIIQQLFNGRMDFSYNSFLI 591

Query: 654 YSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGH 713
           YSLFN   AS+F  +++ A +     + +F IT+D IL GY++SY FYEK  T LG+MGH
Sbjct: 592 YSLFNNHAASRF-MSEATAKT-----VRDFQITRDLILKGYKESYAFYEKHNTALGFMGH 645

Query: 714 LVLIAEEVVKFSKLYKVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILGGGSFVDD 773
           LVLIAEE+VKFSK+YKVELISPDIQ +LQ  +W+FY ++VL+ TRIMYSKILGG  +++D
Sbjct: 646 LVLIAEEIVKFSKVYKVELISPDIQAVLQNDDWVFYSEDVLNDTRIMYSKILGGNDYLED 705

Query: 774 GNGN 777
           GN N
Sbjct: 706 GNTN 709

>AFR245W [3437] [Homologous to ScYFR040W (SAP155) - SH; ScYGL229C
           (SAP4) - SH] complement(880258..882957) [2700 bp, 899
           aa]
          Length = 899

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/903 (43%), Positives = 530/903 (58%), Gaps = 121/903 (13%)

Query: 1   MSFWPFPQD-STSNVSKILDEYFDILNSLRKANLIEDDDND------------------- 40
           MSFWPF Q+ + SN+++ILD+YF +L+SL +    E  + +                   
Sbjct: 1   MSFWPFGQNVNNSNINRILDDYFRVLHSLEEDGAGESGEREAGGGPAAPAAGRIVKERST 60

Query: 41  ----VPLRGEEQIHDSYGSSKFQP-------XXXXXXXXXXXXXLAVTSEESSCDRDTEX 89
                     + +  + G    +P                     A++S  S C    E 
Sbjct: 61  NGGGASGGARDSLQRTEGGDAMRPVYHNPNSSEQGTVSSAPCVPSALSSAVSICTE--EL 118

Query: 90  XXXXXXXXXXXXXXXXFIERILDELDLMDELGKKNNVLLDFLCFGYFFDSDSKKIMNMQY 149
                           FI+ IL E +L++EL ++NN LLDF+CFG+F+D+D  KI N++Y
Sbjct: 119 ADSDEAPLTKFSLNYSFIDSILKESELLNELTRQNNTLLDFVCFGFFYDTDGNKIDNIEY 178

Query: 150 LIDQLISCVQYLTNASITSVDEDKANDNMR------------------------------ 179
           LIDQL+ C+  +        +E K ND  R                              
Sbjct: 179 LIDQLMFCIDRVN-------EEQKENDETRTPGHEQENEQHDDFLPPQQAGFLEGQDSEF 231

Query: 180 ----------SQEGPN----FLH------------KATIISNILSFDEWLISESLIKNMN 213
                     S EG +    FLH            +   IS I + D WLISESL+K+ +
Sbjct: 232 IKRAVFPEPPSHEGDDAILPFLHGRRDTRQSSLLNRVNTISEIFALDIWLISESLVKDPS 291

Query: 214 YLNEIWSVLSNVKLETEDSPLLPIFLKVNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNI 273
           +L++IWSVL++   + E SPL+PIFLK+N++LLL+R+DQ LNFIR R++LVDEF +H+ I
Sbjct: 292 HLSKIWSVLNHKDFKAEKSPLVPIFLKINQNLLLTRQDQLLNFIRARESLVDEFLQHLEI 351

Query: 274 PVLLDFLLKLIATDKPDYPTGIIELLDDQRVIQKCLKFFKNDQYSADVQACASDFLKALI 333
            VL+DF LK+I+TDK + PTGIIEL+ DQ +I K L F  N +YSAD+QACA D +KALI
Sbjct: 352 SVLMDFFLKIISTDKQESPTGIIELVYDQGLIPKMLSFLDNHKYSADIQACAGDLMKALI 411

Query: 334 GISANVPLDEMSVGPNLLSRALASPDVVDHLINIILNENGTALNHTISVVIELIRKNNSD 393
            IS N PLDE+S+GPN L+R L S + +D  ++ I+N+ G AL   +SVVIELIRKNNSD
Sbjct: 412 SISTNAPLDELSIGPNALTRQLCSEESIDCFLDAIINKRGHALTTAVSVVIELIRKNNSD 471

Query: 394 YDEINLLETTTRSHLPSNRDPIYLGYLLKKFSDKIENIFALVDDMADKTIMKRIRINQIN 453
           YD+INLL T+ ++H PS RDPIYLG +LKKF++K+ N   ++ ++ +   +K IR NQ+ 
Sbjct: 472 YDQINLLCTSVKTHPPSTRDPIYLGRMLKKFAEKLPNFKRVLLEIENDGSIKDIR-NQLG 530

Query: 454 QEFQPLGFERIKIVELIAELLHCSNMGLMNSKRAEHIALKRDHLRLQLPHQLQDALQDLE 513
            E++PLGFER KIVELIAELLHCSNMGLMNSK+AE I  +RD +R  +  QLQDAL +L 
Sbjct: 531 IEYKPLGFERFKIVELIAELLHCSNMGLMNSKKAERIVKERDEVRNHMVKQLQDALTELN 590

Query: 514 INKTEHXXXXXXXXXXXXXLTTGSVTDEDEDVLIENVSEHPERSFXXXXXXXXXXXXXVA 573
           +N                  T  S++ +   V  +N  E                     
Sbjct: 591 MNDGNDRTKGDEKGLTGLCATNTSMSTQTTAV-NDNADE--------------------- 628

Query: 574 EIDDSFEIPYINEKQNSKLRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIF 633
           EID+SFEIPY+N  QNSKL + PTIGD FKI LYD Q           +PWNNFWHNV+F
Sbjct: 629 EIDESFEIPYLNMNQNSKLPHNPTIGDLFKIQLYDTQLLPKIIQLFIEHPWNNFWHNVVF 688

Query: 634 DIIQQLFNGRMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFILLG 693
           DIIQQ+FNGRMDFSYNSF+VYSLFN + A QF   D     N      +F IT+D +L G
Sbjct: 689 DIIQQIFNGRMDFSYNSFLVYSLFNNKDAGQF-VIDVKPEENRAQDFTDFAITRDLVLQG 747

Query: 694 YQKSYEFYEKWKTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIQKILQEKEWIFYMDEV 753
           Y+ S+ FYE++ TNLGYMGHLVLIAEE+VKFSK+YKVELISPDI ++LQ+ +WIFY ++ 
Sbjct: 748 YKNSHAFYEQYNTNLGYMGHLVLIAEEIVKFSKVYKVELISPDIHRVLQDPDWIFYSEDA 807

Query: 754 LHSTRIMYSKILGGGSFVDDGNGNVVPQFIESSDPYEEHLETNDETSE-SLLTELDIHLK 812
           L+ TR+MYSKILGG  ++ + NG    +  + ++  E   E   + S  S  T+ D+H K
Sbjct: 808 LNDTRMMYSKILGGSEYLGEENGCTAAEMEQLTETGENLPEFGGKLSGYSFSTQADLHQK 867

Query: 813 VGE 815
           + E
Sbjct: 868 LKE 870

>Sklu_2433.17 YFR040W, Contig c2433 26349-29093 reverse complement
          Length = 914

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/693 (50%), Positives = 465/693 (67%), Gaps = 48/693 (6%)

Query: 106 FIERILDELDLMDELGKKNNVLLDFLCFGYFFDSDSKKIMNMQYLIDQLISCVQYLT--- 162
           FI+ +L E +L++EL ++NN LLDF+CFGYF+D+   K+ N++YLIDQL+ C+  +    
Sbjct: 132 FIDNLLQETELLNELTRQNNTLLDFICFGYFYDAYGTKVENIEYLIDQLMICIDKINEHD 191

Query: 163 ---------------NASITSVDEDKAND-------NMRSQEGPNFLHKATIISNILSFD 200
                            S  +   D +ND       N    +  ++L+KATIIS I S D
Sbjct: 192 DNEPDDKDLQVEQEDGPSTQTQPNDDSNDISTPSVDNQEEDDQSSYLNKATIISEIFSLD 251

Query: 201 EWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLKVNESLLLSRKDQYLNFIRTR 260
            WLISESL+KN  YL  IWS+L +    +E SPL+PIFLK+N++LLL+R+DQYLNFIRTR
Sbjct: 252 IWLISESLVKNSTYLATIWSILHHPNFSSEKSPLIPIFLKINQNLLLTRQDQYLNFIRTR 311

Query: 261 KTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRVIQKCLKFFKNDQYSAD 320
           + LV +F KH+ I VL+DF LK+I+TDK + PTGIIEL+ +Q +I K L +  N  Y AD
Sbjct: 312 ENLVGDFLKHIGISVLMDFFLKVISTDKQESPTGIIELVYEQGLISKLLNYLDNG-YHAD 370

Query: 321 VQACASDFLKALIGISANVPLDEMSVGPNLLSRALASPDVVDHLINIILNENGTALNHTI 380
           +QACA DF+KALI ISAN PLD+MS+GPN L+R L S   +D L+N I+N+ G AL   +
Sbjct: 371 IQACAGDFIKALIAISANAPLDDMSIGPNSLTRQLCSEQCIDLLLNAIVNKRGAALTTAV 430

Query: 381 SVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKKFSDKIENIFALVDDMAD 440
           S+VIELIRKNNSDYD++NLL TT ++H PS RDPIYLG +LKKF+  +   + ++ D+ +
Sbjct: 431 SIVIELIRKNNSDYDQVNLLTTTVKTHPPSIRDPIYLGVMLKKFAVNLPEFYRILLDVEN 490

Query: 441 KTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMGLMNSKRAEHIALKRDHLRLQ 500
              +  ++ NQ+NQE++PLGFER K+VELIAELLHCSNMGLMNSK+AE I  +RD +R  
Sbjct: 491 DDRIPLVK-NQLNQEYKPLGFERFKVVELIAELLHCSNMGLMNSKKAERIVKERDEVRQG 549

Query: 501 LPHQLQDALQDLEINKTEHXXXXXXXXXXXXXLTTG--------SVTDEDEDVLIENVSE 552
           L  QL+DAL +L++ +                            + ++E+ D + E V+E
Sbjct: 550 LTKQLEDALAELDMGEENDNINDANNNNSTTTTNNTITDNNDTVTTSNENNDEVYEKVNE 609

Query: 553 HPERSFXXXXXXXXXXXXXVAEIDDSFEIPYINEKQNSKLRNGPTIGDRFKINLYDNQXX 612
              +                 EID+SFEIPY+N  QN+KLR  PT GD FKINLYD Q  
Sbjct: 610 QNNKESPDDANDE-------EEIDESFEIPYVNPSQNAKLRLNPTTGDLFKINLYDTQIL 662

Query: 613 XXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLEKASQFKKTDSNA 672
                     PWNNFWHNV+FDIIQQ+F+GRMDFSYNSF+VYSLFN + ++QF  T    
Sbjct: 663 PKIIELFLRYPWNNFWHNVLFDIIQQIFSGRMDFSYNSFLVYSLFNNKGSAQFMLTAKPT 722

Query: 673 NSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEEVVKFSKLYKVEL 732
           +      + +F IT D IL GY+ S++FYE  +TNLGYMGHLVLIAEE+VKFSK+YKVEL
Sbjct: 723 H------VRDFRITADLILQGYRDSHDFYEVHETNLGYMGHLVLIAEEIVKFSKVYKVEL 776

Query: 733 ISPDIQKILQEKEWIFYMDEVLHSTRIMYSKIL 765
           ISPDI ++LQ++ WIFY ++VL+ TR+MYSKIL
Sbjct: 777 ISPDIYEVLQDEAWIFYSEDVLNDTRVMYSKIL 809

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 23/29 (79%), Gaps = 1/29 (3%)

Query: 1  MSFWPFPQD-STSNVSKILDEYFDILNSL 28
          MSFWPF Q+ + SN++K+LD+YF +L  L
Sbjct: 1  MSFWPFGQNINNSNINKLLDDYFHVLRDL 29

>KLLA0A01155g complement(104687..107668) some similarities with
           sp|P43612 Saccharomyces cerevisiae YFR040w SAP155
           SIT4P-associated protein, hypothetical start
          Length = 993

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/635 (51%), Positives = 436/635 (68%), Gaps = 65/635 (10%)

Query: 186 FLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLKVNESL 245
           FL+KA IIS I + D WLISESL+KN  YLN+IWS+L + K   E SPL+PIFLK+N++L
Sbjct: 393 FLNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQNL 452

Query: 246 LLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRVI 305
           LL+R+DQYLNFIRTR  LV +  KH++I +L+DF LK++ATDK + PTGIIEL+ +Q++I
Sbjct: 453 LLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSEQKLI 512

Query: 306 QKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLLSRALASPDVVDHLI 365
                F  N++YSAD+QACA DF+K++I +SAN PLDEMS+GPN L+R +AS   +D+L+
Sbjct: 513 DHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEKCIDYLL 572

Query: 366 NIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKKFS 425
             I+NE G AL   +S+ IELIRKNNSDYD++NLL TT +SH PS RDP+YLG +L+KFS
Sbjct: 573 GCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYLGVMLRKFS 632

Query: 426 DKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMGLMNSK 485
           + + N+  ++ D+ +   +  I+ NQ+ + ++PLGFER K+VELIAELLHCSNMGLMNSK
Sbjct: 633 ENLVNLKQILFDIENDASIPIIK-NQMGESYKPLGFERFKVVELIAELLHCSNMGLMNSK 691

Query: 486 RAEHIALKRDHLRLQLPHQLQDALQDLEINKTEHXXXXXXXXXXXXXLTTGSVTDEDEDV 545
           +AE I  +RD +R +L  QL+DAL DL I                  LT  +        
Sbjct: 692 KAERIVKERDQVRTELVQQLEDALTDLNIKSK---------------LTADN-------- 728

Query: 546 LIENVSEHPERSFXXXXXXXXXXXXXVAEIDDSFEIPYINEKQNSKLRNGPTIGDRFKIN 605
              N     E S                +ID+SFE+PY+N+ QN+KLR+ PTIGD FKI 
Sbjct: 729 --HNSDSPTELSLDD-------------DIDESFEVPYVNDNQNAKLRSNPTIGDLFKIE 773

Query: 606 LYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLEKASQF 665
           LY++Q            PWNNFWHNVIFDIIQQ+FNGRMDFSYNSF+VY+LF+ + A +F
Sbjct: 774 LYNSQLLPIIIQLFIKYPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERF 833

Query: 666 K--KTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEEVVK 723
              KT  +A         +F IT+D +LLGY+ S++FYEK  T LG+MGHLVLIAEE+VK
Sbjct: 834 ATDKTLDDAPI-------DFQITRDLVLLGYRNSHKFYEKHNTTLGFMGHLVLIAEEIVK 886

Query: 724 FSKLYKVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILGGGSFVDDGN---GNVVP 780
           FSK+YKV+LISPDI ++L +++W FY +++L+ TRIMYSKILGGG +++DGN   G++V 
Sbjct: 887 FSKVYKVDLISPDIHEVLLDEDWDFYSNDILNDTRIMYSKILGGGDYIEDGNLNGGDIV- 945

Query: 781 QFIESSDPYEEHLETNDETSESLLTELDIHLKVGE 815
                          ND+   S  T++D+H K+ E
Sbjct: 946 -------------MGNDQDPTSFSTQMDLHDKLRE 967

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 122 KKNNVLLDFLCFGYFFDSDSKKIMNMQYLIDQLISCVQYLTNASITS-VDEDKANDNM 178
           ++NN LLDF+CFGYF+     K+ N+ YLID+L+ C+  + + + ++ +D    NDN+
Sbjct: 235 RQNNTLLDFVCFGYFYTETGDKVENIAYLIDRLLDCIDKIDDDNDSANLDTVGGNDNV 292

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 24/29 (82%), Gaps = 1/29 (3%)

Query: 1  MSFWPFPQD-STSNVSKILDEYFDILNSL 28
          MSFWPF Q+ ++SN++ IL+EYF +++ L
Sbjct: 1  MSFWPFGQNFNSSNINGILEEYFHVMHGL 29

>Scas_687.19
          Length = 956

 Score =  395 bits (1014), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 235/549 (42%), Positives = 346/549 (63%), Gaps = 53/549 (9%)

Query: 1   MSFWPFPQD-STSNVSKILDEYFDILNS-------LRKANL-----IEDDDNDVP----- 42
           MSFWPF Q+ + S+++KILDEYF IL++       +RK  L     I+ D  +V      
Sbjct: 1   MSFWPFGQNLNHSDINKILDEYFQILHTLEKENPLVRKEALKFFSKIDTDSQNVSASISS 60

Query: 43  --LRGEEQIHD-------SYGSSKFQPXXXXXXXXXXXXXLAVTSEESSCDRDTEXXXXX 93
             L G+E            +  +   P              +  S E+S   D       
Sbjct: 61  VNLSGDETCSSLVLTKNIYFNKNTLYPTRSGGASGSSSTSGSPLSSENSSATDLNSEDIS 120

Query: 94  XXXXXXXXXXX----XFIERILDELDLMDELGKKNNVLLDFLCFGYFFDSDSK-KIMNMQ 148
                           F++R++ + + ++EL ++N+ LLDF+C+G+FFD  +K K+ N+ 
Sbjct: 121 ETTTPLNVSIKNLDNSFVDRLIIDSEFLNELTRQNSTLLDFICYGFFFDPITKEKVQNLD 180

Query: 149 YLIDQLISCVQYLT----------NASITSVDEDKANDNMRSQEG--------PNFLHKA 190
           YLID L++ V  +              I + DE+K  +  +++          P  L KA
Sbjct: 181 YLIDSLLAYVDEIPMEIAKTEKKEEVKIYATDEEKQTEEEQAEAANEELANEVPTSLSKA 240

Query: 191 TIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLKVNESLLLSRK 250
           TIIS  L+ D W+++++LIKN +YL+++WS++ +  L++E S L+ IFLK+N++LL SR 
Sbjct: 241 TIISEALALDLWMLTDALIKNESYLSKLWSIIRHDGLDSESSSLVSIFLKINQNLLFSRT 300

Query: 251 DQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRVIQKCLK 310
           + Y+ FI T   LVDE   H+++ +++DF LK+IATD+ + PTG+I+L+ DQ++I K L+
Sbjct: 301 ENYIAFICTNPNLVDEILDHIDVSMIMDFFLKIIATDRIESPTGVIQLVCDQKLIYKSLQ 360

Query: 311 FFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLLSRALASPDVVDHLINIILN 370
           F  N +YS+DVQ+C+ DFLKALIGISAN P+D++++GPN L+R LAS + +D LI+IILN
Sbjct: 361 FLDNTKYSSDVQSCSGDFLKALIGISANAPIDDIAIGPNSLTRELASNEAIDILIDIILN 420

Query: 371 ENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKKFSDKIEN 430
           + G AL+  +S+VIELIRKNNSDYD++NLLETT   + P +RDPIYLGYLLKKFS  + N
Sbjct: 421 KRGYALDTAVSIVIELIRKNNSDYDQVNLLETTIIDNPPIDRDPIYLGYLLKKFSINLPN 480

Query: 431 IFALVDDM-ADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMGLMNSKRAEH 489
              ++ D+  D +I   +R NQ++++F+PLGFER KIVELIAELLHCSNMGLMNS++AE 
Sbjct: 481 FLKIIVDIETDDSI--PLRENQLHEKFKPLGFERFKIVELIAELLHCSNMGLMNSRKAEK 538

Query: 490 IALKRDHLR 498
           IALKRD  R
Sbjct: 539 IALKRDKYR 547

 Score =  291 bits (746), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 167/219 (76%), Gaps = 1/219 (0%)

Query: 572 VAEIDDSFEIPYINEKQNSKLRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNV 631
           + EID+SFEIPYINE QN KLR  PT+GD FKI+LYD Q           +PWNNFWHNV
Sbjct: 632 IEEIDESFEIPYINESQNMKLREYPTMGDLFKISLYDTQVMPQIMKLFLAHPWNNFWHNV 691

Query: 632 IFDIIQQLFNGRMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFIL 691
           IFDIIQQ+FNGRMDFSYNSF+VYSLFNL+ + Q+   D  A   N I   NF IT DFIL
Sbjct: 692 IFDIIQQIFNGRMDFSYNSFLVYSLFNLKGSLQYMPPDVIAGIEN-IEDVNFAITTDFIL 750

Query: 692 LGYQKSYEFYEKWKTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIQKILQEKEWIFYMD 751
            GY  S++FYE  KTNLGYMGHLVL+AEE++KFS+LYKVELISPDIQ+   +K+W +Y +
Sbjct: 751 KGYHDSFKFYETRKTNLGYMGHLVLVAEEIIKFSRLYKVELISPDIQEATVDKDWRYYSN 810

Query: 752 EVLHSTRIMYSKILGGGSFVDDGNGNVVPQFIESSDPYE 790
           +VL+ TRIMYSKILGGG++VDDGNGN+VPQ      P E
Sbjct: 811 DVLNETRIMYSKILGGGTYVDDGNGNIVPQLATDGTPEE 849

>KLLA0F14124g 1305690..1308992 similar to sp|P36123 Saccharomyces
           cerevisiae YKR028w SAP190 SIT4P-associated protein,
           start by similarity
          Length = 1100

 Score =  343 bits (879), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 220/599 (36%), Positives = 324/599 (54%), Gaps = 54/599 (9%)

Query: 188 HKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPI----FLKVNE 243
            +A I + ILS D W IS + + N + L ++WS L +       +PL  I    F+K+NE
Sbjct: 283 RRARIAAEILSADVWTISSAFMDNEDLLVKLWSTLEHP------APLSIIASTYFMKINE 336

Query: 244 SLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQR 303
            LL       +NFI  ++ +VD F  H++ P L+DFLLK+I+TDKPD PTGII LL  Q 
Sbjct: 337 RLLDMDISGMINFILKQENIVDRFIAHIDNPPLMDFLLKVISTDKPDAPTGIIALLKKQH 396

Query: 304 VIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMS-VGPNLLSRALASPDVVD 362
           +I K L +  + ++ + +Q+ A DFLKALI ISAN   +  S +GPN L+R L S ++V 
Sbjct: 397 LISKLLDYL-SIEHDSSIQSAAGDFLKALITISANSNNEIASAIGPNELTRELVSAEMVS 455

Query: 363 HLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLK 422
            L+NI+L + GT+L++ + +VIELIRKNNSDYD + ++ TT  +H PS+RDP+YLG+L++
Sbjct: 456 KLVNIML-QCGTSLSNGVGIVIELIRKNNSDYDFVQVMYTTLETHPPSDRDPVYLGHLVR 514

Query: 423 KFSDKIENIFALVDDMADKTIMKRIRINQINQEF---QPLGFERIKIVELIAELLHCSNM 479
            F++K++             I+   +++ +   F   +PLGFER KI EL+AELLHCSNM
Sbjct: 515 CFANKMDRF---------NKILLETKLDPLETPFGSIEPLGFERFKICELVAELLHCSNM 565

Query: 480 GLMNSKRAEHIALKRDHLRLQLPHQLQDALQDLEINKTEHXXXXXXXXXXXXXLTTGSVT 539
           GL+     E I L+RD  R ++  ++++ L++   +  E                   + 
Sbjct: 566 GLLGEPSGEAIVLERDLKREEILKEMEEQLENENASDAETGYYDGEDDTAHANNLHRELQ 625

Query: 540 DEDEDVLIENVSEHPERSFXXXXXXXXXXXXXVAEIDD-SFEIPYINEKQNSKLRNGPTI 598
           D + +  +++     E                +AE  D   E    +E     LR  P +
Sbjct: 626 DLNINATLKDSEATDEVEDVKDVGDAGDVDASLAERTDIHSETSSDSEVTEKVLRENPVV 685

Query: 599 GDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFN 658
           GD  KI+L DN             PWNNF HNV+FDI+QQ+FNG +   YN F++  LF+
Sbjct: 686 GDLLKISLQDNNIITTILDMFFRFPWNNFLHNVVFDIVQQIFNGPLKSGYNKFLLADLFS 745

Query: 659 LEKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLIA 718
                                  + +IT D I+ G +K  E+ ++    LGYMGHL LIA
Sbjct: 746 -----------------------SAHIT-DVIMEGDRKCLEYEKETGIRLGYMGHLTLIA 781

Query: 719 EEVVKFSKLYK---VELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILGGGSFVDDG 774
           EEV KF+   +   V   SP +Q+ L E +W  Y D +L  TR  YS +LG   F D+G
Sbjct: 782 EEVAKFAAYIEEANVTFASPVVQEGLNEPKWKEYCDTILTETREKYSSLLGDDGF-DEG 839

>YGL229C (SAP4) [1769] chr7 complement(64502..66958) Member of the
           SAP family of proteins that associate with Sit4p [2457
           bp, 818 aa]
          Length = 818

 Score =  329 bits (844), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 204/538 (37%), Positives = 298/538 (55%), Gaps = 67/538 (12%)

Query: 1   MSFWPFPQD-STSNVSKILDEYFDILNSLRKANLIEDDDNDVPLRGEEQIHDSYGSSKFQ 59
           MS WPF +  S S +  IL+EY+ I  SL        DD                  K +
Sbjct: 1   MSLWPFGETLSHSGIDSILEEYYLIFRSLEGNETSSTDDK-----------------KNE 43

Query: 60  PXXXXXXXXXXXXXLAVTSEESSCDRDTEXXXXXXXXXXXXXXXXXFIERILDELDLMDE 119
           P                 S ES  +  TE                 FI+RIL E  L+DE
Sbjct: 44  P-----------------SMESESEFGTESRDRSDLNQS-------FIDRILLETALLDE 79

Query: 120 L-GKKNNVLLDFLCFGYFFDSDSKKIMNMQYLIDQLISCVQYLTNASITSVDEDKANDNM 178
           L G  N+ L+DF+C GYF+D  S+++ +M YL+D L++   YL +   T        +N 
Sbjct: 80  LNGAANDRLVDFICLGYFYDDRSQQVRHMDYLVDMLMA---YLKDIDRTGYRTPFLLENS 136

Query: 179 RSQEGP-------NFLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETED 231
             Q G        + +    IIS+I       I E+L++N  +L+ ++ V     +E E+
Sbjct: 137 FHQTGEYEDQDDEDPMLYVNIISSIFCSKSAPIVEALVQNTPFLSSLFEVFQFENIEAEN 196

Query: 232 SPLLPIFLKVNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDY 291
            P+L +FLK+NE+LL  +   YL F +++  +VD+F  H+ +  L++FL+K++ TD+ + 
Sbjct: 197 CPILAVFLKINETLLFEQTSSYLEFFKSQPNIVDKFLYHIEVSPLVEFLIKIMLTDQVES 256

Query: 292 PTGIIELLDDQRVIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMSVGPNLL 351
           PT II+ L  Q +I KCL   +N +YS  +Q  + + LKALI IS N  LD + +GPN L
Sbjct: 257 PTNIIDFLYHQDLIPKCLNLLENSKYSPGIQNSSGELLKALISISTNFKLDTLWIGPNRL 316

Query: 352 SRALASPDVVDHLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSN 411
           +R LASP  VD LINIIL + G A+   +S++IELIRKNNSDYDE++LL TT   + PS 
Sbjct: 317 TRQLASPQYVDQLINIILFQRGHAMGVAVSIIIELIRKNNSDYDEVDLLSTTIVDNPPSQ 376

Query: 412 RDPIYLGYLLKKFSDKIENIFALVDDM-------------ADKTIMKRIRINQINQEFQP 458
           RDP+YLG+LL + +  +E+ +AL+  +             A  ++   +  NQ+++ F+P
Sbjct: 377 RDPVYLGHLLYELTMHMEDFYALLIKLENDDDDDHDTASKALPSVKHHLLENQLHESFRP 436

Query: 459 LGFERIKIVELIAELLHCSNMGLMNSKRAEHIALKRDHLRLQL-PHQLQDALQDLEIN 515
           LGFER+KI ELI+E+LHCSNMGLMNSKR E IA  RD  R  L  + L+ A+++L IN
Sbjct: 437 LGFERVKITELISEMLHCSNMGLMNSKRGEKIARTRDKCRDTLDQNSLEKAMKNLNIN 494

 Score =  241 bits (616), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 171/259 (66%), Gaps = 21/259 (8%)

Query: 578 SFEIPYINEKQNSKLRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQ 637
           SFEIPY++E QN K+R  PTIGD FKI L+D              PWNNFWHN++FDIIQ
Sbjct: 552 SFEIPYVSETQNLKIRKNPTIGDLFKIKLHDLGFFPKFLQLFLRYPWNNFWHNIVFDIIQ 611

Query: 638 QLFNGRMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKS 697
           Q+FNGRMDFSYNSF+VYSLF+ +K+++F        SN ++ + +F+I  DFIL G++ S
Sbjct: 612 QIFNGRMDFSYNSFLVYSLFDFKKSTRFIPKPLYG-SNQKLPVKDFHIISDFILQGHKDS 670

Query: 698 YEFYEKWKTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIQKILQEKEWIFYMDEVLHST 757
           +EFYEK KTNLGYMG LVLIAEE+ K+SK+YK +LI+PDI   LQ++ W+ Y  ++L+ T
Sbjct: 671 FEFYEKEKTNLGYMGQLVLIAEEIAKYSKIYKTDLIAPDIYAFLQDEVWMSYSSDILNET 730

Query: 758 RIMYSKILGGGSFVDDGNGNVVPQFIESSD---------------PYEEHLETNDETSES 802
           R M S ILGGG F  + + N    F+E +D                +EE ++ +D+ +E 
Sbjct: 731 RTMCSIILGGGQFCAESDENTNQDFLEKADMSKPAHPSTMDENEIVHEEDVKLHDKVAEL 790

Query: 803 L-----LTELDIHLKVGEI 816
           +     LTELDIH K+ ++
Sbjct: 791 IDELGQLTELDIHDKIKDV 809

>AFR089W [3281] [Homologous to ScYKR028W (SAP190) - SH; ScYJL098W
           (SAP185) - SH] complement(590137..593232) [3096 bp, 1031
           aa]
          Length = 1031

 Score =  323 bits (828), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 220/622 (35%), Positives = 322/622 (51%), Gaps = 71/622 (11%)

Query: 164 ASITSVDEDKANDNMRSQEGPNFLH--KATIISNILSFDEWLISESLIKNMNYLNEIWSV 221
           A +   + D +N   + QE    +   +A + + ILS D W IS + I++   L ++WS+
Sbjct: 184 AELGHDESDSSNTGTQPQETDEQVQSRRARMAAEILSADVWPISSAFIEHDELLYKLWSI 243

Query: 222 LSNVKLETEDSPLLPI----FLKVNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLL 277
           L +       +PL  +    F+K+NE LL       + FI  +  LVD +  H++ P L+
Sbjct: 244 LDHP------APLSIVASTYFMKINERLLDMDIASMIRFILNQDNLVDRYLTHIDNPPLM 297

Query: 278 DFLLKLIATDKPDYPTGIIELLDDQRVIQKCLKFFKNDQYSADVQACASDFLKALIGISA 337
           DFLLK+I+TDKPD PT +I LL  Q++I K L    + ++S+ VQ+ A DFLKALI ISA
Sbjct: 298 DFLLKVISTDKPDTPTHVIGLLKYQKLISKLLDHL-SPEWSSSVQSAAGDFLKALITISA 356

Query: 338 NVPLDEMS-VGPNLLSRALASPDVVDHLINIILNENGTALNHTISVVIELIRKNNSDYDE 396
           N   +  S +GPN L+R L SP +   L +I+LN  GT+L++ + +VIELIRKNNSDYD 
Sbjct: 357 NSNNEIASAIGPNELTRELVSPAMASKLGDIMLN-GGTSLSNGVGIVIELIRKNNSDYDF 415

Query: 397 INLLETTTRSHLPSNRDPIYLGYLLKKFSDKIENIFALVDDMADKTIMKRIRINQINQEF 456
             ++ TT ++H P++RDP+YLG+L+K F++K+    A++ D       K   +       
Sbjct: 416 FQVMYTTLKTHPPNDRDPVYLGHLVKSFANKLPEFNAMLLD------TKLPPLETPFGTI 469

Query: 457 QPLGFERIKIVELIAELLHCSNMGLMNSKRAEHIALKRD-----HLRLQ---LPHQLQDA 508
           +PLGFER KI ELIAELLHCSNMGL+N  + E I  +RD      LRL+   +P    D 
Sbjct: 470 EPLGFERFKICELIAELLHCSNMGLLNEPKGEEIVNERDIDRECVLRLEGYGIPKNCHDE 529

Query: 509 LQDLEINKTEHXXXXXXXXXXXXXLTTGSVTDEDEDV-LIENVSEHPERSFXXXXXXXXX 567
            + + ++  E              L T      D  V  + + S+               
Sbjct: 530 ERSVSVSPIEE--EDLAKKIRDLQLVTDKRPSSDNSVESLNSDSQQATTPIHQLGTEIHS 587

Query: 568 XXXXVAEIDDSFEIPYINEKQNSKLRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNNF 627
                AE+ +              LR  P +GD+ KI L DN+            PWNNF
Sbjct: 588 EDSSDAELSE------------QALREKPVVGDQLKIALQDNKIITTILGMFFKYPWNNF 635

Query: 628 WHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITK 687
            HNV+FDI+QQ+FNG +   YN F++  LF                        + +IT 
Sbjct: 636 LHNVVFDIVQQIFNGPLKTGYNRFLLADLF-----------------------ASAHIT- 671

Query: 688 DFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEEVVKFSKL---YKVELISPDIQKILQEK 744
           + I+ G +K +E+  +    LGYMGHL L+AEEV KF+      K+   +P I + L ++
Sbjct: 672 EAIIEGDRKCHEYERETGLRLGYMGHLTLVAEEVTKFASYIDEMKISFSNPVISESLNDQ 731

Query: 745 EWIFYMDEVLHSTRIMYSKILG 766
            W  Y + VL  TR  YS +LG
Sbjct: 732 RWREYTELVLAETRGKYSTVLG 753

>CAGL0L03586g complement(408095..411466) similar to sp|P40856
           Saccharomyces cerevisiae YJL098w SAP185 or sp|P36123
           Saccharomyces cerevisiae YKR028w SAP190, start by
           similarity
          Length = 1123

 Score =  323 bits (828), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 215/600 (35%), Positives = 310/600 (51%), Gaps = 67/600 (11%)

Query: 187 LHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPI-----FLKV 241
           L +A + + +LS D W IS ++I+N + L ++WS++         +PL PI     F+K+
Sbjct: 247 LRRARMAAEVLSADVWPISSAIIQNEDLLEKLWSIMQYP------APL-PIEISTYFMKI 299

Query: 242 NESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDD 301
           NE LL    +  L FI     L+D F  H++ P L+DFLLK+I+TDK D PTGII++L +
Sbjct: 300 NERLLDMDLNGILAFILNHPNLLDIFLTHIDNPPLMDFLLKVISTDKADTPTGIIKILKE 359

Query: 302 QRVIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLD-EMSVGPNLLSRALASPDV 360
           Q +I K L F  + +Y    Q+ A DF+KAL+ IS N   +   S+GPN + R L SP +
Sbjct: 360 QGMIPKLLDFL-SPEYDKSTQSAAGDFIKALVTISGNCNNEIASSIGPNEMIRELVSPPM 418

Query: 361 VDHLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYL 420
           V+ LI+I+L + G++L++ + +VIELIRKNNSDYD + L  TT ++H P++RDPIYLGYL
Sbjct: 419 VEKLISIML-KAGSSLSNGVGIVIELIRKNNSDYDFVQLAYTTIKTHPPNDRDPIYLGYL 477

Query: 421 LKKFSDKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMG 480
           LK F+  +     ++      T ++   +     E +PLGFER KI ELIAELLHCSNM 
Sbjct: 478 LKAFAAHMAEFTQML------TSIELPPLQTPQGEIEPLGFERFKICELIAELLHCSNMT 531

Query: 481 LMNSKRAEHIALKRDHLRLQLPHQLQDALQDLEINKTEHXXXXXXXXXXXXXLTTGSVTD 540
           L+N    E I  +RD  R ++       L D   N+ E                   + +
Sbjct: 532 LLNDPNGESIVKERDEERERILKLENQKLNDESDNEIEDNNIPTTDLKSDTSQEDEKIAN 591

Query: 541 EDEDVLIENVSEHPERSFXXXXXXXXXXXXXVAEIDDSFEIPYINEKQ-----------N 589
           E  D+ +++     +                   + D FE    NE++            
Sbjct: 592 EMNDLQLDSEGNADDTDGSEQAKSDT--------VRDEFESKETNEEEYLENISDDSETE 643

Query: 590 SKLRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYN 649
            KLR  PT+GD+ KI L D +             WNNF HNV+FDIIQQ+FNG +   YN
Sbjct: 644 HKLRENPTVGDQLKIALEDTRVIEVILEMFFHYVWNNFLHNVVFDIIQQIFNGPLMTGYN 703

Query: 650 SFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLG 709
            F++                         LL N ++T D I+ G ++S  + EK    LG
Sbjct: 704 RFLLID-----------------------LLKNIHMT-DLIIKGNEQSGVYEEKHVLRLG 739

Query: 710 YMGHLVLIAEEVVKFSKL---YKVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILG 766
           YMGHL L+AEE+VKF       K+   +  I   L E +W +Y +  L   R  Y+ ILG
Sbjct: 740 YMGHLTLMAEEIVKFEAYLDEMKITFTTDTIPTCLSEAKWKYYAETELADLREKYNTILG 799

>Scas_711.22*
          Length = 1018

 Score =  316 bits (809), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 214/605 (35%), Positives = 309/605 (51%), Gaps = 73/605 (12%)

Query: 187 LHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSN-VKLETEDSPLLPIFLKVNESL 245
           + +A + S ILS + W IS ++++N   L ++WS+L + + L  E S     F+K+NE L
Sbjct: 202 VRRAHMASEILSAEVWGISNAILENDELLTKLWSILDHPIPLSIETSTY---FMKINERL 258

Query: 246 LLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRVI 305
           L +     + FI ++ TLV  F KH++ P LLDFLLK+I++DKPD PT +I+ L +Q +I
Sbjct: 259 LDTDITGMVTFILSQSTLVARFLKHIDNPPLLDFLLKVISSDKPDAPTRVIQCLKEQGLI 318

Query: 306 QKCLKFFKNDQYSADVQACASDFLKALIGISANVPLD-EMSVGPNLLSRALASPDVVDHL 364
            + L    + +Y    Q  A+DFLKA + IS N   +   S+GPN L+R L SP++++ L
Sbjct: 319 PRLLDCLSH-EYDPSTQTAAADFLKAFVTISGNCNSEIASSIGPNELTRQLVSPEMMEKL 377

Query: 365 INIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKKF 424
           I I+L   GT+L++ + ++IELIRKNNSDYD + ++ TT  +H P++RDPIYLGYL+  F
Sbjct: 378 IKIMLT-GGTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLVSLF 436

Query: 425 SDKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMGLMNS 484
           +  +      + D    + M R     I     PLGFER K+ ELIAELLHCSNM L+N 
Sbjct: 437 AQYMPEFNKFLLDT--NSTMLRTSFGNIT----PLGFERFKVCELIAELLHCSNMSLLNE 490

Query: 485 KRAEHIALKRDHLR---LQLPHQLQDALQDLEINKTEHXXXXXXXXXXXXXLTTGSVTDE 541
            + E I  +RD  R   L   H     + D E                   + +  +  E
Sbjct: 491 PKGEAIVKERDEERKRVLNFSH-----ISDSEEANMNGDTTTIEGEEITERIDSLKLESE 545

Query: 542 DEDVLIENVSEHPERSFXXXXXXXXXXXXXVAEIDDSFEIP--YINEKQNSK--LRNGPT 597
           +E   I  ++E  + S              VAE  D    P  +I++   ++  +R+   
Sbjct: 546 EE---IRELNEKEDES-------------SVAESSDVEAAPEDHISDSPATEKSIRDEKI 589

Query: 598 IGDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLF 657
           +GD  K  LYD              PWNNF HNV+FDIIQQ+FNG +   YN F++  L 
Sbjct: 590 VGDVLKTLLYDTGIVVNIVKMFFQFPWNNFLHNVVFDIIQQIFNGPLKTGYNIFLLKDLL 649

Query: 658 NLEKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLI 717
                +Q                         +L G  +S E+ E+    LGYMGHL LI
Sbjct: 650 TRAHLTQ------------------------LLLDGDTRSREYEERTHFRLGYMGHLTLI 685

Query: 718 AEEVVKFSKLY---KVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILGGG-----S 769
            EE++KF+      KV     DI   LQ+  WI Y D +L  TR  Y   LG       S
Sbjct: 686 GEEILKFAAYLEETKVVFTEDDIVDALQDSAWIEYADTILADTREKYETALGENEDDDQS 745

Query: 770 FVDDG 774
            ++DG
Sbjct: 746 LIEDG 750

>YKR028W (SAP190) [3283] chr11 (493900..497196) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3297 bp, 1098 aa]
          Length = 1098

 Score =  303 bits (777), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 220/602 (36%), Positives = 314/602 (52%), Gaps = 72/602 (11%)

Query: 188 HKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPL-LPI-----FLKV 241
            +A I + ILS D W IS ++++N + L  +WS+L        D P  LPI     F+K+
Sbjct: 214 RRARIAAEILSADVWPISAAIMQNKDLLGRLWSIL--------DHPAPLPIPASTYFMKI 265

Query: 242 NESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDD 301
           NE LL       L FI +R +LV  F  H++ P L+DFLLK+I+TDKPD PTG+I++L  
Sbjct: 266 NERLLDMDITGMLEFILSRDSLVARFLTHVDNPSLMDFLLKVISTDKPDSPTGVIKILKS 325

Query: 302 QRVIQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLDEMS-VGPNLLSRALASPDV 360
           Q +I K L    N +Y    Q+ A DF+KA + +S N   +  S +GPN L+R L S ++
Sbjct: 326 QELIPKLLDHL-NPEYGISTQSAAGDFIKAFVTLSTNSSNELASGIGPNELTRQLVSEEM 384

Query: 361 VDHLINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYL 420
           ++ LI I+L + GT+L++ + ++IELIRKNNSDYD I L+ TT  SH P++RDPI+L +L
Sbjct: 385 IEKLIKIML-KGGTSLSNGVGIIIELIRKNNSDYDFIQLVYTTLESHPPTDRDPIHLIHL 443

Query: 421 LKKFSDKIENIFALVDDMADKTIMKRIRINQINQEFQPLGFERIKIVELIAELLHCSNMG 480
           +K F+  + + FA   DM DKT +  + +   N   +PLGFER KI ELIAELLHCSNM 
Sbjct: 444 VKLFAKHMPD-FA---DMLDKTKLPLMEMPFGN--IEPLGFERFKICELIAELLHCSNMT 497

Query: 481 LMNSKRAEHIALKRDHLRLQLPHQLQDALQDLEI-----NKTEHXXXXXXXXXXXXXLTT 535
           L+N    E IA +RD   ++   +L+ + +   I     NK+ +             L  
Sbjct: 498 LLNEPNGEMIAQERD---IERAKELETSTEKENITAIVDNKSSYYDKDCVEKDITENLGA 554

Query: 536 ------GSVTDEDEDVLIENVSEHPERSFXXXXXXXXXXXXXVAEIDDSFEIPYINEKQN 589
                 GS  DE  D  + +V +   +S              V   D++       E   
Sbjct: 555 LQINNQGSEEDELNDTGVSSV-KLDVKSDAKVVEGLENDASGVELYDETLS---DTESVR 610

Query: 590 SKLRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYN 649
             LR  P +GDR KI L D +            PWNNF HNVIFDI QQ+FNG +   YN
Sbjct: 611 ECLREKPLVGDRLKIALEDTKILISILDMFTEFPWNNFLHNVIFDIAQQIFNGPLKTGYN 670

Query: 650 SFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNL- 708
            F++                       +  L +  +TK  +     K+ + YEK KT L 
Sbjct: 671 RFLL-----------------------KDYLVDAYLTKKIV--DADKACQDYEK-KTGLR 704

Query: 709 -GYMGHLVLIAEEVVKFSKL---YKVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKI 764
            GYMGHL L+AEE+ KF +     K+   +  +   L+E  W  Y + +L  TR  Y+ +
Sbjct: 705 YGYMGHLTLVAEEISKFKEYIDEMKLTFCNTAVSDRLEEPFWKEYSETILADTREKYNTV 764

Query: 765 LG 766
           LG
Sbjct: 765 LG 766

>Kwal_26.7346
          Length = 747

 Score =  290 bits (742), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 192/530 (36%), Positives = 267/530 (50%), Gaps = 80/530 (15%)

Query: 254 LNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRVIQKCLKFFK 313
           L+FI  +  LVD F KH++ P L+D+LLK+I+TDKPD  TG+IE LD Q +I K L    
Sbjct: 2   LHFILAQDNLVDRFLKHIDNPPLMDYLLKVISTDKPDTTTGVIERLDSQDLIPKLLDHLA 61

Query: 314 NDQYSADVQACASDFLKALIGISANVPLDEMS-VGPNLLSRALASPDVVDHLINIILNEN 372
           +  +S   ++ A DFLKALI ISAN   +  S +GPN L+R L SP +V+ L+NI+L+  
Sbjct: 62  S-VHSPSTKSAAGDFLKALITISANSNNEIASAIGPNGLTRKLVSPSMVEKLMNIMLS-G 119

Query: 373 GTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKKFSDKIENIF 432
           GT+L++ + ++IELIRKNNSDYD + ++ TT  +H P++RDPIYLGYL+K  +  +    
Sbjct: 120 GTSLSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLIKCSAKHLPEF- 178

Query: 433 ALVDDMADKTIMKRIRINQINQEF---QPLGFERIKIVELIAELLHCSNMGLMNSKRAEH 489
                     I+    +  +   F   +PLGFER KI EL+AELLHCSNM L+N    E 
Sbjct: 179 --------NKILVETELPPLETPFGSIEPLGFERFKICELVAELLHCSNMTLLNEPNGEE 230

Query: 490 IALKRDHLRLQLPHQLQ----DALQDLE------INKTEHXXXXXXXXXXXXXLTTGSVT 539
           I  +RD +R +  H  Q    +   D E      ++K                     + 
Sbjct: 231 IVSERDAVREKSLHAEQTDNNEGTADTEDESEDVLDKMSDLRIATTTSSSSDEDNNSHMK 290

Query: 540 DEDEDVLIENVSEHPERSFXXXXXXXXXXXXXVAEIDDSFEIPYINEKQNSKLRNGPTIG 599
           ++D++V  E  SE    S                      EIP         LR  P +G
Sbjct: 291 EDDDEVGGEIHSEGSADS----------------------EIP------EKVLRENPVVG 322

Query: 600 DRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNL 659
           D+ KI L DN+            PWNNF HNV+FDI+QQ+FNG +   +N F++  LF  
Sbjct: 323 DQLKIALQDNRVITTILEMFFAFPWNNFLHNVVFDIVQQIFNGPLKTGFNRFLIADLFTG 382

Query: 660 EKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAE 719
            K +                          I+ G +K  ++  +    LGYMGHL LIAE
Sbjct: 383 AKLTH------------------------MIMEGDKKCEDYENETGLRLGYMGHLTLIAE 418

Query: 720 EVVKFSKL---YKVELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILG 766
           EV KF+      K+   +  I   L E  W  Y + VL  TR  YS +LG
Sbjct: 419 EVAKFAAYVEEMKISFSNQAITDSLDEPSWKEYTETVLADTRENYSSVLG 468

>YJL098W (SAP185) [2817] chr10 (241999..245175) Protein that
           associates with and contributes to function of the
           protein phosphatase Sit4p [3177 bp, 1058 aa]
          Length = 1058

 Score =  236 bits (602), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 199/319 (62%), Gaps = 19/319 (5%)

Query: 188 HKATIISNILSFDEWLISESLIKNMNYLNEIWSVL---SNVKLETEDSPLLPIFLKVNES 244
            +A I + ILS D W IS +LI+N   L ++WS+L   S + +E         F+K+NE 
Sbjct: 207 RRARIAAEILSADVWPISSALIENEGLLAKLWSILRLPSPLSIEAS-----TYFMKINER 261

Query: 245 LLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKLIATDKPDYPTGIIELLDDQRV 304
           LL    D  + FI  ++ +VD+F  H++ P L+DFLLK+I+TDKP+   G+I+L   Q +
Sbjct: 262 LLDMNMDGIIEFILKKEHIVDDFLAHIDNPPLMDFLLKVISTDKPEISNGVIQLFKKQNL 321

Query: 305 IQKCLKFFKNDQYSADVQACASDFLKALIGISANVPLD-EMSVGPNLLSRALASPDVVDH 363
           + K +    +  + +  Q+ A DFLKAL+ IS N P +   S+GPN L+R L SP+++  
Sbjct: 322 VPKLIHLL-DPVFDSCTQSAAGDFLKALVTISGNCPNEITSSIGPNELTRQLVSPNMMKQ 380

Query: 364 LINIILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGYLLKK 423
           L++I+L + G +LN+ + ++IELIRKNNSDYD I    TT  SH P++RDPIYLGYL+K 
Sbjct: 381 LMDIML-KGGNSLNNGVGIIIELIRKNNSDYDTIQTNYTTIESHPPTDRDPIYLGYLVKM 439

Query: 424 FSDKIENIFALVDDMADKTIMKRIRINQIN-QEFQPLGFERIKIVELIAELLHCSNMGLM 482
           FS+ + +   ++ +       K+I + Q +    +PLGFER KI ELIAELLHCSNM L+
Sbjct: 440 FSEHMADFNKILTE-------KKIPLLQTSYGTIEPLGFERFKICELIAELLHCSNMTLL 492

Query: 483 NSKRAEHIALKRDHLRLQL 501
           N   A  I  +RD  R ++
Sbjct: 493 NEPSAYDIVRERDAERERI 511

 Score = 99.4 bits (246), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 87/178 (48%), Gaps = 27/178 (15%)

Query: 592 LRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNNFWHNVIFDIIQQLFNGRMDFSYNSF 651
            R  P +GD+ KI+L D +             WNNF HNV++D++QQ+FNG +   YN F
Sbjct: 622 FRVSPNVGDQLKISLQDTRVIDTMLEMFFHFQWNNFLHNVVYDVVQQIFNGPLKIGYNRF 681

Query: 652 IVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYEKWKTNLGYM 711
           ++                         LL N  +T D I+ G  +  E+ +   T LGYM
Sbjct: 682 LL-----------------------DDLLINIRLT-DMIINGNNECIEYEKGHDTRLGYM 717

Query: 712 GHLVLIAEEVVKFSKLYK---VELISPDIQKILQEKEWIFYMDEVLHSTRIMYSKILG 766
           GHL LIAEEV KF+   +   +   + ++   L E +WI Y ++VL   +  Y+ ILG
Sbjct: 718 GHLTLIAEEVTKFTAYIEEMNITFENTEVMSSLFESKWIAYTEDVLEDLKEKYNAILG 775

>Scas_675.36
          Length = 557

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 107/337 (31%), Positives = 156/337 (46%), Gaps = 44/337 (13%)

Query: 459 LGFERIKIVELIAELLHCSNMGLMNSKRAEHIALKRDHLRLQLPHQLQD----ALQDLEI 514
           LGFE+ KI ELIAELLHCSNM L+N    E I  +RD  R+++  Q +D       DL+ 
Sbjct: 1   LGFEKFKICELIAELLHCSNMTLLNEPNGEAIVTERDLERVKMFSQEEDNDMNGTADLQE 60

Query: 515 NKTEHXXXXXXXXXXXXXLTTGSVTDEDEDVLIEN----VSEHPERSF----XXXXXXXX 566
              E+                  +  E E ++ E      +EH +               
Sbjct: 61  EIEENSVAEKSSNGGEVTEKLNKLKIEPEQIISETNEEIETEHEDNDTDPVNTNDELDVA 120

Query: 567 XXXXXVAEIDDSFEIPYINEKQNSKLRNGPTIGDRFKINLYDNQXXXXXXXXXXXNPWNN 626
                 AEI D  E    +E   + LR  P  GD+ KI+L +               WNN
Sbjct: 121 NGEVETAEIYD--ETLSDSEATEALLRENPIPGDQLKISLRETGIIRTILEMFFHFEWNN 178

Query: 627 FWHNVIFDIIQQLFNGRMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNIT 686
           F HNV+FDI+QQ+FNG +  +YN F++  L                 + ++I+       
Sbjct: 179 FLHNVVFDIVQQIFNGPLRTTYNRFLLGDLL----------------TGSEIIH------ 216

Query: 687 KDFILLGYQKSYEFYEKWKTNLGYMGHLVLIAEEVVKFSKL---YKVELISPDIQKILQE 743
              +L G +K     EK    +GYMGHL+LIAEE+ KF +     K+   +P IQ+ L E
Sbjct: 217 --LVLDGDKKCAAQQEKHGLRIGYMGHLMLIAEEIAKFIEYIEEMKISFSNPAIQECLNE 274

Query: 744 KEWIFYMDEVLHSTRIMYSKILGGGSFV-DDGNGNVV 779
            +W  YM  +L  TR+ Y+ +L  G FV +DG+G+++
Sbjct: 275 PQWREYMATILADTRVKYNTVL--GDFVSEDGSGDLI 309

>Kwal_26.7343
          Length = 282

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 10/62 (16%)

Query: 189 KATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPI----FLKVNES 244
           +A + + ILS D W IS + + +   L+++WS+L +       +PL  +    F+K+NE 
Sbjct: 213 RARMAAEILSADVWPISSAFMDHEELLSQLWSMLDHP------APLSIVASTYFMKINER 266

Query: 245 LL 246
           LL
Sbjct: 267 LL 268

>CAGL0J00693g complement(61246..66900) similar to sp|P08964
           Saccharomyces cerevisiae YHR023w MYO1, hypothetical
           start
          Length = 1884

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 93/211 (44%), Gaps = 27/211 (12%)

Query: 309 LKFFKNDQ---YSADVQACASDFLKALIGISANVPLDEMSVGPNLLSRALASPDVVDHLI 365
           LK  K DQ    + +  A  ++  K ++   A++  D   V  N   + L S  V++   
Sbjct: 148 LKSKKQDQSILVTGESGAGKTENTKKILQYLASITSDSFEVSNNFEMKILQSNPVLESFG 207

Query: 366 N--IILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLGY-LLK 422
           N   + N N +     I +  +   K N  + E  LLE +  ++   N    ++ Y LLK
Sbjct: 208 NAQTVRNNNSSRFGKFIKIEFDQSGKINGAFIEWYLLEKSRITNENRNERNYHIFYQLLK 267

Query: 423 KFSDK-IENIFALV-DDMADKTIMKRIRINQI------NQEFQPL-------GFERIKI- 466
             S K +E+I+ L  +D A   I+     N +        EFQ L       GF + +I 
Sbjct: 268 GTSQKDLESIYKLSSNDFAHYQIL--ANSNHVIPGVDDAAEFQKLLVALETVGFGKDQIN 325

Query: 467 --VELIAELLHCSNMGLMNSKRAEHIALKRD 495
              +++A +LHC N+  + S+++E  + K D
Sbjct: 326 SIFKIVAVILHCGNIEFV-SEKSEQASFKSD 355

>KLLA0E05247g complement(472583..475879) similar to sp|Q12749
           Saccharomyces cerevisiae YLR383w RHC18 recombination
           repair protein, start by similarity
          Length = 1098

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 46/99 (46%), Gaps = 12/99 (12%)

Query: 185 NFLHKATIISNILSFDEWLISESLIKNMNYLNEIWSVLSNVKLETEDSPLLPIFLKVNES 244
           +F H  TI++ + S ++W+    L++  +    +W V      +T +  L  I  K  E+
Sbjct: 266 DFEHAQTILTELASKNDWITRRRLLQGKH----MWMV-----CQTNNEKLKAI--KTREN 314

Query: 245 LLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDFLLKL 283
            L ++K +Y+N I   K  V+ +        LLD   KL
Sbjct: 315 TLSAKKQEYVNRIADMKNKVERYLIQKE-EALLDLGRKL 352

>KLLA0C07128g 617725..620925 weakly similar to sp|Q03660
           Saccharomyces cerevisiae YMR218c TRS130 TRAPP subunit of
           130 kDa involved in targeting and fusion of ER to golgi
           transport vesicles singleton, start by similarity
          Length = 1066

 Score = 31.2 bits (69), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 7/71 (9%)

Query: 367 IILNENGTALNHTISVVIELIRKNNSDYDEINLLETTTRSHLPSNRDPIYLG-------Y 419
           ++L+ N   L+  I   + LI K N D+  +  LET T       R+  + G       Y
Sbjct: 114 VVLHSNKEVLDSNIFKSVSLIEKFNKDFPSLKTLETKTVYRSNDERETFWNGLINKLKHY 173

Query: 420 LLKKFSDKIEN 430
           LL+ F ++IE+
Sbjct: 174 LLEVFENRIES 184

>Sklu_2186.2 YHR028C, Contig c2186 1993-4461 reverse complement
          Length = 822

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 56/132 (42%), Gaps = 25/132 (18%)

Query: 239 LKVNESLLLSRKDQYLNFIRTRKTLVDEFFKHMNIPVLLDF------LLKLIATDKPDYP 292
           L+ + +L  S K  YL+F +T +T V+EF     IP  +         +++I   K   P
Sbjct: 249 LEGDTALWWSPKGDYLSFFKTNETEVNEF----PIPYFVQHENDVYPEVRVIKYPKSGTP 304

Query: 293 TGIIEL--------------LDDQRVIQKCLKFFKNDQYSADVQACASDFLKA-LIGISA 337
             ++ L              +DD+ V+   +K+  +D   A V   +SD L   L+  S 
Sbjct: 305 NPMVSLNIYDLNSKKTSAVEIDDKSVLITEVKWVGDDSILAKVTDRSSDVLSVILVDASN 364

Query: 338 NVPLDEMSVGPN 349
           N     + V P+
Sbjct: 365 NASFKTVRVNPS 376

>CAGL0L03047g 350035..352182 similar to sp|P36120 Saccharomyces
           cerevisiae YKR024c DBP7 RNA helicase, start by
           similarity
          Length = 715

 Score = 30.0 bits (66), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 62/141 (43%), Gaps = 24/141 (17%)

Query: 643 RMDFSYNSFIVYSLFNLEKASQFKKTDSNANSNNQILLGNFNITKDFILLGYQKSYEFYE 702
           + D + NS IV SLF   +A Q  +  +  NS+++++  N  +T D        S+E   
Sbjct: 80  KADVNINSQIVSSLFTSNRAKQTSENKNKHNSDDKVVPSNAPLTDD--------SFE--- 128

Query: 703 KWKTNLGYMGHLVLIAEEVVKFSKLYKVELISPDIQKILQEKEWI-FYMDEVLHSTRIM- 760
                LG    +V   E  ++  K   ++ +   I +ILQ  +   F++     S + + 
Sbjct: 129 ----GLGVGSLVVSHLENKMRIQKSTSIQKVV--IPQILQNADKTDFFIHAQTGSGKTLA 182

Query: 761 -----YSKILGGGSFVDDGNG 776
                +S ILG G  +D  +G
Sbjct: 183 YLLPIFSAILGMGDHIDRKSG 203

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.137    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,221,577
Number of extensions: 1232805
Number of successful extensions: 4200
Number of sequences better than 10.0: 43
Number of HSP's gapped: 4260
Number of HSP's successfully gapped: 64
Length of query: 828
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 718
Effective length of database: 12,788,129
Effective search space: 9181876622
Effective search space used: 9181876622
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)