Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_712.1888288244580.0
YGL233W (SEC15)91091027390.0
CAGL0H07909g88289725800.0
Sklu_2433.1188489423570.0
AFR251C86888022030.0
KLLA0A01023g86184820640.0
Kwal_47.1921487689220520.0
AEL281C139080722.5
KLLA0D11220g47755703.4
Kwal_47.1742022028683.8
KLLA0E11033g1606139686.1
AER074W64367678.1
Scas_703.40899111679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_712.18
         (882 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_712.18                                                          1721   0.0  
YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst ...  1059   0.0  
CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces c...   998   0.0  
Sklu_2433.11 YGL233W, Contig c2433 17844-20498                        912   0.0  
AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH] (888186..8...   853   0.0  
KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces cer...   799   0.0  
Kwal_47.19214                                                         795   0.0  
AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH] (111535..11...    32   2.5  
KLLA0D11220g 958249..959682 weakly similar to sp|Q04347 Saccharo...    32   3.4  
Kwal_47.17420                                                          31   3.8  
KLLA0E11033g complement(969999..974819) similar to sp|P52593 Sac...    31   6.1  
AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH] complement(...    30   8.1  
Scas_703.40                                                            30   9.2  

>Scas_712.18
          Length = 882

 Score = 1721 bits (4458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/882 (96%), Positives = 855/882 (96%)

Query: 1   MDQEVLLSQDFQKILLSYEPKKAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDKWVP 60
           MDQEVLLSQDFQKILLSYEPKKAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDKWVP
Sbjct: 1   MDQEVLLSQDFQKILLSYEPKKAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDKWVP 60

Query: 61  FLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDTS 120
           FLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDTS
Sbjct: 61  FLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDTS 120

Query: 121 LSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQELI 180
           LSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQELI
Sbjct: 121 LSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQELI 180

Query: 181 TEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECXXXXXXXXXXX 240
           TEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDEC           
Sbjct: 181 TEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECLNLIRNSLNSN 240

Query: 241 XGKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNLEKF 300
            GKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNLEKF
Sbjct: 241 LGKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNLEKF 300

Query: 301 FHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWKRASNSNANIPPGDISS 360
           FHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWKRASNSNANIPPGDISS
Sbjct: 301 FHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWKRASNSNANIPPGDISS 360

Query: 361 DAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGLMNRLQPYL 420
           DAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGLMNRLQPYL
Sbjct: 361 DAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGLMNRLQPYL 420

Query: 421 RHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRYFDTE 480
           RHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRYFDTE
Sbjct: 421 RHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRYFDTE 480

Query: 481 FEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDEHLEPQEDMSGFSITLPFSPLYPMTCT 540
           FEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDEHLEPQEDMSGFSITLPFSPLYPMTCT
Sbjct: 481 FEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDEHLEPQEDMSGFSITLPFSPLYPMTCT 540

Query: 541 LLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTSREEIAQIL 600
           LLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTSREEIAQIL
Sbjct: 541 LLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTSREEIAQIL 600

Query: 601 INLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKLIDSKVADI 660
           INLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKLIDSKVADI
Sbjct: 601 INLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKLIDSKVADI 660

Query: 661 LETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREFDSLTRRFL 720
           LETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREFDSLTRRFL
Sbjct: 661 LETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREFDSLTRRFL 720

Query: 721 DILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTPLSPVFNGT 780
           DILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTPLSPVFNGT
Sbjct: 721 DILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTPLSPVFNGT 780

Query: 781 NNGHSPELIENNVKSLEETFIELRQYIELLKTGNEYMDPDLRMRKYSRVKPEHANILMRK 840
           NNGHSPELIENNVKSLEETFIELRQYIELLKTGNEYMDPDLRMRKYSRVKPEHANILMRK
Sbjct: 781 NNGHSPELIENNVKSLEETFIELRQYIELLKTGNEYMDPDLRMRKYSRVKPEHANILMRK 840

Query: 841 VRVTPIMXXXXXXXXXXXXXXXIFTRDFNGSDSRIAKFFNRR 882
           VRVTPIM               IFTRDFNGSDSRIAKFFNRR
Sbjct: 841 VRVTPIMSPSDTPQQQDDDSSSIFTRDFNGSDSRIAKFFNRR 882

>YGL233W (SEC15) [1765] chr7 (59121..61853) Component of exocyst
           complex required for exocytosis [2733 bp, 910 aa]
          Length = 910

 Score = 1059 bits (2739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/910 (58%), Positives = 687/910 (75%), Gaps = 28/910 (3%)

Query: 1   MDQEV--LLSQDFQKILLSYEPKKAETTTS----HDKEENASEYKDLGMEEDAFELDPQS 54
           MDQE   LLS+DFQ++LL+       + T     +++  +A +++    + D F+LDP S
Sbjct: 1   MDQEGQPLLSKDFQQVLLATASGNNSSWTERAVLNNESTDAVKHEPALGQNDVFDLDPLS 60

Query: 55  FDKWVPFLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQ 114
           FDKWVPFLR A++KNQL  +I EL+ SI+DNFQGLELQLLQDSQ+NDKLETSI+EI+NIQ
Sbjct: 61  FDKWVPFLRRALDKNQLDPVIDELENSIEDNFQGLELQLLQDSQMNDKLETSIDEIANIQ 120

Query: 115 NMIDTSLSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSS 174
            M+  +LS  I   Q +L+++ NELI+KKQ++VNNKK SLKISE TIL+TKVVRILELSS
Sbjct: 121 GMVQDTLSSEISKFQIRLSESANELIVKKQMYVNNKKISLKISEATILITKVVRILELSS 180

Query: 175 KCQELITEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECXXXXX 234
           KCQELITE  FFK LQNLDSLEK+YLQEF+NYNF+FL EIY+SIP+L+ VTKDEC     
Sbjct: 181 KCQELITERKFFKVLQNLDSLEKLYLQEFKNYNFQFLIEIYNSIPFLQKVTKDECINLIR 240

Query: 235 XXXXXXXGKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKK 294
                  GKNL  VG  F   Y+NELLP+WLE +  MKL  FKFNSP+EISMRD++ L K
Sbjct: 241 NSLNLNLGKNLIKVGQEFVAIYENELLPQWLETRSKMKLTNFKFNSPIEISMRDESFLAK 300

Query: 295 LNLEKFFHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWK---------- 344
           LNL +FF +++F+DSIMIFQ LN+L  L  EF+KEYE RKTKL+YPL+WK          
Sbjct: 301 LNLGEFFQLDDFHDSIMIFQNLNELSVLSGEFNKEYELRKTKLMYPLIWKKNKTAAYQMD 360

Query: 345 ---RASNSNANIPPGDISS-DAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDN 400
              R + +       D+S+ D FT+ ++L FL++YF KILGFLLYDINLNK+T+F+LVDN
Sbjct: 361 SLLRGTGTTPGSTAHDVSTDDPFTQSLSLHFLQDYFLKILGFLLYDINLNKATEFILVDN 420

Query: 401 NYNATNEFWDGLMNRLQPYLRHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYE 460
           NYN+TNEFWDGLM+RL PYL +FI   L  ++  ++ KDF+CIYVAILEN+KL+I+PLY+
Sbjct: 421 NYNSTNEFWDGLMDRLSPYLSYFIDEKLKTEEDMIKLKDFLCIYVAILENFKLNIEPLYK 480

Query: 461 ILILLFDRYCDISIRYFDTEFEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDEHLEPQE 520
           IL+ +F+++C +S+R FD EF++LLNDDDFMPL+INDKTL++KV +ICWMKE EHL   +
Sbjct: 481 ILVSIFEKFCSVSLRAFDDEFQILLNDDDFMPLSINDKTLYEKVLKICWMKEGEHLSLPD 540

Query: 521 DMSG--FSITLPFSPLYPMTCTLLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFID 578
             +G  F++TLPFSPLYPMTCTL KK YSK+T+F+++FYRH+L  LN +LV  +D IF D
Sbjct: 541 PTNGEPFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHELHTLNNILVKTMDDIFND 600

Query: 579 IVNKKIRAKLQSTSREEIAQILINLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDL 638
           IVNKKIR+KL+STSREEIAQIL+NLDYFI+A K FS  MT  NI+QNPD+EI+L S K L
Sbjct: 601 IVNKKIRSKLESTSREEIAQILVNLDYFIIAAKEFSNFMTRENILQNPDMEIRLSSIKYL 660

Query: 639 KDSRKYAEGKLIKLIDSKVADILETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLIN 698
            +SRK AE KLI+LIDSK++DILET+++DW   E+ QDPDISI+D+AQFLEMMFA+TL N
Sbjct: 661 AESRKLAETKLIELIDSKISDILETIEIDWQITEVRQDPDISIIDLAQFLEMMFASTLQN 720

Query: 699 LPYSIQILLIFREFDSLTRRFLDILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRD 758
           LPYS+Q LLIFREFDSLTR+F+ +LL+DTP  ITHES++NFEV++ YLE IIPRIFPS  
Sbjct: 721 LPYSVQTLLIFREFDSLTRQFMGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFPSTP 780

Query: 759 EEETNITSERMMTPLSPVFNGTNNGHSPELIENNVKSLEETFIELRQYIELLKT-GNEYM 817
               +   +  MTP +P F   N   +P L ENN+KSLE TF+EL+Q IELLKT G +Y 
Sbjct: 781 GTIDSNGYQSPMTPSTPTFPNANGVDAPTLFENNIKSLEATFMELKQCIELLKTQGKDYN 840

Query: 818 DPDLRMRKYSRVKPEHANILMRKVR-VTPIMXXXXXXXXXXXXXXXIFTRD----FNGSD 872
           +P++R+RKYSR++ E A +L+ K++     +               IF  +     + + 
Sbjct: 841 EPEIRLRKYSRIRQEDAALLLSKIQHFVSSVEGANGDDTSVMDSSSIFNSESASVIDSNT 900

Query: 873 SRIAKFFNRR 882
           SRIAKFFNRR
Sbjct: 901 SRIAKFFNRR 910

>CAGL0H07909g 772741..775389 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15, start by similarity
          Length = 882

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/897 (56%), Positives = 670/897 (74%), Gaps = 30/897 (3%)

Query: 1   MDQEV--LLSQDFQKILLSYEPKKAETTTSHDKE------ENASEYKDLGMEEDAFELDP 52
           MDQE   ++S+DFQ +LL  +      ++  D+E      ENA   K + + +   ++D 
Sbjct: 1   MDQETKKVISKDFQDVLL--DTSTVVVSSVFDQENKIVGGENA---KGVDIIDSTLDIDQ 55

Query: 53  QSFDKWVPFLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISN 112
           ++ DKW+P+LR   E +QL T+I EL+ SIDDNFQGLELQLLQDSQ+NDKLETS++EI+ 
Sbjct: 56  RAIDKWIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQLNDKLETSMDEIAE 115

Query: 113 IQNMIDTSLSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILEL 172
           IQ+M++ SLS  I   Q+ LT +TNELI +KQ ++N+KKTSLKISE  IL+ KV+R+LEL
Sbjct: 116 IQSMVELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKISEAIILINKVLRLLEL 175

Query: 173 SSKCQELITEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECXXX 232
           S+KCQELITEGNFFKALQNLDSLEK+YLQEFR+YNFK LKEIY SIPYLKSVTKDEC   
Sbjct: 176 SNKCQELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIYVSIPYLKSVTKDECINL 235

Query: 233 XXXXXXXXXGKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASL 292
                    GKNL  VG +F+  Y++ELL KWL  ++ MKL++ KFNSP+EISMRD+ +L
Sbjct: 236 IKNSLNSNLGKNLNVVGQTFYLIYKDELLSKWLNTREIMKLKRVKFNSPIEISMRDEENL 295

Query: 293 KKLNLEKFFHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWKRASNSNAN 352
           +KL LE+FF+++ F+DS+MIF+TLN+ DYL  EF+KEYEF+K+K I PL WK + N+   
Sbjct: 296 RKLELEQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYEFKKSKTIQPLPWKTSGNT--- 352

Query: 353 IPPGDISSDAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGL 412
           +     + D F + +++ FLKEY   ILGFLLYDINLN+ TD++ V+NNYNATNEFW+ L
Sbjct: 353 VSVNSTAHDEFKESLSVPFLKEYLLNILGFLLYDINLNRLTDYIFVNNNYNATNEFWEML 412

Query: 413 MNRLQPYLRHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDI 472
           M RL+PY ++F+ T L  +   +EFKDF+ IYV I+ENYKL+IDPLY +++ LF++YC  
Sbjct: 413 MMRLKPYFKYFMDTVLKTEKDIIEFKDFLGIYVCIMENYKLNIDPLYSVMLALFEKYCKT 472

Query: 473 SIRYFDTEFEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDEHLEPQEDMSGFSITLPFS 532
           ++  FD +F+V+L+DDDFMPLTI++K  ++KV +ICWMKE+  +    D   FS+TLPFS
Sbjct: 473 TLELFDKDFQVMLSDDDFMPLTIDNKGFYEKVIKICWMKENHQIIDDMDDENFSVTLPFS 532

Query: 533 PLYPMTCTLLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTS 592
           PLYPMTCT+ +K Y+KLTSFI+ FYRH L +LN +LVN ID I   +VNK+IRAKL++TS
Sbjct: 533 PLYPMTCTMTQKVYAKLTSFISSFYRHSLHSLNNILVNTIDGILDGVVNKQIRAKLETTS 592

Query: 593 REEIAQILINLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKL 652
           REEIAQ+LINLDYF++A+K FS +MT+ NI++NPD+EI+L STK+  +SRKYAE KLI L
Sbjct: 593 REEIAQLLINLDYFVIASKEFSNLMTKDNILENPDVEIRLASTKNFAESRKYAESKLIDL 652

Query: 653 IDSKVADILETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREF 712
           ID+K+ DILETV  DW   +   DPDISIVD+AQFLEMMFATTL+NLPYS+QILLIFREF
Sbjct: 653 IDTKIKDILETVSFDWLDTDRRIDPDISIVDLAQFLEMMFATTLVNLPYSVQILLIFREF 712

Query: 713 DSLTRRFLDILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTP 772
           DSLTR FLD+LL+DTP +I+ ESV NFEV++ YLEGIIP+IFP  DE E      +  TP
Sbjct: 713 DSLTRHFLDVLLHDTPQYISKESVGNFEVDMMYLEGIIPKIFPRTDENENGRLGSQ--TP 770

Query: 773 LSPVFNGTNNGHSPELIENNVKSLEETFIELRQYIELLKT--GNEYMDPDLRMRKYSRVK 830
            +P  +  +   S   I+NN+KSLE TF+EL+Q I+LL++   NEY+DP +R RKYSR+K
Sbjct: 771 KTPTIDDESRSQSNSQIDNNIKSLESTFMELKQCIQLLQSEDPNEYLDPQMRSRKYSRIK 830

Query: 831 PEHANILMRKVRVTPIMXXXXXXXXXXXXXXXIFTRDF-----NGSDSRIAKFFNRR 882
           P+ ANIL+ K+R  PI                +F  D+     N  ++R+AKFFNRR
Sbjct: 831 PDDANILIGKIR--PI---TAPAPTNEAENSSVFNLDWNGSDSNNGNNRLAKFFNRR 882

>Sklu_2433.11 YGL233W, Contig c2433 17844-20498
          Length = 884

 Score =  912 bits (2357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/894 (52%), Positives = 643/894 (71%), Gaps = 24/894 (2%)

Query: 1   MDQE--VLLSQDFQKILLSYE-PKKAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDK 57
           MDQE   L+SQ+ QK+LLS +    A   T+ +  + ++    L +++D  ELD QSFD+
Sbjct: 1   MDQEPQSLVSQELQKVLLSSDFSTLASPITAQNNNKQSNTSASL-LQDDIIELDEQSFDR 59

Query: 58  WVPFLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMI 117
           WVP LR+++E + L  +++EL  S+DDNFQ LE ++LQDSQIND L TSINEI +IQ +I
Sbjct: 60  WVPLLRTSIEDSSLTKLVEELFNSVDDNFQSLETRILQDSQINDNLTTSINEIESIQKLI 119

Query: 118 DTSLSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQ 177
           + SL   + +LQ+QL+Q+TN++I+KKQ+ +NN+KTS+KISE  IL+ K+++ILELS++CQ
Sbjct: 120 NGSLQQEVSDLQQQLSQSTNDVILKKQILINNRKTSMKISESMILINKILQILELSNRCQ 179

Query: 178 ELITEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECXXXXXXXX 237
           +LI EG+FFKALQ+LD+LEKIYLQ+F+NYNF FLKEIY+SIP+LKS+ KDE         
Sbjct: 180 DLIKEGDFFKALQSLDNLEKIYLQDFKNYNFDFLKEIYNSIPFLKSIIKDESINLIKKSF 239

Query: 238 XXXXGKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNL 297
                K L  VG  +F+ YQ  LL  WLE+K SMKL  FKFNS VE+++RDQ  L+ L  
Sbjct: 240 TSNLEKTLFTVGSKYFEVYQEVLLKDWLELKHSMKLGNFKFNSSVELALRDQKGLELLKA 299

Query: 298 EKFFHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWKRASNSNA-NIPPG 356
           E F+H++EF+DSI+IFQ L +LDYL  EF KEY+FRK KL+YPL  K  + S++ N    
Sbjct: 300 ENFYHLDEFHDSILIFQNLKELDYLCEEFIKEYDFRKAKLVYPLELKNTTTSSSLNGQNQ 359

Query: 357 DISSDAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGLMNRL 416
               D F + +N+ FLKEY  KILGFL+YD +LNKSTD+VL  N+YN TNEFWD LM +L
Sbjct: 360 SHLDDVFGENLNMSFLKEYLLKILGFLIYDKHLNKSTDYVLSFNSYNTTNEFWDILMKKL 419

Query: 417 QPYLRHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRY 476
            P+L+ F+   L  ++  V+FKDF+ I++AILEN KL+I+ LY I I +F++YC++ +  
Sbjct: 420 APHLQQFVTRNLTTEEELVQFKDFLGIFIAILENLKLNIETLYRIHITVFEKYCNLLVHK 479

Query: 477 FDTEFEVLLNDDDFMPLTINDKTLFQKVSQICWM---KEDEHLEPQEDMSG-FSITLPFS 532
           F  EF  LLNDDDFMPLT ND+ L++KV +ICW+   + ++  E Q+  +G F  TLPFS
Sbjct: 480 FSEEFSTLLNDDDFMPLTTNDRNLYEKVLKICWLKEEEPEKMKEQQDPANGDFLATLPFS 539

Query: 533 PLYPMTCTLLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTS 592
           PLYPM CTL KK Y K+ +F+  FY+H+L  LN +LV  +D IF  +VN KIR+KL +TS
Sbjct: 540 PLYPMACTLAKKTYGKIVTFLNNFYQHELYHLNTILVKTMDSIFQKVVNNKIRSKLDTTS 599

Query: 593 REEIAQILINLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKL 652
           REEIAQ+LINLDYF++A + FS I+T  NI+QNPD+EI+L S + L +SRKYAE KLI+L
Sbjct: 600 REEIAQVLINLDYFVIAAREFSSILTRENIIQNPDVEIRLASAEQLTESRKYAETKLIEL 659

Query: 653 IDSKVADILETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREF 712
           IDSKV+D++E V+LDW +  I Q+PDISI D+AQFLEMMF +TL+NLPYS++ LLIFREF
Sbjct: 660 IDSKVSDLMEFVELDWVATTIKQEPDISIRDIAQFLEMMFTSTLVNLPYSVKTLLIFREF 719

Query: 713 DSLTRRFLDILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTP 772
           DSLTRRFL++LLN TP  IT +SVLNFE+++K+LEGI+ +IFPS  +E   +  E   +P
Sbjct: 720 DSLTRRFLEMLLNGTPSTITPQSVLNFEMDMKFLEGIVSKIFPSETKE---LPFESSPSP 776

Query: 773 LSPVFNGTNNGHSPELIENNVKSLEETFIELRQYIELLKTGN--EYMDPDLRMRKYSRVK 830
            SP+   ++   +  LIENNV+SL+ TF +L+Q+I+L+K  N  EY DP +RMRKY R++
Sbjct: 777 DSPL--QSDQARASNLIENNVRSLQSTFTDLKQHIQLMKASNLEEYKDPSIRMRKYPRIR 834

Query: 831 PEHANILMRKVRV---TPIMXXXXXXXXXXXXXXXIFTRDFNGSDSRIAKFFNR 881
           PE A +L+ KV +   +P                   T     ++SRIAKFFNR
Sbjct: 835 PEVAQLLVSKVAIPSPSPSAGDGDNTSYRGQSPTESLT-----ANSRIAKFFNR 883

>AFR251C [3443] [Homologous to ScYGL233W (SEC15) - SH]
           (888186..890792) [2607 bp, 868 aa]
          Length = 868

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/880 (49%), Positives = 612/880 (69%), Gaps = 31/880 (3%)

Query: 7   LSQDFQKILLSYEPKKAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDKWVPFLRSAV 66
           LSQ+ QK+LL+     AE   + D +    E  D  M      L  Q+F+KWVP+LR AV
Sbjct: 13  LSQELQKVLLT-----AEFAATRDDDYTPGETGDGLMC-----LSDQTFEKWVPYLRQAV 62

Query: 67  EKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDTSLSGGIL 126
           E ++L  +++E+ +S+++NFQ  E Q+LQDSQ++D L  SI+E   IQN+ ++ L G + 
Sbjct: 63  ESDRLDGVVEEVYSSVEENFQNFETQILQDSQVSDNLSFSIDENDRIQNLAESYLQGQVA 122

Query: 127 NLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQELITEGNFF 186
           +LQ  L+ +TNE++ KK+   +N++TS+KISE  IL+ K+ ++LEL++KCQELI +GNF+
Sbjct: 123 DLQAHLSASTNEVVSKKRALTSNRRTSIKISESIILIEKIFQMLELTNKCQELIRDGNFY 182

Query: 187 KALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECXXXXXXXXXXXXGKNLT 246
           KALQNLD LE+IY+ +F+NY F+FL  IY+SIP LK++ KDE              K L+
Sbjct: 183 KALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLKNIIKDESINLIKKSLSSNLEKTLS 242

Query: 247 DVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNLEKFFHIEEF 306
            VG ++F  Y ++LLP WL +KK+MKL  +KFNSPVE+S+RD + L  L LE +++++EF
Sbjct: 243 QVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNSPVEVSLRDDSFLAGLKLEDYYNLDEF 302

Query: 307 YDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWKRASNSNANIPPGDISSDAFTKQ 366
           YDSIMIF++L + +YL  EF+KEY+FRK KL+YPL WK  +    +    +   D+F +Q
Sbjct: 303 YDSIMIFESLKETNYLCDEFTKEYDFRKVKLVYPLDWKSTTTMTHS---ANEQVDSFYQQ 359

Query: 367 MNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGLMNRLQPYLRHFIVT 426
           ++L FLKEY  KILGFLLYD  L+KSTD++   N Y  T EFW+  M ++ P+L  FI  
Sbjct: 360 LSLPFLKEYLLKILGFLLYDKFLHKSTDYIFAYNTYTTTEEFWEQFMTKVSPHLSRFIKE 419

Query: 427 GLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRYFDTEFEVLLN 486
            L  +D  +EFK+F+ I +AILEN KL+ + +Y+I + +F++YC + I  FD EF  LLN
Sbjct: 420 KLTTEDQLIEFKNFLGILIAILENMKLNSESMYKIQVQVFEKYCGLLIHVFDKEFTNLLN 479

Query: 487 DDDFMPLTINDKTLFQKVSQICWMKEDE-HLEPQEDMSGFSITLPFSPLYPMTCTLLKKA 545
           DDDFMPL I+D+  ++KV ++CWMK D   +  Q+D +GFS+TLPFSPLYPMTC L+KK+
Sbjct: 480 DDDFMPLPISDRNFYEKVMKLCWMKPDSVPIVTQDDANGFSVTLPFSPLYPMTCALIKKS 539

Query: 546 YSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTSREEIAQILINLDY 605
           Y+ +  F+  F++HDL  LN +LV  +D IFI +VN KIR+KL +TSREEIAQILINLDY
Sbjct: 540 YANMLLFLNTFFQHDLSYLNIVLVRTVDDIFIKVVNNKIRSKLDTTSREEIAQILINLDY 599

Query: 606 FIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKLIDSKVADILETVD 665
           FIVA K FS IMT+ NI QNPDIEI+L STK L D++KYAE KLI+LIDSKV D++E V+
Sbjct: 600 FIVAAKEFSDIMTKENITQNPDIEIKLSSTKQLADTKKYAETKLIELIDSKVTDLMEFVE 659

Query: 666 LDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREFDSLTRRFLDILLN 725
           LDW ++E+  +P +SI D+AQFLEMMF +TL NLPYSI+ LLIFREFD LTR+FL++L++
Sbjct: 660 LDWTTEEVRDEPGLSIRDIAQFLEMMFTSTLANLPYSIKSLLIFREFDQLTRKFLELLVH 719

Query: 726 DTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTPLSPVFNGTNNGHS 785
           ++P +IT +SV NFE ++K+LE +I  IFP+   E+    S    TP +PV +   N  S
Sbjct: 720 ESPSYITTQSVANFETDMKFLENVISNIFPNESTEQNVEISPS--TPTTPVADSF-NVKS 776

Query: 786 PELIENNVKSLEETFIELRQYIELLKTGN--EYMDPDLRMRKYSRVKPEHANILMRKV-R 842
           P +IE+NV+SL  TF +L Q+I L+K+ N  EY D  +RMRKY R+KPE A++LM K+ R
Sbjct: 777 PNMIESNVRSLFSTFTDLNQHILLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNKLSR 836

Query: 843 VTPIMXXXXXXXXXXXXXXXIFTRDFN-GSDSRIAKFFNR 881
            T                      D++  S+ R AKFFNR
Sbjct: 837 PTTATTDGDNTT----------VSDYSVTSNGRFAKFFNR 866

>KLLA0A01023g 96383..98968 similar to sp|P22224 Saccharomyces
           cerevisiae YGL233w SEC15 vesicular traffic control
           protein singleton, start by similarity
          Length = 861

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/848 (48%), Positives = 577/848 (68%), Gaps = 29/848 (3%)

Query: 2   DQEVLLSQDFQKILLSYEPKKAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDKWVPF 61
           D ++ +SQD Q+ LL+ E      +++ D+ E           ++ FELDPQ FD+WVP 
Sbjct: 4   DPQLAVSQDLQRALLTAEFVSKSGSSNQDQGE-----------DELFELDPQIFDRWVPL 52

Query: 62  LRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDTSL 121
           LR  +++ QL T+I +L  SIDD+F+ LE Q+LQDSQIN+ L TSINEI  +Q +ID SL
Sbjct: 53  LRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQKVQQIIDGSL 112

Query: 122 SGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQELIT 181
              I NLQ Q+  +T  L+ +KQ+ ++N KTS KI+E +IL+ KV++ILEL ++C+ELI 
Sbjct: 113 QNDIKNLQSQVRHSTLNLVSRKQILIDNTKTSSKITESSILIQKVLQILELFNRCRELIE 172

Query: 182 EGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECXXXXXXXXXXXX 241
           E +FFKALQ +++ E IYLQ+F+ YNF+FL +IY SIP LKS  KDE             
Sbjct: 173 EKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKDESINLIKKSLNYNL 232

Query: 242 GKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNLEKFF 301
            K  + +G  ++D Y+ ++L  WL+ K+SMKL  +KFNSPVEIS+RD + L  L L+ F 
Sbjct: 233 EKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEISLRDTSKLDSLQLQNFC 292

Query: 302 HIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWK---RASNSNANIPPGDI 358
            + EF+DSI+IFQ+LN++D+   EF KEYEFRK+KLI+PL  K     S+SN  I     
Sbjct: 293 QLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFLKDFSTVSHSNGKI----- 347

Query: 359 SSDAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNY-NATNEFWDGLMNRLQ 417
             DAF ++++L F KEY  KILGFL+YD  L+KSTD+VL +NN  N+T+ FW  +MN+L 
Sbjct: 348 --DAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLSNNNNPNSTDIFWTSIMNKLY 405

Query: 418 PYLRHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRYF 477
           PYL   +   L  +    EFKDF+ + +AILEN KL+++ LY++ +  F +YC++ +  F
Sbjct: 406 PYLITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVELLYKVQVETFSQYCELLVFLF 465

Query: 478 DTEFEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDEHLEPQEDMSGFSITLPFSPLYPM 537
             EF  LL DDDFMPL I DK L++K+ +ICW+ +            FS T PFSPLYPM
Sbjct: 466 QKEFTNLLQDDDFMPLAITDKALYEKILKICWLADQGSDTSNTTNDNFSATFPFSPLYPM 525

Query: 538 TCTLLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQSTSREEIA 597
           TCTL+KK YS L SFI++FY+HD+  LN +++ AID IF  +VN  I++KL +TSREEIA
Sbjct: 526 TCTLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNIFDRVVNDNIKSKLDTTSREEIA 585

Query: 598 QILINLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIKLIDSKV 657
           QIL+NLDYF++A K FS I+T  N+  NPD+EI+L S K L ++RK AE KLI LIDSKV
Sbjct: 586 QILVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSIKKLIETRKEAETKLITLIDSKV 645

Query: 658 ADILETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFREFDSLTR 717
            D++E ++ DWNS E+  +PD++IVD+AQFLEMMF +TL  +PY+I++LLIFREFD +TR
Sbjct: 646 IDLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTSTLAIIPYNIKMLLIFREFDVITR 705

Query: 718 RFLDILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMTPLSPV- 776
           RFL+ LLN+TPD I+ +SV NFE ++ YLE  I +IFP+    + +        P +P  
Sbjct: 706 RFLEKLLNETPDRISPQSVQNFETDMLYLEKTITKIFPN----DVSSVPTSPSIPATPTD 761

Query: 777 FNGTNNGHSPELIENNVKSLEETFIELRQYIELLKTGN--EYMDPDLRMRKYSRVKPEHA 834
              T    S   +ENN+KSL  TF +L+Q+I L+K  +  EY D D+R++KYSRVKPE A
Sbjct: 762 VPSTAGNRSSTQVENNIKSLLSTFTDLKQHIGLMKINHWDEYKDNDIRLKKYSRVKPEVA 821

Query: 835 NILMRKVR 842
             L+ K++
Sbjct: 822 QSLLSKLQ 829

>Kwal_47.19214
          Length = 876

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/892 (48%), Positives = 594/892 (66%), Gaps = 32/892 (3%)

Query: 2   DQEVLLSQDFQKILLSYEPK--KAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDKWV 59
           D + L+S++ Q++LLS +    K+  T   +  E A      G  E+  +LD  +F+KW 
Sbjct: 4   DAQSLISEELQQVLLSTDLSFLKSLQTGQDEIAEVA------GEYEEELDLDEHTFNKWT 57

Query: 60  PFLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDT 119
           P LRSA+E   L  +++EL  SI+DNF+ LE Q+LQDSQ++D L  S+ +I++I+ +I+ 
Sbjct: 58  PLLRSAIEDESLPLVVEELYNSIEDNFENLESQILQDSQLSDNLTASVGQIASIKEVIEG 117

Query: 120 SLSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILELSSKCQEL 179
           SL   I +L  QL +TTN++I +KQ ++NNKK S KISE  IL+TKV++ILELS KCQ+L
Sbjct: 118 SLLQEIEDLHIQLAETTNDVITRKQNYINNKKISTKISETIILITKVLQILELSKKCQDL 177

Query: 180 ITEGNFFKALQNLDSLEKIYLQEFRNYNFKFLKEIYDSIPYLKSVTKDECXXXXXXXXXX 239
           I E ++FKALQ+L  LEKIY+Q+F+NYNF FLK+IY SIP LKS  KDE           
Sbjct: 178 IKERSYFKALQSLGGLEKIYVQDFKNYNFDFLKKIYASIPILKSKIKDESINLVKSSFNS 237

Query: 240 XXGKNLTDVGMSFFDTYQNELLPKWLEIKKSMKLEKFKFNSPVEISMRDQASLKKLNLEK 299
              K L  VG +FFD Y + LL  WL  +  +KL  FKFNSPVEIS+RD   L+ LN+  
Sbjct: 238 NLEKKLLTVGQTFFDFYHDVLLSDWLNSRSELKLSNFKFNSPVEISLRDTTQLESLNVAT 297

Query: 300 FFHIEEFYDSIMIFQTLNKLDYLFSEFSKEYEFRKTKLIYPLLWK---RASNSNANIPPG 356
            + ++EFYDSI+IFQ L ++DYL +EF KEY+FR +K+++PL  K    A+ +   +   
Sbjct: 298 LYPLDEFYDSILIFQNLKEIDYLRTEFKKEYDFRTSKVVHPLELKVSASATPAEQKLQVT 357

Query: 357 DISSDAFTKQMNLKFLKEYFWKILGFLLYDINLNKSTDFVLVDNNYNATNEFWDGLMNRL 416
           ++ +D FT+      LK Y  +ILGF++YD +LNKST++VL  N +N +  FW+  +NR 
Sbjct: 358 NLFADDFTQDQ----LKHYLLRILGFVIYDRHLNKSTEYVLSFNQFNTSESFWELFINRF 413

Query: 417 QPYLRHFIVTGLNDDDSFVEFKDFMCIYVAILENYKLSIDPLYEILILLFDRYCDISIRY 476
            P+L HF+ + +N ++  ++ KDF+ +Y+AILEN  ++I+ +Y I +LLF +Y    ++ 
Sbjct: 414 SPFLEHFVNSRINTEEEMIDLKDFLGVYIAILENIGVNIEQIYRINVLLFKKYARFLVQM 473

Query: 477 FDTEFEVLLNDDDFMPLTINDKTLFQKVSQICWMKEDE-----HLEPQEDMSGFSITLPF 531
           FD+EF  LL+DDDFMPLTIND  L++KV +ICW++EDE      +E Q     F  TLPF
Sbjct: 474 FDSEFSTLLDDDDFMPLTINDHGLYEKVLKICWLREDELDKFGSIE-QTPGESFFATLPF 532

Query: 532 SPLYPMTCTLLKKAYSKLTSFITMFYRHDLPALNRLLVNAIDKIFIDIVNKKIRAKLQST 591
           SPLYPMTCTL KK Y+KL  F+T F+++DL  LN ++V  ID IF  IVN KI AK  +T
Sbjct: 533 SPLYPMTCTLAKKCYNKLVGFLTDFFQYDLGELNHVIVQMIDDIFGKIVNDKIAAKSDTT 592

Query: 592 SREEIAQILINLDYFIVATKAFSKIMTEGNIMQNPDIEIQLKSTKDLKDSRKYAEGKLIK 651
           SREEIAQILINLDYFIVA K FS I++  NIM NP +E+ L++TK L  SR   E KLI 
Sbjct: 593 SREEIAQILINLDYFIVAVKEFSNILSRENIMHNPGVELGLQATKQLSKSRTLTETKLIA 652

Query: 652 LIDSKVADILETVDLDWNSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSIQILLIFRE 711
           LIDSKV+D++E V+ +W S+EI+++PD SI D+AQFLEMMF +TL+NLP S++ LLIFRE
Sbjct: 653 LIDSKVSDLMEFVEFEWASQEILREPDYSIKDIAQFLEMMFNSTLVNLPDSVKTLLIFRE 712

Query: 712 FDSLTRRFLDILLNDTPDHITHESVLNFEVNIKYLEGIIPRIFPSRDEEETNITSERMMT 771
           FD+LTRRFLD+LLN TP  IT +S+LNFE N+ +LE II ++FPS D      T +   +
Sbjct: 713 FDALTRRFLDVLLNQTPSVITPQSILNFERNMDFLEAIITKLFPSSDS-----TPQTPTS 767

Query: 772 PLSPVFNGTNNGHSPELIENNVKSLEETFIELRQYIELLKTGN--EYMDPDLRMRKYSRV 829
           P  P    ++N  S  +I N V+SL  TF +L+Q+I+ LK+ +  EY D  +RMRKY R+
Sbjct: 768 PEIPSGQFSDNARSSNVINNTVRSLHSTFSDLKQHIQFLKSPDMEEYKDSSIRMRKYPRI 827

Query: 830 KPEHANILMRKVRVTPIMXXXXXXXXXXXXXXXIFTRDFNGSDSRIAKFFNR 881
           KPE A +L  K+ V P                     D   S  RIAKFFNR
Sbjct: 828 KPEVAQMLYNKI-VPPRSAGTESEESSSVDQSF---ADSITSHKRIAKFFNR 875

>AEL281C [2224] [Homologous to ScYPR189W (SKI3) - SH]
           (111535..115707) [4173 bp, 1390 aa]
          Length = 1390

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 40/80 (50%), Gaps = 2/80 (2%)

Query: 451 YKLSIDPLYEILILLFDRYCDISIRYFDTEFEVLLN-DDDFMPLTINDKTLFQKVSQICW 509
           Y L++  L   LIL   RYCD +   F    +   N    ++ L I+   L  +VSQ C+
Sbjct: 907 YNLALAELTAYLILKEMRYCDAATYCFKRSIKYQSNFFASWVGLGISSMNLNYRVSQHCF 966

Query: 510 MKEDEHLEPQEDMSGFSITL 529
           +K +  L P+E    F+++L
Sbjct: 967 IKANA-LAPKEPTIWFNMSL 985

>KLLA0D11220g 958249..959682 weakly similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w singleton, start by
           similarity
          Length = 477

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 650 IKLIDSKVADILETVDLDW-NSKEIIQDPDISIVDVAQFLEMMFATTLINLPYSI 703
           +K++D K+  +L+ +   W  +  I+++P+++ +   QF++ M  + L+ L  S+
Sbjct: 70  LKILDQKIHHVLQRLQTHWIKNPLILREPEVAKIGAEQFIKYMSYSKLVKLTMSL 124

>Kwal_47.17420
          Length = 220

 Score = 30.8 bits (68), Expect = 3.8,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 757 RDEEETNITSERMMTPLSPVFNGTNNGH 784
           RD  ETNIT+  + +P  P+    N GH
Sbjct: 8   RDISETNITNAELSSPTPPLLPSQNGGH 35

>KLLA0E11033g complement(969999..974819) similar to sp|P52593
           Saccharomyces cerevisiae YML103c NUP188 nuclear pore
           protein singleton, start by similarity
          Length = 1606

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 63/139 (45%), Gaps = 7/139 (5%)

Query: 53  QSFDKWVPFLRSAVEKNQLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISN 112
           +S+  W    RS  EK +LGT +  L T++  N  G++     +++I   L ++ N+I+N
Sbjct: 702 ESYQYWN--YRSIAEKYELGTNLTILFTTVVYNIYGIDPSNPPETKITKVLSSAANDITN 759

Query: 113 ---IQNMIDTSLSGGILNLQEQLTQTTNELIIKKQVFVNN-KKTSLKISELTILLTKVVR 168
                +  D      IL++    + +   L I  +VF N   +  LK  EL  LL  V  
Sbjct: 760 RFLSSDSPDVRTVTSILHVLLS-SNSLEALSIGNEVFYNKYNQCLLKSYELANLLISVRA 818

Query: 169 ILELSSKCQELITEGNFFK 187
           +L+L     E    GN  K
Sbjct: 819 MLQLPPSTLESQIYGNLPK 837

>AER074W [2579] [Homologous to ScYDL074C (BRE1) - SH]
           complement(775019..776950) [1932 bp, 643 aa]
          Length = 643

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 4/67 (5%)

Query: 117 IDTSLSGGILNLQEQLTQTTNELIIKKQVFVNNKKTSLKISELTILLTKVVRILEL-SSK 175
           I+ SL   I NL +QL  +    I +K++  +NK TSLKI +LT  L+K  +   L   +
Sbjct: 469 IEKSLQAKIENLNKQLHISR---INEKRLLDSNKTTSLKIMDLTSQLSKANKSSTLVQQE 525

Query: 176 CQELITE 182
           C +LI E
Sbjct: 526 CNKLIEE 532

>Scas_703.40
          Length = 899

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 45/111 (40%), Gaps = 4/111 (3%)

Query: 10  DFQKILLSYEPKKAETTTSHDKEENASEYKDLGMEEDAFELDPQSFDKWVPFLRSAVEKN 69
           D +KI L   P   E  +      +    + L +   A E+  + +     F      KN
Sbjct: 676 DMKKIRLQMSPDAIEIASRKVASVSGDARRALKVCRRAAEIAEKHYMMKHGFGYDGEAKN 735

Query: 70  QLGTIIQELDTSIDDNFQGLELQLLQDSQINDKLETSINEISNIQNMIDTS 120
           +   I  E D  ++DN  G ELQ +    I   L  +IN  SNI N I+ S
Sbjct: 736 E--NITDEEDNELEDNQDGEELQTVHIRHIMQALNETIN--SNIVNFINRS 782

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,265,159
Number of extensions: 1385457
Number of successful extensions: 5407
Number of sequences better than 10.0: 97
Number of HSP's gapped: 5559
Number of HSP's successfully gapped: 98
Length of query: 882
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 771
Effective length of database: 12,753,511
Effective search space: 9832956981
Effective search space used: 9832956981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)