Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_711.4533533510841e-148
ABR054C3141131108e-06
Kwal_26.8190324118940.001
KLLA0F04862g31649920.001
Scas_625.7d30271910.002
YKL042W (SPC42)363133870.007
CAGL0L01793g359140810.041
KLLA0C17204g76866663.0
Kwal_14.232692383653.7
Scas_579.1079332637.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_711.45
         (335 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_711.45                                                           422   e-148
ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH] (494105..49...    47   8e-06
Kwal_26.8190                                                           41   0.001
KLLA0F04862g 476880..477830 some similarities with sp|P36094 Sac...    40   0.001
Scas_625.7d                                                            40   0.002
YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the s...    38   0.007
CAGL0L01793g 206723..207802 weakly similar to sp|P36094 Saccharo...    36   0.041
KLLA0C17204g 1504341..1506647 similar to sgd|S0004300 Saccharomy...    30   3.0  
Kwal_14.2326                                                           30   3.7  
Scas_579.10                                                            29   7.2  

>Scas_711.45
          Length = 335

 Score =  422 bits (1084), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 228/335 (68%), Positives = 228/335 (68%)

Query: 1   MNVSPTPKRYISGTFNPRRVPEPEXXXXXXXXXXXXXQRDNLPRYDDVKRPYQXXXXXXX 60
           MNVSPTPKRYISGTFNPRRVPEPE             QRDNLPRYDDVKRPYQ       
Sbjct: 1   MNVSPTPKRYISGTFNPRRVPEPEYNNYHHNYNNHNYQRDNLPRYDDVKRPYQDHLDDAL 60

Query: 61  XXXXXKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTANSNDE 120
                KRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTANSNDE
Sbjct: 61  LPDDAKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTANSNDE 120

Query: 121 IEILKRRIEDLEKENKRLRRRDELFNEKIKEEDSDKKVFXXXXXXXXXXXXXXXXXAMIL 180
           IEILKRRIEDLEKENKRLRRRDELFNEKIKEEDSDKKVF                 AMIL
Sbjct: 121 IEILKRRIEDLEKENKRLRRRDELFNEKIKEEDSDKKVFTETTEDDELLEKIEKLTAMIL 180

Query: 181 KHKQEQRNSGTTPAKTSWKEQNSKAYPXXXXXXXXXXXXXXXXXDQVEKIRHKLALKREN 240
           KHKQEQRNSGTTPAKTSWKEQNSKAYP                 DQVEKIRHKLALKREN
Sbjct: 181 KHKQEQRNSGTTPAKTSWKEQNSKAYPTEETLLTQESLELKSLEDQVEKIRHKLALKREN 240

Query: 241 EQRKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDRHSHHPTXXXXXXXXX 300
           EQRKI                                      DRHSHHPT         
Sbjct: 241 EQRKISLNKELLKLKSSLEPSLSTFSASLNSSSPSKASPLLFKDRHSHHPTIDIIDNDDI 300

Query: 301 XTPFKERQLSEPEVNLNVKTPRAKTGSTEEKGWHT 335
            TPFKERQLSEPEVNLNVKTPRAKTGSTEEKGWHT
Sbjct: 301 ITPFKERQLSEPEVNLNVKTPRAKTGSTEEKGWHT 335

>ABR054C [645] [Homologous to ScYKL042W (SPC42) - SH]
           (494105..495049) [945 bp, 314 aa]
          Length = 314

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 49/113 (43%), Gaps = 17/113 (15%)

Query: 1   MNVSPTPKRYISGTFNPRRVPEPEXXXXXXXXXXXXXQRDNLPRYDDVKRPYQXXXXXXX 60
           MN+SPTPKRY S    PR V                     +P Y +             
Sbjct: 1   MNISPTPKRYQSSNHMPRAV--------------NHNYHSAVPAYHEHA---AGQNADRI 43

Query: 61  XXXXXKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTL 113
                K ++     L++ N+ L  +L+ K +E+EKL +L  SL+ KLIKYT L
Sbjct: 44  VPDEYKINSNMISSLIKQNKDLLAKLDEKDRELEKLNVLVGSLRGKLIKYTEL 96

>Kwal_26.8190
          Length = 324

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 53/118 (44%), Gaps = 30/118 (25%)

Query: 1   MNVSPTPKRYISGTFN-PRRVPEPEXXXXXXXXXXXXXQRDNLPRYDDVKRPYQXXXXXX 59
           MN+SPTP+RY S  ++ PR                           D+   P+       
Sbjct: 1   MNISPTPRRYNSRGYDYPRET-------------------------DEAFHPFNQEPPMI 35

Query: 60  XXX----XXXKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTL 113
                     + +++  ++L++ N+ L  +L+ KQ E+++L +L  SL+ KLIKYT L
Sbjct: 36  PSDRIVPEEYRVNSQMINKLIKQNKELTLQLDRKQDEIDRLNVLVGSLRGKLIKYTEL 93

>KLLA0F04862g 476880..477830 some similarities with sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42 spindle pole body
           component singleton, hypothetical start
          Length = 316

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 33/49 (67%)

Query: 66  KRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLT 114
           K ++   +EL++ N+ L +++  KQ+E+++L +L  S + KLIKYT L 
Sbjct: 28  KYNSSMINELIKQNKDLHKQVTEKQEEIDRLNVLIGSFRAKLIKYTELN 76

>Scas_625.7d
          Length = 302

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 46/71 (64%), Gaps = 7/71 (9%)

Query: 68  SNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTANSNDEIEILKRR 127
           SN   +EL+  NR LK+ L  ++ E+++   L+ SL+ KLIKYT L    N+++E  + +
Sbjct: 48  SNDAINELIDMNRQLKKTLRDREDELDRYGRLTESLQSKLIKYTNL----NNKLE--REK 101

Query: 128 IEDLEKENKRL 138
           IE LE EN++L
Sbjct: 102 IE-LELENEKL 111

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 17/21 (80%)

Query: 225 DQVEKIRHKLALKRENEQRKI 245
           DQVE++R K  LK+ENE RKI
Sbjct: 231 DQVEELRKKTLLKQENELRKI 251

>YKL042W (SPC42) [3216] chr11 (358120..359211) Component of the
           spindle pole body [1092 bp, 363 aa]
          Length = 363

 Score = 38.1 bits (87), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 60/133 (45%), Gaps = 10/133 (7%)

Query: 1   MNVSPTPKRYISGTFNPRRVPEPEXXXXXXXXXXXXXQRDNLPRYDDVKRPYQXXXXXXX 60
           MN SPTPKRY S +    R+ +                RD    Y+DV            
Sbjct: 1   MNGSPTPKRYSSKS---SRLYDDYYNIPYQYSNPTPMNRD----YNDVG---SRINADKL 50

Query: 61  XXXXXKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTANSNDE 120
                KR+ +  ++ V+ N+ L  +L  KQ E+ +L  ++ +L+ KL KY  +T    D+
Sbjct: 51  VPEEYKRNTEFINKAVQQNKELNFKLREKQNEIFELKKIAETLRSKLEKYVDITKKLEDQ 110

Query: 121 IEILKRRIEDLEK 133
              L+ +I DLEK
Sbjct: 111 NLNLQIKISDLEK 123

>CAGL0L01793g 206723..207802 weakly similar to sp|P36094
           Saccharomyces cerevisiae YKL042w SPC42, start by
           similarity
          Length = 359

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 58/140 (41%), Gaps = 8/140 (5%)

Query: 1   MNVSPTPKRYIS------GTFNPRRVPEPEXXXXXXXXXXXXXQRDNLPRYDDVKRPYQX 54
           MN+SPTPKRY S       +    +VPE E                N P Y +       
Sbjct: 1   MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYSGINPPVYKNGLHSNLD 60

Query: 55  XXXXXXXXXXXKRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLT 114
                      +R+    ++L+  N+ L+  +  +++E+E+L I+    + KL KY+ + 
Sbjct: 61  DDKLVPEEIKLQRT--VINDLISQNKELQTTVHTQREEIERLNIIIGQFRAKLTKYSVMN 118

Query: 115 ANSNDEIEILKRRIEDLEKE 134
               DE+   +R    L K+
Sbjct: 119 RKLEDELRGSERSSNALNKD 138

>KLLA0C17204g 1504341..1506647 similar to sgd|S0004300 Saccharomyces
           cerevisiae YLR309c IMH1 involved in vesicular transport,
           start by similarity
          Length = 768

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 14/66 (21%)

Query: 66  KRSNKTFDELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLIKYTTLTANSNDEIEILK 125
           +++N   +  ++ N  L ERLE               L+EKL     L +NSND++E ++
Sbjct: 444 QKNNGNLESYIKENGKLSERLE--------------VLQEKLETLQNLKSNSNDQVETIR 489

Query: 126 RRIEDL 131
           ++ E+L
Sbjct: 490 KQCEEL 495

>Kwal_14.2326
          Length = 923

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 47/83 (56%), Gaps = 12/83 (14%)

Query: 74  ELVRHNRHLKERLEGKQQEVEKLTILSTSLKEKLI----KYTTLT---ANSNDEIEILKR 126
           +L + N  LK  ++     +EK    + SL E+L+    KY TL    +NS+D++E+++R
Sbjct: 578 QLTKENEELKNEVKKADNSLEKYIKENGSLSERLLVLKEKYETLQDMKSNSSDQVELIRR 637

Query: 127 RIED----LEKENKR-LRRRDEL 144
           + E+    L++ NKR L   DEL
Sbjct: 638 QCEELNIKLKEANKRHLSLEDEL 660

>Scas_579.10
          Length = 793

 Score = 28.9 bits (63), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 2/32 (6%)

Query: 123 ILKRRIEDLEKEN--KRLRRRDELFNEKIKEE 152
           +L +R+ D E  +  KRL   DEL N KIKEE
Sbjct: 239 VLSQRLVDAEVGSYTKRLFNDDELLNAKIKEE 270

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,413,277
Number of extensions: 301472
Number of successful extensions: 2210
Number of sequences better than 10.0: 168
Number of HSP's gapped: 2169
Number of HSP's successfully gapped: 205
Length of query: 335
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 233
Effective length of database: 13,065,073
Effective search space: 3044162009
Effective search space used: 3044162009
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 62 (28.5 bits)