Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_712.201861869751e-137
YGL231C1901855391e-70
CAGL0H07953g1831844826e-62
Kwal_47.192101811804574e-58
AFR249W1811844174e-52
KLLA0A01067g2021833212e-37
Sklu_2433.1379791416e-12
KLLA0E12089g214842651.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_712.20
         (186 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_712.20                                                           380   e-137
YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein o...   212   1e-70
CAGL0H07953g complement(776742..777293) similar to sp|P53073 Sac...   190   6e-62
Kwal_47.19210                                                         180   4e-58
AFR249W [3441] [Homologous to ScYGL231C - SH] complement(886552....   165   4e-52
KLLA0A01067g complement(100259..100867) weakly similar to sp|P53...   128   2e-37
Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement      59   6e-12
KLLA0E12089g 1068487..1074933 similar to sp|P43583 Saccharomyces...    30   1.8  

>Scas_712.20
          Length = 186

 Score =  380 bits (975), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 186/186 (100%), Positives = 186/186 (100%)

Query: 1   MSVEPFEWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVGKNQHESQGNKATEAIRMKE 60
           MSVEPFEWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVGKNQHESQGNKATEAIRMKE
Sbjct: 1   MSVEPFEWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVGKNQHESQGNKATEAIRMKE 60

Query: 61  LNNLLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAF 120
           LNNLLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAF
Sbjct: 61  LNNLLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAF 120

Query: 121 KPVLGNKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNIG 180
           KPVLGNKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNIG
Sbjct: 121 KPVLGNKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNIG 180

Query: 181 RKVFAF 186
           RKVFAF
Sbjct: 181 RKVFAF 186

>YGL231C (YGL231C) [1767] chr7 complement(63047..63619) Protein of
           unknown function, has moderate similarity to
           uncharacterized S. pombe Spcc1281.03cp [573 bp, 190 aa]
          Length = 190

 Score =  212 bits (539), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 109/185 (58%), Positives = 127/185 (68%), Gaps = 3/185 (1%)

Query: 4   EPFEWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVGKNQHESQGNKATEAIRMKELNN 63
           EP+EWA  L + K  E  +     TLPSPPG+       N    Q +  ++   + + N 
Sbjct: 5   EPYEWAKHLLDTKYIEKYNIQNSNTLPSPPGFEGNSSKGNVTRKQQDATSQTTSLAQKNQ 64

Query: 64  ---LLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAF 120
              L  QKA  IA+QPAKSIPMN+ MSYMSGTSLQIIPIM ALMLLSGP+KAIFS R+AF
Sbjct: 65  ITVLQVQKAWQIALQPAKSIPMNIFMSYMSGTSLQIIPIMTALMLLSGPIKAIFSTRSAF 124

Query: 121 KPVLGNKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNIG 180
           KPVLGNK  QSQV +AMF+YIVFQG LMYIG RKLN+MGLIPN K DWL WE    YN G
Sbjct: 125 KPVLGNKATQSQVQTAMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDWLPWERIAHYNNG 184

Query: 181 RKVFA 185
            + F+
Sbjct: 185 LQWFS 189

>CAGL0H07953g complement(776742..777293) similar to sp|P53073
           Saccharomyces cerevisiae YGL231c, hypothetical start
          Length = 183

 Score =  190 bits (482), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 121/184 (65%), Gaps = 12/184 (6%)

Query: 7   EWAVKLCNLKEEEATDSSAIKTLPSPPGY----GVVEVGKNQHESQGNKATEAIRMKELN 62
           EW   L N +  +    S + T PSP GY    G V   KN    Q NK        ++ 
Sbjct: 8   EWVENLLNPQIVKEWQQSTVNT-PSPQGYQGLSGSVRDKKNTSNKQVNKP-------DIA 59

Query: 63  NLLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAFKP 122
           NL  QKA  IA+QPAKSIPMN  MSYMSGTSLQIIPIM ALMLLSGP+K+IF+IR  FKP
Sbjct: 60  NLQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKP 119

Query: 123 VLGNKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNIGRK 182
           VLGN + Q+Q+   M LY+ FQG LM+IG++KLN MGLIPN  SDW+ WE   DYN G +
Sbjct: 120 VLGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYNKGIR 179

Query: 183 VFAF 186
           VF+F
Sbjct: 180 VFSF 183

>Kwal_47.19210
          Length = 181

 Score =  180 bits (457), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 93/180 (51%), Positives = 122/180 (67%), Gaps = 5/180 (2%)

Query: 7   EWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVGKNQHESQGNKATEAIRMKELNNLLA 66
           EWA  LC+    +  +     +LPSPPG+  + V  ++   + + + EA   + L +L+ 
Sbjct: 7   EWAQNLCDPDYVQKINVVTSNSLPSPPGFKTLSVSTSKPSKKTSNSAEA---ENLASLMV 63

Query: 67  QKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAFKPVLGN 126
           QKA  I+ QPAKSIPMNMI+SYMSGTSLQII IM ALM +S P+K++ +IR  FKPV+GN
Sbjct: 64  QKAWQISFQPAKSIPMNMIVSYMSGTSLQIISIMTALMFVSNPIKSVINIRRTFKPVMGN 123

Query: 127 KEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNIGRKVFAF 186
            E+Q QV SAM +++VFQ  LM IGI KLN+MGLIPNTKSDWL  E P  Y    + +AF
Sbjct: 124 PEVQPQVLSAMIMFVVFQAMLMGIGIHKLNSMGLIPNTKSDWLFLEKPAIYK--DRSYAF 181

>AFR249W [3441] [Homologous to ScYGL231C - SH]
           complement(886552..887097) [546 bp, 181 aa]
          Length = 181

 Score =  165 bits (417), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 88/184 (47%), Positives = 118/184 (64%), Gaps = 3/184 (1%)

Query: 1   MSVEPFEWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVGKNQHESQGNKATEAIRMKE 60
           MS E   WA  L   +  ++    +  TLP PPG+   +  K+Q  S   +  EA R + 
Sbjct: 1   MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQ--KSQTRSVSKEEGEANR-ER 57

Query: 61  LNNLLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFSIRAAF 120
           +N L  +KA  +A QP+K+IPMN  MSYMSGTSLQIIPIM ALMLL+GP+K++  +R+ F
Sbjct: 58  INALQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALMLLTGPVKSVLQVRSTF 117

Query: 121 KPVLGNKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELPVDYNIG 180
           K +L N+    QV +AM LY+ FQ  LM IG++KLNAMGL+PN  SDWL WE P+ Y++ 
Sbjct: 118 KGLLNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPNKHSDWLAWETPMAYSMQ 177

Query: 181 RKVF 184
              F
Sbjct: 178 SYAF 181

>KLLA0A01067g complement(100259..100867) weakly similar to sp|P53073
           Saccharomyces cerevisiae YGL231c singleton, start by
           similarity
          Length = 202

 Score =  128 bits (321), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 112/183 (61%), Gaps = 16/183 (8%)

Query: 1   MSVEPFEWAVKLCNLKEEEATDSSAIK--TLPSPPGYGVVEVGKNQHESQGNKATEAIRM 58
           MS +  +WA    +LK ++    +++    LP P G   +E+       +G K  + I  
Sbjct: 23  MSEDIPQWA---KDLKVDKVMRRNSVNGGKLPDPFGIKKLEI-------EGQKPPKVIDH 72

Query: 59  KELNN---LLAQKAMSIAMQPAKSIPMNMIMSYMSGTSLQIIPIMAALMLLSGPLKAIFS 115
              N    L A++A  I+ +P KS+PMN+IMSYMSG SLQIIPIM A+ML+S P+K+I  
Sbjct: 73  DAQNRIAKLTAERAWQISSEPLKSVPMNIIMSYMSGNSLQIIPIMTAVMLVSNPIKSILG 132

Query: 116 IRAAFKPVLG-NKEIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWLTWELP 174
           +++ F+ ++  + ++   V +AM +Y+++Q  LM IG+ KLN+MGL P T SDWL W+ P
Sbjct: 133 VKSKFQHLINKDNDVTPPVVAAMIMYVIYQLILMGIGLHKLNSMGLFPTTSSDWLAWQQP 192

Query: 175 VDY 177
            +Y
Sbjct: 193 TEY 195

>Sklu_2433.13 YGL231C, Contig c2433 22436-22670 reverse complement
          Length = 79

 Score = 58.9 bits (141), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 51/79 (64%), Gaps = 7/79 (8%)

Query: 1  MSVEPFEWAVKLCNLKEEEATDSSAIKTLPSPPGYGVVEVG--KNQHESQGNKATEAIRM 58
          M+V+P +WA  LCN K  ++   ++  TLPSPPG+ +V  G  KN++++  NK+ E    
Sbjct: 1  MNVQPPQWATDLCNPKHAKSLTVASSNTLPSPPGFKLVSEGSSKNKNDN-ANKSKE---- 55

Query: 59 KELNNLLAQKAMSIAMQPA 77
          K++N L  QKA  +A+QPA
Sbjct: 56 KDINGLQVQKAWELALQPA 74

>KLLA0E12089g 1068487..1074933 similar to sp|P43583 Saccharomyces
           cerevisiae YFL007w BLM3 singleton, start by similarity
          Length = 2148

 Score = 29.6 bits (65), Expect = 1.8,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 128 EIQSQVNSAMFLYIVFQGALMYIGIRKLNAMGLIPNTKSDWL 169
           EI+S ++ A +LY +     +Y+ I+ ++  GLI  T  D L
Sbjct: 127 EIESHLDQAKYLYHIVTN--LYVAIKSMDVQGLISITSQDLL 166

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.132    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,452,852
Number of extensions: 192131
Number of successful extensions: 469
Number of sequences better than 10.0: 11
Number of HSP's gapped: 464
Number of HSP's successfully gapped: 11
Length of query: 186
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 90
Effective length of database: 13,272,781
Effective search space: 1194550290
Effective search space used: 1194550290
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 58 (26.9 bits)