Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_711.391227122759500.0
YJL074C (SMC3)1230123939090.0
CAGL0H02805g1219123332870.0
AAL182W1231123230990.0
Kwal_14.24351247123530210.0
KLLA0A00286g1280124828580.0
Scas_565.611707423335e-31
CAGL0D05258g11702682235e-18
AGR236W11703852182e-17
YFR031C (SMC2)11702172121e-16
KLLA0D16005g11704022057e-16
Scas_681.414097232041e-15
Sklu_2249.210832022022e-15
AGR089C13701001985e-15
CAGL0F02079g12237291977e-15
Kwal_56.238251396841932e-14
KLLA0D07502g12438461922e-14
YLR086W (SMC4)1418951913e-14
CAGL0L12188g13981001913e-14
Kwal_55.2042111702851879e-14
KLLA0F19085g1372821861e-13
Scas_707.2312238171851e-13
YFL008W (SMC1)12253771691e-11
AGL023W1222951573e-10
Kwal_23.504312253491555e-10
CAGL0G02497g1780107930.012
AEL337C109742880.036
KLLA0F07997g111967880.040
KLLA0E05247g1098114860.077
Scas_636.1460876850.080
CAGL0F01155g110548850.091
YDR091C60876840.12
CAGL0G08041g60782840.12
Scas_643.11109535820.23
Kwal_26.7204111735820.23
Kwal_56.2342953976800.27
AGR125W60753800.33
YOL034W (SMC5)109335800.34
CAGL0G08756g135446800.40
Kwal_33.15024369140780.42
CAGL0L01221g99490790.43
KLLA0B14256g127184780.60
AER044W110376770.85
Scas_698.3131478760.96
KLLA0C01991g70695761.1
KLLA0C17556g60782732.2
KLLA0B11121g237164712.4
AGL335W69149722.8
Scas_538.252174723.0
AEL085W52767713.2
Scas_719.6109678723.4
CAGL0G02937g56475695.8
AAL064W528138695.8
Kwal_26.948071949695.8
CAGL0L06908g439139687.4
Scas_719.46415102688.3
Kwal_47.1717836775678.7
Scas_710.5060255688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_711.39
         (1227 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_711.39                                                          2296   0.0  
YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin, ...  1510   0.0  
CAGL0H02805g complement(256682..260341) similar to sp|P47037 Sac...  1270   0.0  
AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH] complement(161...  1198   0.0  
Kwal_14.2435                                                         1168   0.0  
KLLA0A00286g complement(22024..25866) similar to sp|P47037 Sacch...  1105   0.0  
Scas_565.6                                                            132   5e-31
CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces c...    91   5e-18
AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH] complement(...    89   2e-17
YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of...    86   1e-16
KLLA0D16005g complement(1346492..1350004) similar to sp|P38989 S...    84   7e-16
Scas_681.4                                                             83   1e-15
Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement          82   2e-15
AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..90...    81   5e-15
CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces c...    80   7e-15
Kwal_56.23825                                                          79   2e-14
KLLA0D07502g complement(642751..646482) similar to sp|P32908 Sac...    79   2e-14
YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensi...    78   3e-14
CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces...    78   3e-14
Kwal_55.20421                                                          77   9e-14
KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomy...    76   1e-13
Scas_707.23                                                            76   1e-13
YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein ...    70   1e-11
AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH] complement(...    65   3e-10
Kwal_23.5043                                                           64   5e-10
CAGL0G02497g 223375..228717 similar to sp|Q02455 Saccharomyces c...    40   0.012
AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [32...    39   0.036
KLLA0F07997g complement(748561..751920) similar to sgd|S0005394 ...    39   0.040
KLLA0E05247g complement(472583..475879) similar to sp|Q12749 Sac...    38   0.077
Scas_636.14                                                            37   0.080
CAGL0F01155g complement(116762..120079) similar to tr|Q08204 Sac...    37   0.091
YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative...    37   0.12 
CAGL0G08041g complement(758811..760634) highly similar to tr|Q03...    37   0.12 
Scas_643.11                                                            36   0.23 
Kwal_26.7204                                                           36   0.23 
Kwal_56.23429                                                          35   0.27 
AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH] complement(...    35   0.33 
YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing ...    35   0.34 
CAGL0G08756g complement(829778..833842) highly similar to sp|P32...    35   0.40 
Kwal_33.15024                                                          35   0.42 
CAGL0L01221g 137742..140726 similar to sp|P32618 Saccharomyces c...    35   0.43 
KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces...    35   0.60 
AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH] complement...    34   0.85 
Scas_698.3                                                             34   0.96 
KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces c...    34   1.1  
KLLA0C17556g complement(1544404..1546227) highly similar to sgd|...    33   2.2  
KLLA0B11121g 976252..976965 weakly similar to sp|P53271 Saccharo...    32   2.4  
AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH] complement(...    32   2.8  
Scas_538.2                                                             32   3.0  
AEL085W [2421] [Homologous to ScYDL030W (PRP9) - SH] complement(...    32   3.2  
Scas_719.6                                                             32   3.4  
CAGL0G02937g complement(268985..270679) highly similar to sp|P06...    31   5.8  
AAL064W [123] [Homologous to ScYDR299W (BFR2) - SH] complement(2...    31   5.8  
Kwal_26.9480                                                           31   5.8  
CAGL0L06908g complement(777557..778876) highly similar to sp|Q07...    31   7.4  
Scas_719.46                                                            31   8.3  
Kwal_47.17178                                                          30   8.7  
Scas_710.50                                                            31   8.8  

>Scas_711.39
          Length = 1227

 Score = 2296 bits (5950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1152/1227 (93%), Positives = 1152/1227 (93%)

Query: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
            MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVI            AIRFVLSDDYSNLKREE
Sbjct: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120
            RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120

Query: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180
            DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL
Sbjct: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180

Query: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240
            KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL
Sbjct: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240

Query: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300
            NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA
Sbjct: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300

Query: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360
            KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF
Sbjct: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360

Query: 361  QELSKEELKFKLQYNXXXXXXXXXXXXXXXYARFASIEERNEWIQNEIEESDKTLQGLVD 420
            QELSKEELKFKLQYN               YARFASIEERNEWIQNEIEESDKTLQGLVD
Sbjct: 361  QELSKEELKFKLQYNKLQQRQRDLLLKKGRYARFASIEERNEWIQNEIEESDKTLQGLVD 420

Query: 421  IKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKR 480
            IKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKR
Sbjct: 421  IKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKR 480

Query: 481  KELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGT 540
            KELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGT
Sbjct: 481  KELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGT 540

Query: 541  LGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLD 600
            LGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLD
Sbjct: 541  LGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLD 600

Query: 601  ANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLNSITL 660
            ANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLNSITL
Sbjct: 601  ANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLNSITL 660

Query: 661  DGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDSNIDT 720
            DGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDSNIDT
Sbjct: 661  DGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDSNIDT 720

Query: 721  LNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTADK 780
            LNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTADK
Sbjct: 721  LNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTADK 780

Query: 781  KETYVKDMSSEFNXXXXXXXXXXXXXTSXXXXXXXXXXXXXXXXXXXXXXXMNSLNAELN 840
            KETYVKDMSSEFN             TS                       MNSLNAELN
Sbjct: 781  KETYVKDMSSEFNSELSLVEKEELEVTSISLLEIEKKLTLTTENLETVTSEMNSLNAELN 840

Query: 841  SKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIEDL 900
            SKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIEDL
Sbjct: 841  SKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIEDL 900

Query: 901  KSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLLA 960
            KSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLLA
Sbjct: 901  KSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLLA 960

Query: 961  EDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATELDES 1020
            EDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATELDES
Sbjct: 961  EDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATELDES 1020

Query: 1021 KTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARMETNS 1080
            KTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARMETNS
Sbjct: 1021 KTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARMETNS 1080

Query: 1081 NXXXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQ 1140
            N            INNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQ
Sbjct: 1081 NDDDVDMDQEDEVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQ 1140

Query: 1141 MVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYE 1200
            MVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYE
Sbjct: 1141 MVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYE 1200

Query: 1201 NKISTVIEVDKQDAINFIKGNNKYAEV 1227
            NKISTVIEVDKQDAINFIKGNNKYAEV
Sbjct: 1201 NKISTVIEVDKQDAINFIKGNNKYAEV 1227

>YJL074C (SMC3) [2838] chr10 complement(299073..302765) Cohesin,
            coiled-coil protein of the SMC family involved in
            chromosome condensation and segregation [3693 bp, 1230
            aa]
          Length = 1230

 Score = 1510 bits (3909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 766/1239 (61%), Positives = 962/1239 (77%), Gaps = 21/1239 (1%)

Query: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
            MYIKRV+IKGFKTYRN+T+ID+FSPH N++I            AIRFVLSDDYSNLKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120
            RQGLIHQGSGGSVMSASVEIVFHDP+H MILPSGV+ R  +DE+ IRRTVGLKKDDYQLN
Sbjct: 61   RQGLIHQGSGGSVMSASVEIVFHDPDHSMILPSGVLSR-GDDEVTIRRTVGLKKDDYQLN 119

Query: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180
            DRNVTKGD+VRMLE+ GFSM+NPYNIVPQGKI++LTNAKDKERLQLLEDVVGAKSFEVKL
Sbjct: 120  DRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKERLQLLEDVVGAKSFEVKL 179

Query: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240
            KASLKKMEETEQK+ +I KEM ELNSKL EMEQERKELEKYN LE+NRK++QFTLYDREL
Sbjct: 180  KASLKKMEETEQKKIQINKEMGELNSKLSEMEQERKELEKYNELERNRKIYQFTLYDREL 239

Query: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300
            N++INQ+ERLD DYN T  SSEQYI+ELDKRE++I  +SK LS I+++LKIK  TDL QA
Sbjct: 240  NEVINQMERLDGDYNNTVYSSEQYIQELDKREDMIDQVSKKLSSIEASLKIKNATDLQQA 299

Query: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360
            K R SE++ +LTN+ V+IKD++ QI++ E Q N D  TL  I   I++R+QKLS I P++
Sbjct: 300  KLRESEISQKLTNVNVKIKDVQQQIESNEEQRNLDSATLKEIKSIIEQRKQKLSKILPRY 359

Query: 361  QELSKEELKFKLQYNXXXXXXXXXXXXXXXYARFASIEERNEWIQNEIEESDKTLQGLVD 420
            QEL+KEE  +KLQ                 YARF S +ER+ WI +EIEE   ++Q L +
Sbjct: 360  QELTKEEAMYKLQLASLQQKQRDLILKKGEYARFKSKDERDTWIHSEIEELKSSIQNLNE 419

Query: 421  IKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKR 480
            +++++ ++R  +  +  ++DE+I+ L DSI GP+  G+LE    EL  LK + + S+D R
Sbjct: 420  LESQLQMDRTSLRKQYSAIDEEIEELIDSINGPDTKGQLEDFDSELIHLKQKLSESLDTR 479

Query: 481  KELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGT 540
            KELWR EQK++TVL+ LL +V   +RNVNETM RSLANGI +VKEI  KLK+  +SVFGT
Sbjct: 480  KELWRKEQKLQTVLETLLSDVNQNQRNVNETMSRSLANGIINVKEITEKLKISPESVFGT 539

Query: 541  LGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLD 600
            LGELI VN+KYK CAEV+GGNSLFHIVVDTEETAT+IM ELY+MKGGRVTFIPLNR+ LD
Sbjct: 540  LGELIKVNDKYKTCAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIPLNRLSLD 599

Query: 601  ANIQYPPN--DQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLNSI 658
            +++++P N   Q  FTPLI KIKY+ RF+KAV+H+FGKTIVVKDL  GL+++KK KLN+I
Sbjct: 600  SDVKFPSNTTTQIQFTPLIKKIKYEPRFEKAVKHVFGKTIVVKDLGQGLKLAKKHKLNAI 659

Query: 659  TLDGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDSNI 718
            TLDGDRADKRGVLTGGY DQ+K++RL+SL  LNES ++H+++  EL  ++  + ++D+ I
Sbjct: 660  TLDGDRADKRGVLTGGYLDQHKRTRLESLKNLNESRSQHKKILEELDFVRNELNDIDTKI 719

Query: 719  DTLNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTA 778
            D +N +IRK + +RES+L+NIE  ++ L  KKN+K++LEESL A+ +K EK   N     
Sbjct: 720  DQVNGNIRKVSNDRESVLTNIEVYRTSLNTKKNEKLILEESLNAIILKLEKLNTNRTFAQ 779

Query: 779  DKKETYVKDMSSEFNXXXXXXXXXXXXXTSXXXXXXXXXXXXXXXXXXXXXXXMNSLNAE 838
            +K  T+  D+  EF+              +                       ++SLNAE
Sbjct: 780  EKLNTFENDLLQEFDSELSKEEKERLESLTKEISAAHNKLNITSDALEGITTTIDSLNAE 839

Query: 839  LNSKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIE 898
            L SKL PQ+ D+ S+MS+ G +++  L+ ++  +  + E+V+ Q  +A+  + T+Q+EIE
Sbjct: 840  LESKLIPQENDLESKMSEVGDAFIFGLQDELKELQLEKESVEKQHENAVLELGTVQREIE 899

Query: 899  DLKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGL 958
             L +E+ NN K+LEKAN+QQRLLLKKL+ FQK VEKTMIKKT L+TRR+ELQQ+IREIGL
Sbjct: 900  SLIAEETNNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIKKTTLVTRREELQQRIREIGL 959

Query: 959  LAEDAL-NAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATEL 1017
            L EDAL N F+D++S++LL+RLN ++ +ISGLKNVNKRA+ENF+KF+E++K+L ERA+EL
Sbjct: 960  LPEDALVNDFSDITSDQLLQRLNDMNTEISGLKNVNKRAFENFKKFNERRKDLAERASEL 1019

Query: 1018 DESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNAR-- 1075
            DESK SIQDLI +L+QQKV AVDSTF KV+ENFE VFE+LVP G AKLIIHR ++NA   
Sbjct: 1020 DESKDSIQDLIVKLKQQKVNAVDSTFQKVSENFEAVFERLVPRGTAKLIIHRKNDNANDH 1079

Query: 1076 -------METNSNXXXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQK 1128
                   M+  SN              ++E +YTGVSISVSFNSK+NEQLHVEQLSGGQK
Sbjct: 1080 DESIDVDMDAESNESQNGK--------DSEIMYTGVSISVSFNSKQNEQLHVEQLSGGQK 1131

Query: 1129 TVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDML 1188
            TVCAIALILAIQMVDPA FYLFDEIDAALDKQYRTAVA ++K+LS NAQFICTTFRTDML
Sbjct: 1132 TVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFICTTFRTDML 1191

Query: 1189 QVADRFFRVKYENKISTVIEVDKQDAINFIKGNNKYAEV 1227
            QVAD+FFRVKYENKISTVIEV++++AI FI+G+NK+AEV
Sbjct: 1192 QVADKFFRVKYENKISTVIEVNREEAIGFIRGSNKFAEV 1230

>CAGL0H02805g complement(256682..260341) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1219

 Score = 1270 bits (3287), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/1233 (53%), Positives = 878/1233 (71%), Gaps = 20/1233 (1%)

Query: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
            MYIKRV+IKGFKTYRN+T+I DFSPHHN+VI            A+RFVLSDDYSNLKREE
Sbjct: 1    MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120
            RQGLIHQG+G SVMSASVEIVFHDPEH +I P+G+    ++DE+ IRRTVGLKKDDYQ+N
Sbjct: 61   RQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQVN 120

Query: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180
            DRNVTKGD+VRMLES GF MSNPYNIVPQG+I+SLTNAKDKERLQLLE+VVGAKSFEVKL
Sbjct: 121  DRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKERLQLLEEVVGAKSFEVKL 180

Query: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240
            KAS+K+M+ETEQKRA+I+ EM+EL SKL EME+ERKELEKYN+LE++RKV ++TL+DREL
Sbjct: 181  KASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLRYTLHDREL 240

Query: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300
             DII+Q+E LD DYN T  SS++YI EL+KRE +I  +++ +  +  +LK+K T DL QA
Sbjct: 241  QDIISQIESLDGDYNDTLGSSKKYILELEKRENMIKEVNEEIKNLQKSLKLKATVDLEQA 300

Query: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360
            K+   E   +   +++Q+KD+K +IK  + Q ++D+K L +I + I  ++ K   ISP+F
Sbjct: 301  KAILEESLERSEAIKLQLKDIKEKIKQNKEQHDNDRKNLKLITEIIDSKKSKRRKISPRF 360

Query: 361  QELSKEELKFKLQYNXXXXXXXXXXXXXXXYARFASIEERNEWIQNEIEESDKTLQGLVD 420
             +L  EE   K                   YARF S EER+EWI ++I+E  +++  +  
Sbjct: 361  DQLQSEEKLIKHHLKECIEKQNNFLLKKGSYARFKSKEERDEWINSKIKELSESINTMKA 420

Query: 421  IKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKR 480
               ++  ++  I+ K+   + +I+ L DS+ GP +  E+E I+ EL  L+ +Y A+ID R
Sbjct: 421  STTELKEQKSSIDVKINESENNIEELEDSLNGPGIKAEIEDIEKELINLRRKYTANIDAR 480

Query: 481  KELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGT 540
            KE WR EQK++ +  +L+  VK  ER++NETM RSLANG K+VKEI  +L L  +SVFGT
Sbjct: 481  KEKWREEQKLQMISDSLVNEVKENERSLNETMSRSLANGFKNVKEICERLNLGTESVFGT 540

Query: 541  LGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIY-L 599
            +GELI VNEKYK+CAEV+GGNSLFH+VVDT+ETA+I+M EL++MKGGRVTF+PLN++   
Sbjct: 541  VGELIQVNEKYKVCAEVIGGNSLFHVVVDTDETASILMNELFRMKGGRVTFMPLNKLKNG 600

Query: 600  DANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLNSIT 659
            + NI YP +     TPLI KIKYD +FD  V+ +FG+ +VVKDLT GL ISK++KL+ IT
Sbjct: 601  NQNIDYPSDPNIPCTPLIKKIKYDMQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCIT 660

Query: 660  LDGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDSNID 719
            LDGDR D +GVLTGGY +Q K+SRL+ L T+  S  +  E+S +LT IK  + E+D++ID
Sbjct: 661  LDGDRVDGKGVLTGGYLEQSKKSRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDID 720

Query: 720  TLNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTAD 779
            + N SIR     +E++ SN+   K KL +++N+ + L++    +  K +  ++N+ V+ +
Sbjct: 721  STNGSIRLVMNRKENMQSNLNTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSGE 780

Query: 780  KKETYVKDMSSEFNXXXXXXXXXXXXXTSXXXXXXXXXXXXXXXXXXXXXXXMNSLNAEL 839
            K      D++  FN              S                       ++++ AEL
Sbjct: 781  KLTQLKIDLTKTFNNELTTEEKKEIEILSKEILENQNKLNLTSETLSHLSVEIDTITAEL 840

Query: 840  NSKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIED 899
             SKL PQ+ DI  ++     S +  L  D + +  +     NQ     + + +I+KEIE 
Sbjct: 841  ESKLIPQQNDIKQKLLDSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEIES 900

Query: 900  LKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLL 959
             K+E  N ++ILEKAN+QQRLLLKKL+ +QKDV+KTMIKKT L TR+ E++QKIRE+G++
Sbjct: 901  TKAEITNKERILEKANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVGII 960

Query: 960  AEDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATELDE 1019
            +ED L+ F  LSSE+LL +LN  +++ISG++N+NKRA+EN++KF+EKQ EL ERATELD+
Sbjct: 961  SEDTLDKFKTLSSEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRERATELDD 1020

Query: 1020 SKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRV-----DNNA 1074
            SK SIQDLI +L++QK+ AVD TF KV++NF  +FEK+VP G A L IHR+     D+N+
Sbjct: 1021 SKQSIQDLIIKLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNS 1080

Query: 1075 RMETNSNXXXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIA 1134
             + T SN               + + Y GVSISVSFNSK++EQL VEQLSGGQKTVCAIA
Sbjct: 1081 ELFTQSNE--------------HTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIA 1126

Query: 1135 LILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRF 1194
            LILAIQMV+PAPFYLFDEIDAALDKQYR AVA  I QLS NAQFICTTFR+DM+  A++F
Sbjct: 1127 LILAIQMVEPAPFYLFDEIDAALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKF 1186

Query: 1195 FRVKYENKISTVIEVDKQDAINFIKGNNKYAEV 1227
            +RVKYENK S+VIEV K++A  FIKG NK +E+
Sbjct: 1187 YRVKYENKQSSVIEVTKEEAKRFIKGGNKLSEI 1219

>AAL182W [5] [Homologous to ScYJL074C (SMC3) - SH]
            complement(16155..19850) [3696 bp, 1231 aa]
          Length = 1231

 Score = 1198 bits (3099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 620/1232 (50%), Positives = 861/1232 (69%), Gaps = 15/1232 (1%)

Query: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
            MYIK+V+I+GFKTY+N+T ID+FSPHHN+V+            AIRFVLSDDY+NLKREE
Sbjct: 1    MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120
            R+ LI+QG+  SVMS  VEIVFH  E++ +L +     ++   I IRRTVGLKKD+Y +N
Sbjct: 61   RRSLIYQGTS-SVMSGYVEIVFHGAENRTLLGA-----QDGGVIHIRRTVGLKKDEYMIN 114

Query: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180
            ++N ++ DV R+LES GFS SNPYNIVPQG+I+SLTNA+++ERLQLLE+V+GAKSFE KL
Sbjct: 115  NKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRERLQLLEEVIGAKSFERKL 174

Query: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240
            K SL+KME TE+ R +I  E++E+ +KL E+++ERKELEKYN+L++ RK+ QF LYDREL
Sbjct: 175  KESLQKMETTEKNREKIRIELEEVEAKLNELDEERKELEKYNSLDRKRKMCQFALYDREL 234

Query: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300
            N++ + VE+LD +Y  T   SEQYI+EL+KRE +I  ++K+L+++ S LK+K +TDL QA
Sbjct: 235  NEVTSMVEKLDGEYTNTLVLSEQYIQELEKRESLIETLTKSLNQLGSELKMKESTDLQQA 294

Query: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360
            K    EL   L +L V+ ++L  Q  A + Q+ S+ ++L  I  +I  +EQ+L+ +SP+F
Sbjct: 295  KDSELELAKHLADLNVKYEELISQNNALKEQSASNSESLLAIRSQIAVKEQQLARLSPRF 354

Query: 361  QELSKEELKFKLQYNXXXXXXXXXXXXXXXYARFASIEERNEWIQNEIEESDKTLQGLVD 420
            ++L+ EE   K ++                Y++F +  ER+ WI  E+    + LQ    
Sbjct: 355  EQLTIEEAAMKAEFKALQQRQRDLLAKRGKYSQFRNKAERDAWIDQELSILKEELQCSSI 414

Query: 421  IKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKR 480
                I  ERD +  K+ +LD+ I  LNDS  GP +  ELE +Q EL  LK  +   ID+R
Sbjct: 415  ALTSISEERDSLRIKLTTLDDQIMELNDSAHGPGINAELEDVQQELTVLKKAHLFKIDER 474

Query: 481  KELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGT 540
            K+LWR+EQKI++VL++L+++VK  E  ++ETMDRSLA G+K+V EIA +L LPE SVFG 
Sbjct: 475  KQLWRSEQKIQSVLESLVDDVKRAEGTLSETMDRSLATGLKNVSEIAQRLNLPEGSVFGP 534

Query: 541  LGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLD 600
            LGELI ++EKYK CAEVVGG SLFH+VVDTE TA ++M+ELY  KGGRVTFIPLNR+++D
Sbjct: 535  LGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRVHVD 594

Query: 601  ANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLNSITL 660
            +NI YP ND+   TPLI KIKYD +F++A++H+FGKTIVVKDL  G +++K+F+LN+ITL
Sbjct: 595  SNIVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLAKQFRLNAITL 654

Query: 661  DGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDSNIDT 720
            DGD+AD RGVLTGG++D +KQ RLDS+  L     + +    +L  +K+ +  +D  ID 
Sbjct: 655  DGDKADSRGVLTGGFHDHHKQKRLDSMRDLKSLKKEQQGNKSQLEEVKEKLHSIDQEIDE 714

Query: 721  LNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRVTADK 780
            LN+ I+K  + RE +L+ +E +  KL   K ++ LLEE++  L  K EK +IN ++  DK
Sbjct: 715  LNDKIKKSMSRREMILTQVEAVNIKLEKAKRERFLLEETMVQLISKEEKAKINQKLLQDK 774

Query: 781  KETYVKDMSSEFNXXXXXXXXXXXXXTSXXXXXXXXXXXXXXXXXXXXXXXMNSLNAELN 840
             + Y +D+S +F+              +                       ++SL AEL+
Sbjct: 775  LDMYTEDLSRDFDTELTLTEREELDEIAKKLPDLENLLNTTTDALSSVVVKIDSLKAELD 834

Query: 841  SKLFPQKQDILSQMSQ-EGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIED 899
            SKL PQ +++  Q ++    + + +L+  +D++  + + +  + ++    V  I + I+ 
Sbjct: 835  SKLKPQAKELEDQPNEIMSTTAIQNLQEHIDAVEDERKTLLERKSTVDNEVQKISEIIDT 894

Query: 900  LKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLL 959
            LKS +   +K LEKANSQQR LLKKL+ +QK+ EK+M++K  L TRRDELQQKIR+IGLL
Sbjct: 895  LKSRQEEEEKSLEKANSQQRALLKKLDNYQKEAEKSMLRKMTLSTRRDELQQKIRDIGLL 954

Query: 960  AEDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATELDE 1019
             +D+ + ++++SS ELLK L+S+++ IS + NVNKRA ENF+KFD+KQK++++RA ELDE
Sbjct: 955  PDDSADKYHNMSSSELLKELSSINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELDE 1014

Query: 1020 SKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARMETN 1079
            SK SI+ LI +L++QKV AV++TF KV+ENF  +FEK+VP G  KL+IHR +N     + 
Sbjct: 1015 SKESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEPSKPSK 1074

Query: 1080 SNXXXXXXXXXXXXINNN--------ESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVC 1131
                            N+        +SIY+GVSI VSFNSK++EQ+HVEQLSGGQKTVC
Sbjct: 1075 RQQKKRKRQETEDVHFNDDQDENSSQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQKTVC 1134

Query: 1132 AIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVA 1191
            AIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVA  +KQLS  AQFICTTFR DM+ VA
Sbjct: 1135 AIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDMIAVA 1194

Query: 1192 DRFFRVKYENKISTVIEVDKQDAINFIKGNNK 1223
            DRF+RV +ENKISTV+EV K +A+NF+ G  K
Sbjct: 1195 DRFYRVNFENKISTVVEVTKAEALNFVTGREK 1226

>Kwal_14.2435
          Length = 1247

 Score = 1168 bits (3021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/1235 (48%), Positives = 846/1235 (68%), Gaps = 20/1235 (1%)

Query: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
            MYI+ V+I+GFKTYRN T ++DFSPH N+VI            A+RFVLSDDYS+LKREE
Sbjct: 25   MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120
            RQGLIHQG+G S+MSA VEIVFHDP  +M++ SG+ P      + +RRT+GLKKD+Y +N
Sbjct: 85   RQGLIHQGTG-SIMSAYVEIVFHDPSDQMMMTSGI-PVTEEHIVRVRRTIGLKKDEYSVN 142

Query: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180
             +   K D+ RM ES GFS SNPYNIVPQG+I+++TNAKDKERL LLEDVVGA+SFE+KL
Sbjct: 143  GKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDKERLLLLEDVVGARSFEIKL 202

Query: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240
            + S KKME T + RA+I  E+ EL ++L+E+++ER+ELEKY  LE++R++FQF LYDREL
Sbjct: 203  RESSKKMEATNRDRAKITSELSELKARLEELDEERQELEKYQELERDRRIFQFVLYDREL 262

Query: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300
            N++ +Q+E L+D+YN    SSE+YI+EL KRE +I+N++KN+S +++ LK+K +TD  Q 
Sbjct: 263  NEVTSQIESLEDEYNNVLQSSEEYIQELYKRETLIANLTKNISNVEAELKLKESTDFQQD 322

Query: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360
            KSR  E+  +  +L+++ ++ K Q      Q    +K L  + +EIQ    +L+ +SP++
Sbjct: 323  KSRLQEIVKRKADLEIRYEETKRQRDQVHGQCAVYRKNLATVEEEIQNTSTQLNRLSPRY 382

Query: 361  QELSKEELKFKLQYNXXXXXXXXXXXXXXXYARFASIEERNEWIQNEIEESDKTLQGLVD 420
            ++L  E   F+ Q +               YA+F +  ER+ WI  E+     +L+   D
Sbjct: 383  EQLKLEAEAFEAQLSQYQRKQREIISKRGIYAQFENQSERDAWIAKEL----SSLKAQTD 438

Query: 421  -IKNKILI---ERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAAS 476
             +K  + I   E++++ ++++   E I  LNDS+ GP ++ EL+ IQ  L  LK  Y   
Sbjct: 439  DLKKNVEIMEAEKEQVAAEIQQDKEAITELNDSVRGPGISSELQDIQTHLNDLKRSYLEK 498

Query: 477  IDKRKELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDS 536
            ID+RKELWR+EQ+++TV + LL+ VK  ERN++ETMDR+LANG+K+V+EI  +LKLP  +
Sbjct: 499  IDERKELWRSEQRLQTVSEALLDGVKRSERNLSETMDRNLANGLKAVREITQRLKLPPGA 558

Query: 537  VFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNR 596
            V G LGELI VNEKYK CAE VGGNSL H+VVDTEETA+I+M ELY  K GRVTFIPLNR
Sbjct: 559  VHGPLGELIKVNEKYKTCAEAVGGNSLLHVVVDTEETASILMSELYNTKAGRVTFIPLNR 618

Query: 597  IYLDANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKKFKLN 656
            I     + +P N Q   TPL+ KIKYD+ F+KAVRH+FG+TIVV+DL  G ++++ + L+
Sbjct: 619  ISDRNAVTFPENAQAECTPLLWKIKYDKVFEKAVRHVFGRTIVVRDLGNGSKLARSYNLD 678

Query: 657  SITLDGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQEVDS 716
            ++TLDGDRAD RGV+TGGY+D +K++RLD L  ++ +  +  + +  L +++  I  +DS
Sbjct: 679  AVTLDGDRADNRGVITGGYHDYHKRTRLDCLKDISSAKEQLTQATQSLNAVRLKIGAIDS 738

Query: 717  NIDTLNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEINIRV 776
             ID +N  ++     ++++L+NIEG++ K+     D     E+L+A+ +K  + + ++ V
Sbjct: 739  EIDNVNGELKAQAARKDAILANIEGLRLKMSKMTADSTFKMENLEAMTVKLNRLKTSLTV 798

Query: 777  TADKKETYVKDMSSEFNXXXXXXXXXXXXXTSXXXXXXXXXXXXXXXXXXXXXXXMNSLN 836
              +K E Y  D+   F               +                       ++ L 
Sbjct: 799  NEEKIEKYEDDLKKPFEKNLSDEEEEALKSLAVEIRKLSEPMARTTEALSELSLRIDLLK 858

Query: 837  AELNSKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKE 896
             ELN KL PQK+D+ +++ +E      +  R+++ M  +L+ +  +       + ++ + 
Sbjct: 859  TELNVKLNPQKRDLENRLEEEYSRDDLTTNRELEHMADELKKLAVKEQDLQTSLASLTEA 918

Query: 897  IEDLKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQKIREI 956
            I  L  E+ N  ++LEKA+SQQR L+KKL+TFQK+ EK++IKKT+LITRRDE+Q +I EI
Sbjct: 919  IGTLSEERANYQQLLEKADSQQRALVKKLDTFQKEAEKSVIKKTSLITRRDEVQLRISEI 978

Query: 957  GLLAEDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVERATE 1016
            GLL+E++L    +L +E +L++LN+V++ IS + N+N+RA ENF+KF++K+++L  RA E
Sbjct: 979  GLLSEESLERHQNLETERILRKLNTVNDKISKMSNINRRAIENFKKFNDKREDLESRAEE 1038

Query: 1017 LDESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARM 1076
            L++SK SI+ L+  L++QKV AV++TF KVA NF T+FEKLVP G  +LIIHR       
Sbjct: 1039 LEQSKESIEKLVESLKKQKVEAVEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTE---- 1094

Query: 1077 ETNSNXXXXXXXXXXXXINNN----ESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCA 1132
               SN            +N+N    +S+Y+GVSISVSFNSK NEQL+VEQLSGGQKTVCA
Sbjct: 1095 --KSNRGTGQRSPEYSPLNSNADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCA 1152

Query: 1133 IALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVAD 1192
            IALILAIQMVDPAPFYLFDEIDAALDKQYRT+VAN IK+LS +AQFICTTFRTDMLQVAD
Sbjct: 1153 IALILAIQMVDPAPFYLFDEIDAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVAD 1212

Query: 1193 RFFRVKYENKISTVIEVDKQDAINFIKGNNKYAEV 1227
             F+RVK+ENKIS +  V KQ+AI FIKG NK  E+
Sbjct: 1213 SFYRVKFENKISEIATVSKQEAIKFIKGRNKLGEI 1247

>KLLA0A00286g complement(22024..25866) similar to sp|P47037
            Saccharomyces cerevisiae YJL074c SMC3 required for
            structural maintenance of chromosomes, start by
            similarity
          Length = 1280

 Score = 1105 bits (2858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1248 (47%), Positives = 832/1248 (66%), Gaps = 46/1248 (3%)

Query: 1    MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
            ++IK V+I GFKTY+N+TV+++FSPHHN+V+            AIRFVLS++ SNLKRE+
Sbjct: 58   VHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKRED 117

Query: 61   RQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLN 120
            R+G I+QG+G  VMSA VEI+F DPE+ M+ P     R +  E+ IRRTVGLKKD+Y +N
Sbjct: 118  RKGFIYQGAG-QVMSAFVEIIFDDPENLMLAP----LRNDTGEVRIRRTVGLKKDEYMIN 172

Query: 121  DRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVKL 180
            D+N T+ DV R+LE+ GFS SNPYNIVPQG+IISLTNAKD ERL LLEDVVGAKSFE KL
Sbjct: 173  DKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERLHLLEDVVGAKSFENKL 232

Query: 181  KASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240
            K SLKKME  E+ R +I  E++EL+ +L E+  E++ELEKYN L ++RKV QF LYDREL
Sbjct: 233  KESLKKMEAAERDRTKITNELNELDKRLSELSDEKEELEKYNNLNRDRKVLQFCLYDREL 292

Query: 241  NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQA 300
            NDI NQ+E+L+ +YN    +S +Y+ EL+KRE +   ++K ++ ++S +KIK +TDLPQ 
Sbjct: 293  NDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNKRMNSLESEIKIKQSTDLPQL 352

Query: 301  KSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKF 360
            K+   E+  +L +L  ++ D+++Q+ A +    S+ K +  +  +I+     ++ + PKF
Sbjct: 353  KASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKEIGEVKKQIEINCSSIAEVQPKF 412

Query: 361  QELSKEELKFKLQYNXXXXXXXXXXXXXXXYARFASIEERNEWIQNEIEESDKTLQGLVD 420
            Q+LS E    K++                 Y  F ++ ERN+WIQ +I   +++L     
Sbjct: 413  QKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRTVNERNDWIQEQINLLNQSL----- 467

Query: 421  IKNKILIERDEINSKVRSLDEDIDNLN-------DSIEGPNVTGELEVIQDELEKLKSEY 473
              NK  I +D++ S++ +L  D++NLN       DS+ G     + E +Q+++ + K EY
Sbjct: 468  --NKSNILKDQLTSQLSTLQHDLENLNAEIEDLADSVNGMGSVAQQEDLQNKVTQAKKEY 525

Query: 474  AASIDKRKELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLP 533
               ID+RK+LWR EQ+++T+  +L  +VK  E ++NET+DRSLA G+++V +I  +L L 
Sbjct: 526  LTKIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETIDRSLALGLQNVNDIVNRLNLH 585

Query: 534  EDSVFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIP 593
            E  VFG +GELI V++KYKICAEVVGGNSLF++VVD EETA++++KEL+  KGGRVTFIP
Sbjct: 586  E-HVFGPVGELIKVSDKYKICAEVVGGNSLFNVVVDNEETASLLIKELFATKGGRVTFIP 644

Query: 594  LNRIYLDANIQYPPN-DQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRISKK 652
            LN++++D N  YP N ++   TPLI KIKYD +F+K ++ +FG+T+VVK L  G  ++K+
Sbjct: 645  LNKLHVDTNFTYPNNLEKNQCTPLIKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLAKE 704

Query: 653  FKLNSITLDGDRADKRGVLTGGYYDQYKQSRLDSLSTLNESTAKHRELSLELTSIKQAIQ 712
            +KLN+ITLDGDRAD +GVL+GGY DQYK +RLD+L    +S  +++++ +EL  IKQA+Q
Sbjct: 705  YKLNAITLDGDRADSKGVLSGGYLDQYKSNRLDTLRDFKQSKREYKKIQVELQEIKQALQ 764

Query: 713  EVDSNIDTLNNSIRKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESLQALAIKTEKNEI 772
             ++  ID LNN ++     R++  + IE  +S+L+ K + KI +++S++AL  +  K + 
Sbjct: 765  SIEQEIDGLNNVVKDAAAERDAYEAGIEKARSQLKAKLSQKITIDDSIKALKARLNKIDT 824

Query: 773  NIRVTADKKETYVKDMSSEFNXXXXXXXXXXXXXTSXXXXXXXXXXXXXXXXXXXXXXXM 832
             +    ++   +  D+S  F               S                       +
Sbjct: 825  ELEQCRERTNAFAADISKPFVNELDADEKAELLAISNSIQTKETSLNFNLSTLNELSSKL 884

Query: 833  NSLNAELNSKLFPQKQDILSQMSQEGLSYLSSLRRDVDSMTSKLEAVQNQCNSALQHVDT 892
            + LNAELNSKL P+  ++  + S      +S +   ++ +  + + V          +  
Sbjct: 885  DELNAELNSKLLPKLHELERKPSSSHSLQISQINNQMELVLMEKQTVTRTKEQVESELSV 944

Query: 893  IQKEIEDLKSEKRNNDKILEKANSQQRLLLKKLETFQKDVEKTMIKKTALITRRDELQQK 952
            +   I+ L+ EK    K L+KANSQQR L+K++  FQK+ EK ++KK+ L +R++ELQQ 
Sbjct: 945  LDSSIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQL 1004

Query: 953  IREIGLLAEDALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQKELVE 1012
            IRE+GLLAE++L  +  L+S+E+LK+LN+ +  +S + NVNKRA EN+ +F++K+ EL  
Sbjct: 1005 IREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELTS 1064

Query: 1013 RATELDESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLII-HR-- 1069
            RA ELDESK SI++LI +L++QK+TA++ TF KVA+NF  VF  LVP G  KLII HR  
Sbjct: 1065 RAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKN 1124

Query: 1070 VDNN----------ARMETNSNXXXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQLH 1119
             DN+          AR E NS                NES YTGVSI VSFNSK++EQL 
Sbjct: 1125 TDNSEVSTKKRRRGARQEQNSAEAL------------NESKYTGVSIQVSFNSKKDEQLR 1172

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFI 1179
            VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR AVA  IK LS  AQFI
Sbjct: 1173 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1232

Query: 1180 CTTFRTDMLQVADRFFRVKYENKISTVIEVDKQDAINFIKGNNKYAEV 1227
            CTTFRTDM+ VAD FFRVK+ENK+STV EV +QDA+NF +GNNK  E+
Sbjct: 1233 CTTFRTDMINVADTFFRVKFENKVSTVTEVSRQDAVNFSRGNNKMEEL 1280

>Scas_565.6
          Length = 1170

 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 194/742 (26%), Positives = 331/742 (44%), Gaps = 77/742 (10%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
           M ++ ++I GFK+Y  +TVI D+ P  N +             AI FVL      + R  
Sbjct: 1   MKVEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRAS 60

Query: 61  R-QGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDD-YQ 118
             Q LI++     V  ASV IVF D   K   P G     N+ +I + R + L     Y 
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVF-DNSDKTNSPIGF---NNSSKISVTRQIILGGTSKYL 116

Query: 119 LNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEV 178
           +N     +  V+++ +S   +++NP  ++ QGKI  + N K  E L L+E+  G K FE 
Sbjct: 117 INGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPNEILSLIEEAAGTKMFEN 176

Query: 179 KLKASLKKM--EETEQKRARIAKEMDELNSKLKEMEQERKELEKYNA----LEKNRKVFQ 232
           + + + + M  +ET+ + +R   E +E+  KL+++  E++   ++       EK  KV  
Sbjct: 177 RREKAERTMAKKETKLQESRTLLE-EEIEPKLEKLRNEKRMFLEFQTTQADFEKTMKVVH 235

Query: 233 FTLYDRELNDIINQVERLDDDYNVTANSSEQYIKELD----KREEIISNISKNLSE--ID 286
              Y     ++IN+   + D       SSE  + EL     +  E I +++++L +  I 
Sbjct: 236 AFDY----KNMINRHASVKD----VLESSEARMAELKGLILRTAEEIGSLNEDLEQVKIQ 287

Query: 287 STLKIKTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEI 346
              ++     L + +   SEL N+++ ++         IK   +Q    +  ++     +
Sbjct: 288 KEKELDKDATLSRLEKEESELLNEVSRIKTSHSICNDNIKENNKQVEKLKSDIEQFKLTL 347

Query: 347 QKREQKLSSISPKFQELSKEELKFKLQYNXXXXXXXXXXXXXXX-------YARFASIEE 399
           +++ +   S   ++QE++    K K  Y+                      Y+   +I  
Sbjct: 348 KEKSETFESTEKEYQEINASLAKIKETYSKKEELLSTLLTGITSTGDTDGGYSAQLTIA- 406

Query: 400 RNEWIQNEIEESDKTLQGLVDIKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVTGEL 459
           +N+   N+ E S K L   +DI NK L+     N++ +     I+N  + I G NV    
Sbjct: 407 KNKL--NDTEVSIKKLSMRIDILNKELV-----NNQPKLQQAKIEN--EKIRG-NVEKHK 456

Query: 460 EVIQDELEKLKSEYAASIDKRKELWRNE-------QKIETVLQNLLENVKVLERNVNETM 512
            V  D LE+  S+      + KEL   E        ++ET  +NL   V  L+ N     
Sbjct: 457 HVCLD-LEQQLSKSGFDPLRTKELKTRENSLRQEIHRVETQNENLKRRVAGLDFNYTNPS 515

Query: 513 DRSLANGIKSVKEIATKLKLPEDSVFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEE 572
           +   A   +SVK +A +L       F     L       ++CA    G  L+++VVD E+
Sbjct: 516 ENFDA---RSVKGVAAQLFTLNKDHFDAASAL-------QVCA----GGRLYNVVVDNEK 561

Query: 573 TATIIMKELYKMKGGRVTFIPLNRIY---LDA-NIQYPPNDQTSFTPL-INKIKYDQRFD 627
           TA++++++    K  RVT IPLN+I    L+A  +Q   +       L +N I YD    
Sbjct: 562 TASLLLEKGRLRK--RVTIIPLNKIAARTLNARTLQMAKDIAPGKVELALNLIGYDDEVS 619

Query: 628 KAVRHIFGKTIVVKDLTTGLRIS--KKFKLNSITLDGDRADKRGVLTGGYYDQYKQSRLD 685
           +A+  IFG ++V +D  T  +++   + +  SITLDGD  D  G L+GG  +        
Sbjct: 620 RAMEFIFGGSLVCQDANTAKKVTFHPQIRTRSITLDGDVYDPEGTLSGGSRNNTNNLL-I 678

Query: 686 SLSTLNESTAKHRELSLELTSI 707
           ++ T NES    ++L  EL  I
Sbjct: 679 NIQTYNESCQTLKKLRYELDDI 700

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 95/190 (50%), Gaps = 29/190 (15%)

Query: 1017 LDESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARM 1076
            +++ K  IQ+ I++L + K   +  T+ KV E+F  +F  L+P   AKL+          
Sbjct: 1007 IEKDKVKIQETISKLNEYKRDTLIKTWEKVTEDFGHIFADLLPNSFAKLVP--------- 1057

Query: 1077 ETNSNXXXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALI 1136
                              +  + +  G+ + V   +   + L VE LSGGQ+++ A++LI
Sbjct: 1058 ------------------SEGKDVTEGLEVRVKLGNLWKDSL-VE-LSGGQRSLVALSLI 1097

Query: 1137 LAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFR 1196
            +A+    PAP Y+ DE+DAALD  +   + ++IK     +QFI  + +  M   A+R FR
Sbjct: 1098 MALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFSNANRVFR 1157

Query: 1197 VKYENKISTV 1206
             +++N  S V
Sbjct: 1158 TRFQNGTSVV 1167

>CAGL0D05258g 500858..504370 similar to sp|P38989 Saccharomyces
            cerevisiae YFR031c SMC2 chromosome segregation protein,
            start by similarity
          Length = 1170

 Score = 90.5 bits (223), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 125/268 (46%), Gaps = 59/268 (22%)

Query: 966  AFNDLSSE------ELLKRLNSVSEDISGLKNVN--KRAYENFRK-FDEKQK-------- 1008
            A ND+  E      E+L R  S+ E  +G+ NVN  +   E  +K FDE ++        
Sbjct: 932  ALNDIQEEHEWVTDEMLVR--SICEQNAGV-NVNEYRHRMEQLQKNFDELRRKVNPNIMN 988

Query: 1009 --ELVERATE--------LDESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLV 1058
              E VE+  E        +++ K  I+D I++L + K   +  T+ KV ++F  +F  L+
Sbjct: 989  MIESVEKKGEALKTMIRTIEKDKKKIEDTISKLNEYKKETLVKTWKKVTKDFGNIFCDLL 1048

Query: 1059 PIGKAKLIIHRVDNNARMETNSNXXXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQL 1118
            P   AKL+                               + I  G+ + V   +   E L
Sbjct: 1049 PNSSAKLVPCE---------------------------GKDITEGLEVKVKLGNLWKESL 1081

Query: 1119 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQF 1178
               +LSGGQ+++ A++LI+A+    PAP Y+ DE+DAALD  +   + ++IK     +QF
Sbjct: 1082 V--ELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQF 1139

Query: 1179 ICTTFRTDMLQVADRFFRVKYENKISTV 1206
            I  + +  M   A+R FR ++++  S V
Sbjct: 1140 IVVSLKEGMFTNANRVFRTRFQDGTSVV 1167

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 88/334 (26%), Positives = 154/334 (46%), Gaps = 29/334 (8%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLS-DDYSNLKRE 59
           M ++ ++I GFK+Y  +TVI D+ P  N +             AI FVL     + ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAS 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGV--VPRENNDEICIRRTVGLKKDD- 116
             Q LI++     V  ASV IVF D   K   P G    P+     I + R + L     
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVF-DNTDKSNTPIGFSEYPK-----ISVTRQIVLGGTSK 114

Query: 117 YQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSF 176
           Y +N     +  V+++ +S   +++NP  ++ QGKI  + N K  E L L+E+  G K F
Sbjct: 115 YLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSEILSLIEEAAGTKMF 174

Query: 177 EVKLKASLKKMEETEQK----RARIAKEMDELNSKLKEMEQERKELEKYNA-LEKNRKVF 231
           E + + + + M++ E K    R  + +E+D    KL+  ++   E +   A LE   KV 
Sbjct: 175 EDRKEKAERTMQKKETKLQENRTLLKEEIDPQLEKLRNEKRLFLEFQTIQADLETTEKVV 234

Query: 232 QFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSE-IDSTLK 290
             T Y + LN          D       +S   + EL K+ ++++    NL+E +  T+K
Sbjct: 235 IATDYQKMLNS--------RDSIKTVLETSNSKMDELQKKIDLVNREISNLNEDLQQTMK 286

Query: 291 -----IKTTTDLPQAKSRHSELTNQLTNLQVQIK 319
                ++  T++   +S+  +L +++  L+  +K
Sbjct: 287 QKKKELENDTNIKAMESKEDKLLSEIAKLKANLK 320

>AGR236W [4547] [Homologous to ScYFR031C (SMC2) - SH]
           complement(1189851..1193363) [3513 bp, 1170 aa]
          Length = 1170

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 100/385 (25%), Positives = 171/385 (44%), Gaps = 44/385 (11%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLS-DDYSNLKRE 59
           M ++ ++I GFK+Y  +TVI  + P  N +             +I FVL     + ++ +
Sbjct: 1   MKVEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQ 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVF--HDPEHKMILPSGVVPRENNDEICIRRTVGLKKDD- 116
             Q LI++     V+ ASV IVF   DP      P G    E   +I + R + L     
Sbjct: 61  NLQDLIYKRGQAGVIKASVTIVFDNSDPSSS---PFGF---ETYPKISVTRQIILGGTSK 114

Query: 117 YQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSF 176
           Y +N     +  V+ + +S   +++NP  ++ QGKI  + N K  E L L+E+  G + F
Sbjct: 115 YLINGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPDEILALIEEAAGTRMF 174

Query: 177 EVKLKASLKKMEETEQKRARI-AKEMDELNSKLKEMEQERKELEKYNA----LEKNRKVF 231
           E + + + K M + E K   I A  ++E+  KL  +  E++   ++      LEK  ++ 
Sbjct: 175 EDRREKAEKTMAKKETKLQEIRALLLEEIEPKLNRLRNEKRAFLEFQQTQTDLEKTSRIV 234

Query: 232 QFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKEL----DKREEIISNISKNLSEI-- 285
               Y   +    +  ERL  D        ++ IK+L    +K  + IS ++++   I  
Sbjct: 235 NTYDYQTLVQKRSSMQERLQSD--------QKRIKDLEFSVEKYRDEISTLTEDFESIRR 286

Query: 286 --DSTLKIKTTTDLPQAK--SRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDI 341
             +  L+  TT    +AK  S  +EL+     L +   DL             +Q+ L  
Sbjct: 287 QKEKQLQKDTTLQTLEAKENSLSTELSRVTAALGITRDDLA-----------DEQRNLSA 335

Query: 342 INDEIQKREQKLSSISPKFQELSKE 366
           +N  I K EQ+L+S+S  + E   E
Sbjct: 336 LNLSIAKSEQELTSLSKTYSETENE 360

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 92/346 (26%), Positives = 164/346 (47%), Gaps = 35/346 (10%)

Query: 862  LSSLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIEDLKSEKRNNDKILEKANSQQRLL 921
            ++ L RDV   ++ LE+VQ   N     +  I +EIE+L S  R+  K + ++  + + L
Sbjct: 856  ITKLERDVLLRSNDLESVQRDLNEERNKLLRIDEEIEELTSLIRDKSKKMSESELEYQKL 915

Query: 922  LKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLLAEDALNAFNDLSSEELLKRLNS 981
              +    + + EK   +  AL   +DE    + + GL+A + LN    ++ EE  +R   
Sbjct: 916  TAEANKSKYNAEKIEEEIKAL---KDE-NSWLSDAGLVA-NILNQNEGINLEEYRERAKQ 970

Query: 982  VSEDISGLK-NVNKRAYENFRKFDEKQKELVERATELDESKTSIQDLITRLRQQKVTAVD 1040
            + E   G++  VN          ++K+  L      +++ K  I + I +L + K  A+ 
Sbjct: 971  LQEKFQGMRRKVNPNIMSMIENVEKKEAALRTMIKTIEKDKMKIVETIEKLNEYKRDALV 1030

Query: 1041 STFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARMETNSNXXXXXXXXXXXXINNNESI 1100
             T+ KV  +F  +F +L+P   AKL        A +E                    + +
Sbjct: 1031 KTWEKVNVDFGNIFAELLPNSFAKL--------AAIE-------------------GKDV 1063

Query: 1101 YTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQ 1160
              G+ + V   +   E L   +LSGGQ+++ A++LILA+    PAP Y+ DE+DAALD  
Sbjct: 1064 TAGLEVKVKLGTLWKESLV--ELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLS 1121

Query: 1161 YRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYENKISTV 1206
            +   + ++IK     +QFI  + +  M   A+R F+ ++++  S V
Sbjct: 1122 HTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFKTRFQDGTSVV 1167

>YFR031C (SMC2) [1711] chr6 complement(216582..220094) Subunit of
            condensin protein complex required for chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [3513 bp, 1170 aa]
          Length = 1170

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/217 (26%), Positives = 100/217 (46%), Gaps = 29/217 (13%)

Query: 990  KNVNKRAYENFRKFDEKQKELVERATELDESKTSIQDLITRLRQQKVTAVDSTFLKVAEN 1049
            K VN          ++K+  L      +++ K  IQ+ I++L + K   +  T+ KV  +
Sbjct: 980  KKVNPNIMNMIENVEKKEAALKTMIKTIEKDKMKIQETISKLNEYKRETLVKTWEKVTLD 1039

Query: 1050 FETVFEKLVPIGKAKLIIHRVDNNARMETNSNXXXXXXXXXXXXINNNESIYTGVSISVS 1109
            F  +F  L+P   AKL+                               + +  G+ + V 
Sbjct: 1040 FGNIFADLLPNSFAKLVPCE---------------------------GKDVTQGLEVKVK 1072

Query: 1110 FNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANII 1169
              +   E L   +LSGGQ+++ A++LI+A+    PAP Y+ DE+DAALD  +   + ++I
Sbjct: 1073 LGNIWKESLI--ELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLI 1130

Query: 1170 KQLSVNAQFICTTFRTDMLQVADRFFRVKYENKISTV 1206
            K     +QFI  + +  M   A+R FR ++++  S V
Sbjct: 1131 KTRFKGSQFIVVSLKEGMFANANRVFRTRFQDGTSVV 1167

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 94/195 (48%), Gaps = 6/195 (3%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLS-DDYSNLKRE 59
           M ++ ++I GFK+Y  +TVI D+ P  N +             AI FVL     S ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRAS 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLK-KDDYQ 118
             Q LI++     V  ASV IVF D   K   P G     N+ +I + R V L     Y 
Sbjct: 61  SLQDLIYKRGQAGVTKASVTIVF-DNTDKSNSPIGFT---NSPQISVTRQVVLGGTSKYL 116

Query: 119 LNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEV 178
           +N     +  V+++ +S   +++NP  ++ QGKI  + N K  E L L+E+  G K FE 
Sbjct: 117 INGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILSLIEEAAGTKMFED 176

Query: 179 KLKASLKKMEETEQK 193
           + + + + M + E K
Sbjct: 177 RREKAERTMSKKETK 191

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 18/151 (11%)

Query: 537 VFGTLGELINV---NEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIP 593
           V G +G+L  +   N +Y    +   G  LF++VV   +TAT +++     K  RVT IP
Sbjct: 523 VHGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIP 580

Query: 594 LNRIY--------LDANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTT 645
           L++IY        LD   +  P         IN I++D+   KA+  IFG +++ +D  T
Sbjct: 581 LDKIYTRPISSQVLDLAKKIAPG---KVELAINLIRFDESITKAMEFIFGNSLICEDPET 637

Query: 646 GLRIS--KKFKLNSITLDGDRADKRGVLTGG 674
             +I+   K +  SITL GD  D  G L+GG
Sbjct: 638 AKKITFHPKIRARSITLQGDVYDPEGTLSGG 668

>KLLA0D16005g complement(1346492..1350004) similar to sp|P38989
           Saccharomyces cerevisiae YFR031c SMC2 chromosome
           segregation protein, start by similarity
          Length = 1170

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 102/402 (25%), Positives = 186/402 (46%), Gaps = 60/402 (14%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLS-DDYSNLKRE 59
           M ++ ++I GFK+Y  +TVI D+ P  N +             AI FVL     + ++ +
Sbjct: 1   MKVEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQ 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTV---GLKKDD 116
             Q LI++     V  ASV IVF++ +      +  +  E++ +I I R +   G+ K  
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVFNNSD----TSNSPIGFESHAKISITRQIILGGVSK-- 114

Query: 117 YQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSF 176
           Y +N     +  V+++ +S   +++NP  ++ QGKI  + N K +E L L+E+  G + F
Sbjct: 115 YLINGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQEILSLIEEAAGTRMF 174

Query: 177 EVKLKASLKKMEETEQKRARIAKEM-DELNSKLKEMEQERK----------ELE------ 219
           E + + + + M + E K   I   + +E+  KL+    E++          +LE      
Sbjct: 175 EDRREKAERTMAKKETKLQEIRTLLTEEIEPKLERFRNEKRTYLEFQETQSDLENVMRVV 234

Query: 220 ---KYNALEKNRKVFQFTLYD-----RELNDII----NQVERLDDDYNVTANSSEQYIK- 266
              +++ L   +K  + +L+       EL D I    N+VE L  D +       + ++ 
Sbjct: 235 NAFEFSQLSNKKKHIEESLHSGQSRLEELEDTISRLKNEVENLGSDLDALKEQRHKEVQL 294

Query: 267 -----ELDKREEIISNISKNLSEIDSTLKIKTTTDLPQAKSRHSELTNQLTNLQVQIKDL 321
                EL+ +E   S IS  LS + ++L I    D  + K R       ++NL+  I+  
Sbjct: 295 GGRMSELETKE---SEISNELSRVQTSLNI-ALEDSGEEKVR-------ISNLKKNIERW 343

Query: 322 KLQIKAQERQANSDQKTLDIINDEIQKREQKLSSISPKFQEL 363
           K Q + ++   +S  K  +I N    K+ ++L +I  + QEL
Sbjct: 344 KQQHQEKKTLYDSKYKEYNIQN----KKLEELKAIHKEKQEL 381

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 107/231 (46%), Gaps = 30/231 (12%)

Query: 977  KRLNSVSEDISGLK-NVNKRAYENFRKFDEKQKELVERATELDESKTSIQDLITRLRQQK 1035
            KR + ++E    L+  VN          ++K+  L      +++ K  IQ+ I +L + K
Sbjct: 966  KRGSDLAESFQSLRRKVNPEVMSMIESVEKKETALKTMIKTIEKDKQKIQETIEKLNEYK 1025

Query: 1036 VTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARMETNSNXXXXXXXXXXXXIN 1095
               +  T+ KV+ +F  +F  L+P   AKL                             +
Sbjct: 1026 RETLIKTWEKVSVDFGNIFGDLLPNSFAKL---------------------------EPS 1058

Query: 1096 NNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDA 1155
              + +  G+ + V       E L VE LSGGQ+++ A++LILA+    PAP Y+ DE+DA
Sbjct: 1059 EGKDVTEGLEVKVKLGKIWKESL-VE-LSGGQRSLIALSLILALLQFKPAPMYILDEVDA 1116

Query: 1156 ALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYENKISTV 1206
            ALD  +   + ++IK     +QFI  + +  M   A+R FR ++++  S V
Sbjct: 1117 ALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTSVV 1167

>Scas_681.4
          Length = 1409

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 161/723 (22%), Positives = 303/723 (41%), Gaps = 101/723 (13%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
           ++I ++ +  FK+Y  Q V+  F    + V+            ++ FV     + ++++ 
Sbjct: 149 LFINKLTLNNFKSYAGQQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 208

Query: 61  RQGLIHQGSG-GSVMSASVEIVF------HDPEHKMILPSGVVPRENNDEICIRRTVGLK 113
              LIH+      + S SV++ F      HD + K+   S   P+     +  R+     
Sbjct: 209 LSDLIHKSEKFPDLTSCSVDVEFLYAIDEHDGDTKI---SETKPKL----VISRKAFKNN 261

Query: 114 KDDYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQL 166
              Y +N +     DV ++L+  G  + +   ++ QG++ ++   K K         L+ 
Sbjct: 262 SSKYYINGKESNYTDVTKLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEY 321

Query: 167 LEDVVGAKSFEVKLKASLKKME-------ETEQKRARIAKEMDELNSKLKEMEQERKELE 219
           LED++G   ++  ++  L ++E       E E +   + +E + L S  K +  E  E E
Sbjct: 322 LEDIIGTSKYKQLIEKDLIEIESLNEICIEKENRFEIVDREKNSLESG-KNLALEFLEKE 380

Query: 220 KYNALEKNRKVFQFTLY--DRELNDIINQVERLDDDYNVTANSSEQYIKELDKREEIISN 277
           K   L K+ K+ Q+ L+  + +L + + ++  L+++YNV  + ++    E+++ +++   
Sbjct: 381 KQLTLSKS-KLLQYNLWQNNSKLTNTLQKISALNEEYNVEKSKNQTLQNEINRTKQL--- 436

Query: 278 ISKNLSEIDSTLKIKTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQK 337
               L+E  S +K+    +  Q KS+   L  +  +L  ++K+L  +    E+   + +K
Sbjct: 437 ----LNESQSKIKVLEGEEKQQLKSKRI-LEGEHVSLDEKLKNLTQKKAKTEKIIATTEK 491

Query: 338 TLDIINDEIQKREQKLSSISPKFQEL---------SKEELKFKLQYNXXXXXXXXXXXXX 388
           T+  +  EIQ+ E+     S + + L         S E +K KL+               
Sbjct: 492 TISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLKLKEKTSGISEEILIHEH 551

Query: 389 XXYARFASIEERNEWIQNEIEESDKTL--QGLVDIKNKILIERDEINSKVR---SLDEDI 443
                   ++E+   IQ  + ES  +L  +G V +KN I +   E++++       +ED+
Sbjct: 552 DLEPWNIKVQEKKTEIQ--LVESQISLLQEGQVKLKNDIKVLSQEVSNQTALKIKREEDL 609

Query: 444 DNL---NDSIEGPNVTGELEVIQDELEKLKSEYAASIDKRKELWRNEQKIETVLQNLLEN 500
            NL     SI      GE E   D   KLK                           ++N
Sbjct: 610 VNLKKQQSSITKEISNGETEC-NDGRSKLKE--------------------------MKN 642

Query: 501 VKVLERNVNETMDRSLANGIKSVKEIATKLKLPED----SVFGTLGELINVNEKYKICAE 556
           V  ++R        +LAN     K +    KL +        G LG+L  ++  Y +   
Sbjct: 643 VLNMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVS 702

Query: 557 VVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRI--YLDANIQYPPNDQTSFT 614
                 L  IVV+T E     ++ L K K G   FI L+++  +    IQ P N    F 
Sbjct: 703 TACPR-LDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFD 761

Query: 615 PLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRIS---KKFKLNSITLDGDRADKRGVL 671
            +  K   D +F  A   +   T+V KDL    R++   +++++  +TLDG   D  G +
Sbjct: 762 LIKPK---DSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRV--VTLDGKLIDVSGTM 816

Query: 672 TGG 674
           +GG
Sbjct: 817 SGG 819

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 63/105 (60%), Gaps = 3/105 (2%)

Query: 1103 GVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR 1162
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1292 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1349

Query: 1163 TAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYENKISTV 1206
            + VAN IK+ + NAQFI  + R +M ++A +   + K EN+  + 
Sbjct: 1350 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSA 1394

>Sklu_2249.2 YFR031C, Contig c2249 627-3873 reverse complement
          Length = 1083

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 98/202 (48%), Gaps = 21/202 (10%)

Query: 521 KSVKEIATKLKLPEDSVFGTLGELINVNEKYKICAEVVGGNSLFHIVVDTEETATIIMKE 580
           KSVK +A +L   E   F +   L       ++CA    G  LF++VVD E TA+ +++ 
Sbjct: 521 KSVKGVAAQLFTLEKENFDSATAL-------QVCA----GGRLFNVVVDNEVTASQLLER 569

Query: 581 LYKMKGGRVTFIPLNRIYLDANIQYPPNDQTSFTP-----LINKIKYDQRFDKAVRHIFG 635
               K  RVT IPLN+I      +       S  P      +N I Y+    +A+  IFG
Sbjct: 570 GRLRK--RVTIIPLNKIASRTLNENALKLAKSVAPGNVELALNLIGYEDEVSRAMEFIFG 627

Query: 636 KTIVVKDLTTGLRIS--KKFKLNSITLDGDRADKRGVLTGGYYDQYKQSRLDSLSTLNES 693
            +++ KD  T  R++   + +  SITLDGD  D  G L+GG  +  K S L  + T N +
Sbjct: 628 TSLICKDAETAKRVTFHPQIRARSITLDGDIYDPEGTLSGGSRN-TKNSLLIDIQTFNAA 686

Query: 694 TAKHRELSLELTSIKQAIQEVD 715
           + +  E+ LEL  I   I E +
Sbjct: 687 SKRLNEMELELKQINSKIAEYE 708

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 94/363 (25%), Positives = 162/363 (44%), Gaps = 24/363 (6%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLS-DDYSNLKRE 59
           M ++ ++I GFK+Y  +TVI ++ P  N +             +I FVL       ++  
Sbjct: 1   MKVEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRAS 60

Query: 60  ERQGLIHQGSGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGLKKDD-YQ 118
             Q LI++     V  ASV IVF D   K   P G    E+  +I + R + L     Y 
Sbjct: 61  NLQDLIYKRGQAGVTKASVTIVF-DNTDKSSSPIGF---ESYPKISVTRQIILGGTSKYL 116

Query: 119 LNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEV 178
           +N     +  V+ + +S   +++NP  ++ QGKI  + N K  E L L+E+  G + FE 
Sbjct: 117 INGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTEILSLIEEAAGTRMFED 176

Query: 179 KLKASLKKMEETEQKRARIAKEM-DELNSKLKEMEQERKEL----EKYNALEKNRKVFQ- 232
           + + + K M + E K   I   + +E+  KL+++  +++      E    LEK  ++   
Sbjct: 177 RREKAEKTMAKKETKLQEIRTLLEEEIEPKLEKLRNQKRAFLEFQETQTDLEKTLRILNA 236

Query: 233 FTLYDREL-NDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKI 291
           +  YD    N  I +          T  +S   ++EL+   +   N   NL E   T+KI
Sbjct: 237 YEYYDMATKNSTIKE----------TLQNSTARVEELNNFIQKTKNEISNLDEDLKTIKI 286

Query: 292 KTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQ 351
           +    + Q   + S+L  Q  +L  +I  LK  +       N +   L  +++ +QK E+
Sbjct: 287 QKQEQV-QKDGKLSQLEKQENDLANEISRLKTALGISVENINEESYKLKKLHENVQKFER 345

Query: 352 KLS 354
            LS
Sbjct: 346 DLS 348

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 93/204 (45%), Gaps = 6/204 (2%)

Query: 864  SLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIEDLKSEKRNNDKILEKANSQQRLLLK 923
            S+  D+    ++L  +QN  N     +  I  EI +L+S     ++ L  +  + + L  
Sbjct: 858  SIEDDLSLRQTELNQIQNDLNEEKTRLLDIDDEIRELESLLMKKNEQLSNSELELQKLTH 917

Query: 924  KLETFQKDVEKTMIKKTALITRRDELQQKIREIGLLAEDALNAFNDLSSEELLKRLNSVS 983
            +L  F+   +K   +  +L+     L  K    GL+  + +N    ++ EE  +R N + 
Sbjct: 918  ELNKFKSSTDKIEQRIESLLEDNRWLNDK----GLVL-NIINQNEGINLEEYRQRGNQLQ 972

Query: 984  EDISGLK-NVNKRAYENFRKFDEKQKELVERATELDESKTSIQDLITRLRQQKVTAVDST 1042
            E   G+K  VN          ++K+  L      +++ KT IQ+ I +L + K   +  T
Sbjct: 973  EKFQGMKRKVNPNIMSMIENVEKKETALKTMIKTIEKDKTKIQETIEKLNEYKRDTLLKT 1032

Query: 1043 FLKVAENFETVFEKLVPIGKAKLI 1066
            + KV+ +F  +F  L+P   AKL+
Sbjct: 1033 WEKVSVDFGNIFGDLLPNSFAKLV 1056

>AGR089C [4399] [Homologous to ScYLR086W (SMC4) - SH] (901443..905555)
            [4113 bp, 1370 aa]
          Length = 1370

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 61/100 (61%)

Query: 1119 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQF 1178
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IK+ + NAQF
Sbjct: 1271 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1330

Query: 1179 ICTTFRTDMLQVADRFFRVKYENKISTVIEVDKQDAINFI 1218
            I  + R +M ++A R   +   + ++    +  +D IN +
Sbjct: 1331 IVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNRDIINVL 1370

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 160/722 (22%), Positives = 308/722 (42%), Gaps = 99/722 (13%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
           + I+ +V++ FK+Y  + V+  F    + V+            ++ F      + +++ +
Sbjct: 106 LCIRTLVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGK 165

Query: 61  RQGLIHQGSGGSVMS-ASVEIVFH----DPEHKMILPSGVVPRENNDEICI-RRTVGLKK 114
              LIH+      +   SVEI F     +P+    + SG        E+ + R+      
Sbjct: 166 LSHLIHKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSG------KPELSVMRKAFKNNT 219

Query: 115 DDYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLL 167
             Y LN +  T  +V R+L   G  + +   ++ QG++ S+   K K         L+ L
Sbjct: 220 SKYYLNGKESTYTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYL 279

Query: 168 EDVVGAKSFEVKLKASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYN-ALEK 226
           ED++G   ++ +++ +L               E+D LN    E E     +EK   +LE 
Sbjct: 280 EDIIGTTKYKAQIEQAL--------------VEVDSLNDICMEKENRFDLVEKEKLSLEP 325

Query: 227 NR-KVFQFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEI 285
            + +   F   +++L  ++++  +    Y++  N S        K  + +SN+S  ++++
Sbjct: 326 GKDEALAFLKKEKDLTLLMSKKYQ----YHLFHNGS--------KLAKTLSNVSNTMNKL 373

Query: 286 DS--TLKIKTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSD-------- 335
           +     K++   ++ +      +L N+L ++    K+   +++  ER+  S+        
Sbjct: 374 EQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNEEKQKSLL 433

Query: 336 ------QKTLDIINDEIQKREQKLSSISPKFQEL--SKEELKFKL---QYNXXXXXXXXX 384
                 +KTL+ +   I++ E K+     + QE   S   L   +   Q           
Sbjct: 434 QKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELEKMKLALS 493

Query: 385 XXXXXXYARFASIEERNEWIQNEIEESDKTLQGLVDIKNKILIERDEINSKVRSLDEDID 444
                     A +E+  E   N++EE    ++ LV+ +  I+ E D        L+ +I 
Sbjct: 494 DKTGDITKEVAVLEKELEPWTNKVEEKKSEIK-LVESEISIIKEAD------LKLESEIA 546

Query: 445 NLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKRKELWRNEQKIETVLQNLLENVKVL 504
           NL+  IE   + G +   ++ +E L  E ++SI  R  +   E++  +    L E  KVL
Sbjct: 547 NLSQEIE--QLRGNISHREESIETLNVE-SSSI--RDYILVGERECTSARSKLEEMKKVL 601

Query: 505 ---ERNVNETMDRSLANGIKSVKEIATKLKLPEDS-----VFGTLGELINVNEKYKICAE 556
               + VN+   RS  +  ++  ++ T L   + S       G LG+L  +++KY I A 
Sbjct: 602 VTHRQRVNDA--RSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDI-AI 658

Query: 557 VVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLDANIQYPPNDQTSFTPL 616
                 L  IVVDT E     ++ L K K G   FI L+++    N+Q P +   +   L
Sbjct: 659 STACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLR-KFNLQ-PAHTPENVPRL 716

Query: 617 INKIKY-DQRFDKAVRHIFGKTIVVKDLTTGLRIS---KKFKLNSITLDGDRADKRGVLT 672
            + +K  + +F  A   +   T+V  DL+   R++   K++++  +TLDG   D  G +T
Sbjct: 717 FDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRV--VTLDGKLIDISGTMT 774

Query: 673 GG 674
           GG
Sbjct: 775 GG 776

>CAGL0F02079g 201002..204673 similar to sp|P32908 Saccharomyces
           cerevisiae YFL008w SMC1 chromosome segregation protein,
           start by similarity
          Length = 1223

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 177/729 (24%), Positives = 310/729 (42%), Gaps = 128/729 (17%)

Query: 117 YQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGA--- 173
           Y+L+   VT  +  + LES    +     +V QG +  + +       +L+E+V G+   
Sbjct: 117 YKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSPLGLTKLIEEVSGSMQY 176

Query: 174 -KSFEVKLKASLKKM----EETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNR 228
            K +E +LK    K+     E+ +KR RI  E+      +   E+ RK ++K   ++ N 
Sbjct: 177 KKEYE-ELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRDEEYRKYVQKKKRVQTNL 235

Query: 229 KVFQFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKELD--------------KREEI 274
            ++Q    + E    + ++E   +D +V     E   K L+              K++  
Sbjct: 236 SLWQLYHMEDERYQCLQKLEESQNDVDVIREKLEAEEKNLEVFKKALSKEAVLLTKKKNH 295

Query: 275 ISNISKNLSEIDSTLKIKTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQERQANS 334
           I +ISK   + +S LK+     +PQ  S      N+L NL  ++  L+  ++ +E     
Sbjct: 296 IRSISKEKEKAESDLKV---VKIPQNAS-----INRLKNLDKRVDSLQKDLEREEANLEK 347

Query: 335 DQKTLDIINDEIQKREQKLSSISP---KFQELSKEELKFKLQYNXXXXXXXXXXXXXXXY 391
            +  L ++ D     EQ++ S S    KF  LS+++LK    Y+                
Sbjct: 348 YKHQLKVVTDSKNAFEQEILSKSKNNNKFT-LSEDDLKL---YD---------------- 387

Query: 392 ARFASIEERNEWIQNEIEESDKTLQGLVDIKNKILIERDEINSKVRSLDEDIDN------ 445
                 E + E++ N   E + TL  L + K +I  +   IN KV    + I++      
Sbjct: 388 ------ELKGEYLNNGGIEIEDTLNLLDNKKEEITADLKIINDKVEISKQRIEDELVTKK 441

Query: 446 ------LNDSIEGPNVTGELEVIQ-DELEKLKSEYAASIDKRKELWRNEQKIETVLQNLL 498
                 + DS    N   +L   + DEL K + +         E W N+   E  L + L
Sbjct: 442 EEQDAKIRDSTLLLNEKNDLHSHKLDELRKTQKDI--------EYWNNK---EFDLNHKL 490

Query: 499 ENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGTLGELINVN-EKYKICAEV 557
            +  V   ++N T   S  N  + ++E    LK     V G + EL     +KYK+    
Sbjct: 491 RDTLVKLDDLNATQRES--NKERKLRENVAMLKRFFPGVRGLVHELCKPKRDKYKLAVST 548

Query: 558 VGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLDANIQYPPNDQTSFTPLI 617
           V G +   ++VD+   A   +  L K + G ++FIPL+ I   A  + P  +  ++T  I
Sbjct: 549 VLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTIDA-ATPRMPVPESETYTLAI 607

Query: 618 NKIKYDQRFDKAVRHIFGKTIVVK--DLTTGLRISKKFKLNSITLDGDRADKRGVLTGGY 675
           N ++Y     +A+ ++   TI+    D+   L+ +K   +  +TLDG   +K G++TGG 
Sbjct: 608 NTVEYKDDLVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGALINKTGLMTGGI 667

Query: 676 Y---------DQYKQSRLDSLSTL-----------NESTAKHRELSLELTSI-------- 707
                     D+Y QS LD    L            +ST   REL + L+S+        
Sbjct: 668 TSDSANRWDKDEY-QSLLDLKDKLIVDVEEAANKSRQSTLIARELEISLSSLTSEISYIR 726

Query: 708 ------KQAIQEVDSNIDTLNNSI-RKHNTNRESLLSNIEGMKSKLRNKKNDKILLEESL 760
                 K+A++E ++ I+  NN I R+     + L + I G++ ++R+    +  L+E  
Sbjct: 727 TQITQTKRAVEETETEINHHNNLIDREFIPQVKDLENKISGLEDEIRDWNTKREALQE-- 784

Query: 761 QALAIKTEK 769
           +  A  TEK
Sbjct: 785 KCFARLTEK 793

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 123/276 (44%), Gaps = 65/276 (23%)

Query: 946  RDELQQKIREIGLLAED------ALNAFNDLSSEELLKRLNSVSEDISGLKNVNKRAYEN 999
            + +L  +IR+I  + E+      A+  F+D  S     R + V ++  GLK   ++ ++ 
Sbjct: 996  KQDLNNQIRDIDDVLEELQPNARAVERFDDAKS-----RFDEVDKETEGLKTEERKVFDE 1050

Query: 1000 FRKFDEKQKELVERATE-LDESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLV 1058
            F K  +K+KEL E A E ++E   +I   +TR        V+ST              ++
Sbjct: 1051 FLKVKQKRKELFENAFEKINEHLDAIYSELTR-------NVNST-------------SIL 1090

Query: 1059 PIGKAKLIIHRVDNNARMETNSNXXXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQL 1118
              G A + I                           + +E    G+    +   K  + +
Sbjct: 1091 GGGSASMTIE--------------------------DEDEPFNAGIRYHATPPMKRFKDM 1124

Query: 1119 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD-KQYRTAVANIIKQLSVNAQ 1177
              E LSGG+KTV A+AL+ AI   +P+PF++ DE+DAALD    +   A I +  + + Q
Sbjct: 1125 --EYLSGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQ 1182

Query: 1178 FICTTFRTDMLQVADRF---FRVKYENKISTVIEVD 1210
            FI  + +  M + +D     FR + EN  S ++ +D
Sbjct: 1183 FIVISLKNTMFEKSDALVGVFRQQQENS-SKIVTLD 1217

>Kwal_56.23825
          Length = 1396

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 56/84 (66%), Gaps = 1/84 (1%)

Query: 1119 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQF 1178
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IK+ + NAQF
Sbjct: 1297 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1356

Query: 1179 ICTTFRTDMLQVADRFFRVKYENK 1202
            I  + R +M ++A +   V Y+NK
Sbjct: 1357 IVISLRNNMFELAKQLVGV-YKNK 1379

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 36/186 (19%), Positives = 76/186 (40%), Gaps = 13/186 (6%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
           + I R+V+  FK+Y    V+  F    + V+            ++ FV     + +++ +
Sbjct: 127 LCIDRLVLHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGK 186

Query: 61  RQGLIHQGS-GGSVMSASVEIVFHDPEHKMILPSGV--VPRENNDEICIRRTVGLKKDDY 117
              LIH+      + S  V+I F   + +   P G   + ++    +  R+        Y
Sbjct: 187 LSELIHKSELHPDLDSCHVDIFFQYVQDE---PDGTTSIIQQKPSMVIRRKAFRNNTSKY 243

Query: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDV 170
            LN +  +   + ++L   G  + +   ++ QG++ S+   K K         L+ LED+
Sbjct: 244 YLNGKESSYTIITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDI 303

Query: 171 VGAKSF 176
           +G   +
Sbjct: 304 IGTAQY 309

>KLLA0D07502g complement(642751..646482) similar to sp|P32908
           Saccharomyces cerevisiae YFL008w SMC1 chromosome
           segregation protein, start by similarity
          Length = 1243

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 194/846 (22%), Positives = 342/846 (40%), Gaps = 141/846 (16%)

Query: 8   IKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREERQGLIHQ 67
           +  FK+Y++   +     +   +I            AI FVL    + L+      LI++
Sbjct: 9   LHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLIYR 68

Query: 68  G-----------------SGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEIC-IRRT 109
           G                 S     +      + + E +    S V  +++ DE     RT
Sbjct: 69  GRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKFTRT 128

Query: 110 VGLKKDD-YQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLE 168
           +    D  Y++NDR V+       LES    +     +V QG +  + +   +    LLE
Sbjct: 129 INTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQGPESLTLLLE 188

Query: 169 DVVGAKSFE---VKLKA----SLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKY 221
            V G+ +++    KLK     +L +  +    R ++  ++      ++  EQ R  LE  
Sbjct: 189 QVSGSINYKNDYEKLKEEHKLALAEFTDAHNSRKKVQNDLKSFKEGVQRDEQYRTSLEIR 248

Query: 222 NALEKNRKVFQFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKN 281
           + L+ N     F L+  EL  I+ + ++L D   V+   +     +L   E I++ I   
Sbjct: 249 DQLKHN-----FILW--ELFHILKRRKKLVDSLTVSKTETTALKNKLSDEERILTKIKST 301

Query: 282 -------LSEIDSTL------KIKTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQ 328
                  LS++  TL      K    + L    S       ++ NL+ +I   K  ++ Q
Sbjct: 302 TAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIKRIHNLEKRISSFKKDMERQ 361

Query: 329 ERQANSDQKTLDIINDEIQKREQKLSSISPKFQE--LSKEELKFKLQYNXXXXXXXXXXX 386
           +      +  L +++   +  E++L +I     +  LS+E+LK   QY            
Sbjct: 362 QAYVKQFENQLKVVSKTKKSFEKELENIHANLNKFNLSEEDLK---QYELLKEKYLS--- 415

Query: 387 XXXXYARFASIEERNEWIQN-EIEESDKTLQGLVDIKNKILIER--DEINSKVRSLDEDI 443
                +  + IEE+   ++N E E ++++   L++ + K   ER  DE+   V +L+ D+
Sbjct: 416 -----SGGSHIEEKLAILKNDEFELNEES--ELINKRLKTTRERISDELQVDVDALEADL 468

Query: 444 DNLNDSIEGPNVTG-----ELEVIQDELEKLKS-EYAASIDKRKELWR----NEQKIETV 493
           + +   +   N        E + IQ  LE LK+ EY  +   R  L +    N  + ET 
Sbjct: 469 NEVTQRLNDKNSIAAAKSKEWKGIQTNLESLKNKEYELNFSLRDVLLKIDDLNADQRETK 528

Query: 494 LQ-NLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDSVFGTLGELINVN-EKY 551
            +  L ENV +L+R         L  G+K                 G + +L +   EKY
Sbjct: 529 KERKLRENVSMLKR---------LYPGVK-----------------GLVHDLCHPKKEKY 562

Query: 552 KICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLDANIQYPPNDQT 611
            I    + G +   I+VD+  TA   +  L K + G  +FIPL+ I  D N    P    
Sbjct: 563 AIAVSTILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTI--DVNPPSLPVSNV 620

Query: 612 SFTPL-INKIKYDQRFDKAVRHIFGKTIVVK--DLTTGLRISKKFKLNSITLDGDRADKR 668
               L IN I+Y+   +KA++++   +I+    DL   L+ S+  K   +TL+G    K 
Sbjct: 621 QGCLLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIHKA 680

Query: 669 GVLTGGYY---------DQY------KQSRLDSLSTLNE----STAKHRELSLELTSIKQ 709
           G +TGG           D+Y      K    + L+ L++       K REL  E++ +  
Sbjct: 681 GQMTGGTAQKNQNRWNKDEYQGLMVLKDQITEELTALSDKFRADNMKSRELENEISLLNN 740

Query: 710 AIQEVDSNIDTLNNSIR------KHNTN---------RESLLSNIEGMKSKLRNKKNDKI 754
            I  + + I  L  ++       KHN +          +S    IE +KSKL   +++K 
Sbjct: 741 EISSLRTQITQLERTLSGKNVEIKHNEDLITTEYEPQLKSFTQRIEELKSKLTKLESEKD 800

Query: 755 LLEESL 760
           +L+E +
Sbjct: 801 VLQEQI 806

 Score = 65.5 bits (158), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ-LSVNAQF 1178
            +E LSGG+KT+ A+AL+  I    P+PF++ DE+DAALD      +A+ IK+  + NAQF
Sbjct: 1143 MEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQF 1202

Query: 1179 ICTTFRTDMLQ 1189
            I  + +  M +
Sbjct: 1203 IVISLKNAMFE 1213

>YLR086W (SMC4) [3501] chr12 (302244..306500) Subunit of condensin
            protein complex required for proper chromosome
            condensation and segregation, coiled-coil protein of the
            SMC family [4257 bp, 1418 aa]
          Length = 1418

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 58/95 (61%), Gaps = 2/95 (2%)

Query: 1103 GVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR 1162
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1305 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1362

Query: 1163 TAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV 1197
            + VAN IK+ + NAQFI  + R +M ++A +   V
Sbjct: 1363 SIVANYIKERTKNAQFIVISLRNNMFELAQQLVGV 1397

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/252 (21%), Positives = 115/252 (45%), Gaps = 22/252 (8%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
           ++I  +V++ FK+Y  + V+  F    + V+            ++ FV     + ++++ 
Sbjct: 154 LFINELVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 213

Query: 61  RQGLIHQGSG-GSVMSASVEIVFHDPEHKMILPSGV--VPRENNDEICIRRTVGLKKDDY 117
              LIH+     S+ S SV + F   ++ +   SG   +  E    I  R+        Y
Sbjct: 214 LSDLIHKSEAFPSLQSCSVAVHF---QYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKY 270

Query: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLEDV 170
            +N++  +  +V ++L++ G  + +   ++ QG++ ++   K K         L+ LED+
Sbjct: 271 YINEKESSYTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDI 330

Query: 171 VGAKSFEVKLKASLKKME-------ETEQKRARIAKEMDELNSKLKEMEQERKELEKYNA 223
           +G  +++  ++  + ++E       E E +   + +E + L S  KE   E  E EK   
Sbjct: 331 IGTANYKPLIEERMGQIENLNEVCLEKENRFEIVDREKNSLESG-KETALEFLEKEKQLT 389

Query: 224 LEKNRKVFQFTL 235
           L ++ K+FQF L
Sbjct: 390 LLRS-KLFQFKL 400

>CAGL0L12188g 1308672..1312868 similar to tr|Q12267 Saccharomyces
            cerevisiae YLR086w Stable Maintenance of Chromosomes,
            start by similarity
          Length = 1398

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 1103 GVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR 1162
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1285 GVTFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1342

Query: 1163 TAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRV-KYEN 1201
            + VAN IK+ + NAQFI  + R +M ++  +   + K+EN
Sbjct: 1343 SIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHEN 1382

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 160/733 (21%), Positives = 313/733 (42%), Gaps = 121/733 (16%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
           ++I ++V+  FK+Y  + VI  F    + ++            ++ FV     + ++++ 
Sbjct: 128 LFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDR 187

Query: 61  RQGLIHQG-SGGSVMSASVEIVFHDPEHKMIL----PSGVVPRENNDEICIRRTVGLKKD 115
              LIH+  +   + S SVE+ F     K ++     S  +     + +  R+       
Sbjct: 188 LSDLIHKSETFPDLKSCSVEVHF-----KYVIDKDDGSTTIDETKGNLVVTRKAFKNNAS 242

Query: 116 DYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLLE 168
            Y +N +     +V  +L+  G  + +   ++ QG++ ++   K K         L+ LE
Sbjct: 243 KYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLE 302

Query: 169 DVVGAKSFEVKLKASLKKME-----------ETEQKRARIAKEMDELNS----------K 207
           D++G      K K S++K+            E E + + + +E + L S          K
Sbjct: 303 DIIGTS----KYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEALQFLNK 358

Query: 208 LKEMEQERKELEKYNALEKNRKVFQFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKE 267
            KE+  E+ +L +YN ++ N+K          L+D++N+        NV    ++Q   E
Sbjct: 359 EKELVLEKSKLYQYNLMQDNKK----------LDDVLNK------KTNVQQEQTKQE-DE 401

Query: 268 LDKREEIISNISKNLSEIDSTLKIKTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKA 327
             K    IS+I+ +L+ + + L+   T ++  +K++ +    ++ N Q+ + +L  + K 
Sbjct: 402 FRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQI-VNNLDSKRKE 460

Query: 328 QERQANSDQKTLDIINDEIQKREQKLSSISPKFQELSK---------EELKFKLQYNXXX 378
            E Q+   Q  ++  + EIQ   ++ SS++     LS          E +K KL+     
Sbjct: 461 FEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLR----- 515

Query: 379 XXXXXXXXXXXXYARFASIEERNEWIQNEIEESDKTLQGLVD----IKNKILIERDE--- 431
                               E+ E +  +I E +K L    +    +K +I I   E   
Sbjct: 516 --------------------EKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSI 555

Query: 432 INSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEYAASIDKRKELWRNEQKIE 491
           I    + L+ DI  L ++I       +LEV + E++ L  +    I +R+   R  +  +
Sbjct: 556 IEENRKGLENDIAGLENAILSQK--RDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQ 613

Query: 492 TVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLPEDS-----VFGTLGELIN 546
             L N+ E V+ L +   E   RS  +  ++  ++ + L   + S       G LG+L  
Sbjct: 614 ATLANVREKVEALRQKAIEI--RSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAV 671

Query: 547 VNEKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRI--YLDANIQ 604
           ++ KY +         L  +VVDT E+    ++ L K K G   FI L+++  +    I 
Sbjct: 672 IDPKYDVAISTACPR-LNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRID 730

Query: 605 YPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVKDLTTGLRIS---KKFKLNSITLD 661
            P   Q  F  +  K   ++RF+ A   +   T+V +++    R++   K++++  +TLD
Sbjct: 731 TPDQSQRLFDLITVK---EKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRV--VTLD 785

Query: 662 GDRADKRGVLTGG 674
           G+  D  G +TGG
Sbjct: 786 GNLIDLSGTMTGG 798

>Kwal_55.20421
          Length = 1170

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 134/285 (47%), Gaps = 38/285 (13%)

Query: 923  KKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLLAEDALNAFNDLSSEELLKRLNSV 982
            +KL+T    VE+ +   TAL+   D LQ +    GL++   +     ++ E   +R + +
Sbjct: 920  RKLKTNTSSVEEQI---TALLKDEDWLQDE----GLVS-SIVTQNQGINLEAYRQRADQL 971

Query: 983  SEDISGLK-NVNKRAYENFRKFDEKQKELVERATELDESKTSIQDLITRLRQQKVTAVDS 1041
            +E  S L+  VN          ++K+  L    + +++ K  IQ+ + +L + K   +  
Sbjct: 972  NEKFSALRRKVNPNIMSMIESVEKKESALKTMISTIEKDKRKIQETVAKLNEYKRETLIK 1031

Query: 1042 TFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARMETNSNXXXXXXXXXXXXINNNESIY 1101
            T+ KV  +F  +F  L+P   AKL+                               +S+ 
Sbjct: 1032 TWEKVTVDFGNIFGDLLPNSFAKLVPIE---------------------------GKSVT 1064

Query: 1102 TGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQY 1161
             G+ + +   S   E L   +LSGGQ+++ A++LILA+    PAP Y+ DE+DAALD  +
Sbjct: 1065 EGLEVKIRLGSIWKESLV--ELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSH 1122

Query: 1162 RTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYENKISTV 1206
               + ++IK     +QFI  + +  M   A+R FR ++++  S V
Sbjct: 1123 TQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTSVV 1167

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 77/158 (48%), Gaps = 20/158 (12%)

Query: 531 KLPEDSVFGTLGELINVNEK-------YKICAEVVGGNSLFHIVVDTEETATIIMKELYK 583
           K    SV G   +L ++NE+        +ICA    G  LF++VV+ E TA+ +++    
Sbjct: 517 KFDPTSVKGVAAQLFSLNEENFSSATALQICA----GGRLFNVVVNNESTASQLLERGRL 572

Query: 584 MKGGRVTFIPLNRIYLDANIQYPPNDQTSFTP-----LINKIKYDQRFDKAVRHIFGKTI 638
            K  RVT IPLN+I      Q   N      P      +N I Y+    KA+  IFG ++
Sbjct: 573 RK--RVTIIPLNKISARRLHQDTVNFAKQLAPDSVELALNLIGYEDEVAKAMEFIFGTSL 630

Query: 639 VVKDLTTGLRIS--KKFKLNSITLDGDRADKRGVLTGG 674
           + +D  T  +++   K +  SITL GD  D  G L+GG
Sbjct: 631 ICRDAETAKKVTFHPKVRARSITLQGDIYDPEGTLSGG 668

>KLLA0F19085g 1758111..1762229 similar to sgd|S0004081 Saccharomyces
            cerevisiae YLR086w SMC4 Stable Maintenance of
            Chromosomes, start by similarity
          Length = 1372

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 53/82 (64%), Gaps = 1/82 (1%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQFI 1179
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN IK+ + NAQFI
Sbjct: 1274 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1333

Query: 1180 CTTFRTDMLQVADRFFRVKYEN 1201
              + R +M ++A     + Y+N
Sbjct: 1334 VISLRNNMFELAQNLVGI-YKN 1354

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 46/201 (22%), Positives = 86/201 (42%), Gaps = 19/201 (9%)

Query: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREE 60
           + I ++V+  FK+Y     I  F    + V+            ++ FV     + +++ +
Sbjct: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182

Query: 61  RQGLIHQGSG-GSVMSASVEIVFH-----DPEHKMILPSGVVPRENNDEICIRRTVGLKK 114
              LIH+     S+ S SV+I FH     D     ILPS          +  RR      
Sbjct: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSA------GTMVVERRAFKNNS 236

Query: 115 DDYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLL 167
             Y +N +     +V R+L+  G  + +   ++ QG++ S+   K K         L+ L
Sbjct: 237 SKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYL 296

Query: 168 EDVVGAKSFEVKLKASLKKME 188
           ED++G   F+ +++  L+++E
Sbjct: 297 EDIIGTAKFKPQIEKCLEEIE 317

>Scas_707.23
          Length = 1223

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 168/817 (20%), Positives = 351/817 (42%), Gaps = 103/817 (12%)

Query: 8   IKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREERQGLIHQ 67
           +  FK+YR  T I     +   +I            AI FVL    S+L+    + LI++
Sbjct: 9   LSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLIYR 68

Query: 68  GSGGSVMSASVEIVFHDPE-----HKMILPSGVVPRENNDEICIRRTVGLKKDD-YQLND 121
           G    V+    E    DPE     H            +   + + RT+ +  D  Y++++
Sbjct: 69  G----VIRDFSE---EDPEDGEEQHPTSAYVKAFYEMDGKVVELMRTININGDTTYKIDN 121

Query: 122 RNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVGAKSFEVK-- 179
           + V+       LE     +     +V QG +  + +    +  +L E++ G+  ++ +  
Sbjct: 122 KTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSALDLSKLFEEISGSIQYKKEYD 181

Query: 180 -LKASLKKM----EETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFT 234
            LK  L+K+     E+ + R RI  E+      + + E+ +  +EK     K +    FT
Sbjct: 182 SLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISKDEEYKNNVEK-----KKKYEMYFT 236

Query: 235 LYDRELNDIINQVERLDDDYNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTT 294
           L+         ++  LD       +  +Q   E+ K +E I+N  K+L+   S   +K  
Sbjct: 237 LW---------KLFHLDAQRIQFKDKLKQAKTEMSKLKEKINNEEKHLTRSKSAF-LKEN 286

Query: 295 TDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTLDIINDEIQKREQKLS 354
           + L + +S+      +   +  Q   +K+ ++A  ++  + +K ++    +I++++  +S
Sbjct: 287 SILTKKRSQLDYTVKEKEKVISQCNSIKIPLRASSKRIMNIEKRIESFKRDIERQKDYVS 346

Query: 355 SISPKFQELSKEELKFKLQYNXXXXXXXXXXXXXXXYARFASIEERNEWIQNEIEESDKT 414
           +   + + ++K +  F+++                 + +F   +   +W +   E+   T
Sbjct: 347 TFENQLKVVTKAKELFEVE----------IKKSARNHDKFRLTDTDLKWYEQLNEKYLST 396

Query: 415 LQGLVDIKNKILI-ERDEINSKVRSLDEDIDNLNDSIEGPNVTGELEVIQDELEKLKSEY 473
              L++ K  +L  ++ E   ++  L+  ID     +    VT EL +  + L+   ++ 
Sbjct: 397 GGSLLEQKISLLNNDKQEKTDEMELLNRHID-----VSKNRVTEELNITGENLQNQVTDM 451

Query: 474 AASIDKRKELWRNEQKIETVLQNLLENVKVLERNVNETMDRSL-------ANGIKSVKEI 526
            ++++++   +  + K     Q  +E+    E ++N  +  +L       AN  +S+KE 
Sbjct: 452 TSTLNEKNATYAEQMKKLKDYQMQVESSNNQEYDLNYKLRETLVKLDDLSANQRESLKEK 511

Query: 527 -----ATKLKLPEDSVFGTLGELINVN-EKYKICAEVVGGNSLFHIVVDTEETATIIMKE 580
                 T LK     V G + +L     EKY +   V+ G +   I+V+    A   +  
Sbjct: 512 KLRENVTMLKRFFPGVKGLVHDLCRPKKEKYGLAVSVMLGKNFDSIIVENLSVARECISF 571

Query: 581 LYKMKGGRVTFIPLNRIYLD-ANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIFGKTIV 639
           L K + G  +FIPL+ I  +   +  PP+ +   T  IN I+YD  +++A++++ G +I+
Sbjct: 572 LKKQRAGTASFIPLDTIDSEQPTLSAPPSQEYILT--INAIEYDLAYERAMQYVCGDSII 629

Query: 640 VK--DLTTGLRISKKFKLNSITLDGDRADKRGVLTGGYY----DQYKQSRLDSLSTLN-- 691
               D+   L+ ++  +   ++LDG    K G++TGG      +++ +    SL TL   
Sbjct: 630 CDTLDIARDLKWNRGVRSKLVSLDGSLIHKAGLMTGGISKDSKNRWDKEEYQSLMTLKDK 689

Query: 692 -------------ESTAKHRE-------LSLELTSIKQAIQEVDSNIDTLNNSIRKHN-- 729
                        ++ AK RE       L+ EL+S++  + +V  +++   N I  HN  
Sbjct: 690 LLIQIEEVSTVGRDAAAKARELESSLSLLNAELSSLRTQLVQVKRSVEENANEINYHNKL 749

Query: 730 ------TNRESLLSNIEGMKSKLRNKKNDKILLEESL 760
                    ESL   I+ +++ + +   +K+ L+E++
Sbjct: 750 LTEQYTPKLESLQEEIQAIENSISSITAEKVSLQETI 786

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 118/252 (46%), Gaps = 45/252 (17%)

Query: 973  EELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQK--ELVERATELDESKTSIQDLITR 1030
            EEL   + S+ ED   +   N RA E   +FD+ Q+  E+VE+ TE         DL  +
Sbjct: 997  EELENHIRSI-EDTLNVLQPNARAVE---RFDDAQERFEVVEKETE---------DL--K 1041

Query: 1031 LRQQKVTAVDSTFLKVA----ENFETVF----EKLVPIGKAKLIIHRVDNNARMETNSNX 1082
             R++K     + FLK+     E FE  F    E L PI +    + R  N++ + +  N 
Sbjct: 1042 AREKKAL---TQFLKIKKRRRELFENAFDFVNEHLDPIYRE---LTRNPNSSALLSGGNA 1095

Query: 1083 XXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMV 1142
                        + +E    G+        K  + +  E LSGG+KTV A+AL+ AI   
Sbjct: 1096 SLTLE-------DEDEPFNAGIKYHAMPPLKRFKDM--EYLSGGEKTVAALALLFAINAY 1146

Query: 1143 DPAPFYLFDEIDAALDKQYRTAVANIIKQLS-VNAQFICTTFRTDMLQVADRF---FRVK 1198
             P+PF++ DE+DAALD      +A  I++    + QFI  + +  M + +D     +R +
Sbjct: 1147 QPSPFFVLDEVDAALDITNVERIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQ 1206

Query: 1199 YENKISTVIEVD 1210
             EN  S ++ +D
Sbjct: 1207 QENS-SKIVTLD 1217

>YFL008W (SMC1) [1674] chr6 (119424..123101) Coiled-coil protein of
            the SMC family involved in chromosome condensation and
            segregation [3678 bp, 1225 aa]
          Length = 1225

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 92/377 (24%), Positives = 174/377 (46%), Gaps = 66/377 (17%)

Query: 869  VDSMTSKLEAVQNQCNSALQHVDTIQKEIEDLKSEKRNNDKILEKANSQQRLLLKKLETF 928
            + S+ SKLE  +N       H+D +QK+    +SE  +++ ILE  NS  ++L ++ +  
Sbjct: 874  IGSIESKLEEHKN-------HLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERDGI 926

Query: 929  QKDVEKTMIKK-TAL-------ITRRDELQQKIREIGLLAED--ALNAFN---------- 968
            ++D+EK  +++ TAL       I      +  I ++ + + D  A+   N          
Sbjct: 927  KEDIEKFDLERVTALKNCKISNINIPISSETTIDDLPISSTDNEAITISNSIDINYKGLP 986

Query: 969  --------DLSSEELLKRLNSVSEDISGLKNVNKRAYENFRKFDEKQK--ELVERATE-L 1017
                    D + +EL ++++ V E ++ L+  N RA E   ++DE +   E++   TE L
Sbjct: 987  KKYKENNTDSARKELEQKIHEVEEILNELQ-PNARALE---RYDEAEGRFEVINNETEQL 1042

Query: 1018 DESKTSIQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLVPIGKAKLIIHRVDNNARME 1077
               +  I +   ++++++    + TF  V+++ + ++ +L                    
Sbjct: 1043 KAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTK-----------------N 1085

Query: 1078 TNSNXXXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALIL 1137
             NSN             + +E    G+    +   K  + +  E LSGG+KTV A+AL+ 
Sbjct: 1086 PNSNVELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDM--EYLSGGEKTVAALALLF 1143

Query: 1138 AIQMVDPAPFYLFDEIDAALD-KQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRF-- 1194
            AI    P+PF++ DE+DAALD    +   A I +  + + QFI  + +  M + +D    
Sbjct: 1144 AINSYQPSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVG 1203

Query: 1195 -FRVKYENKISTVIEVD 1210
             +R + EN  S +I +D
Sbjct: 1204 VYRQQQENS-SKIITLD 1219

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 143/702 (20%), Positives = 291/702 (41%), Gaps = 77/702 (10%)

Query: 8   IKGFKTYRNQTVIDDFSPHHNIVIXXXXXXXXXXXXAIRFVLSDDYSNLKREERQGLIHQ 67
           +  FK+YR  T +     +   +I            AI FVL    ++L+    + LI++
Sbjct: 9   LSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLIYR 68

Query: 68  G---------------SGGSVMSASVEIVFHDPEHKMILPSGVVPRENNDEICIRRTVGL 112
           G               +  +  SA V+  F+   +K++    ++ R N D          
Sbjct: 69  GVLNDENSDDYDNEGAASSNPQSAYVK-AFYQKGNKLVELMRIISR-NGD---------- 116

Query: 113 KKDDYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKERLQLLEDVVG 172
               Y+++ + V+  D    LE+    +     +V QG +  +      E  ++ E+V G
Sbjct: 117 --TSYKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPVELSRMFEEVSG 174

Query: 173 A-------KSFEVKLKASLKKMEETEQKRARIAKEMDELNSKLKEMEQERKELEKYNALE 225
           +       +  + K++   K   E+ + R RI  E+      + + E+ RK+L+K N L+
Sbjct: 175 SIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDKKNELQ 234

Query: 226 KNRKVFQFTLYDRELNDIINQVERLDDDYNVTANSSEQYIKELDKREEII----SNISKN 281
           K + ++Q    +++  ++ +++  L+ + +         +K L + +       + ISK 
Sbjct: 235 KFQALWQLYHLEQQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKESAVISKQ 294

Query: 282 LSEIDSTLKI--KTTTDLPQAKSRHSELTNQLTNLQVQIKDLKLQIKAQERQANSDQKTL 339
            S++D   K   K  +DL   K        ++++++ +I+ L+  ++ Q+      +  L
Sbjct: 295 KSKLDYIFKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQKDLQRQKTYVERFETQL 354

Query: 340 DIINDEIQKREQKLSSISPKFQELSKEELKFKLQYNXXXXXXXXXXXXXXXYARFASIEE 399
            ++    +  E+++   +  +        KFKL  N                     +EE
Sbjct: 355 KVVTRSKEAFEEEIKQSARNYD-------KFKLNENDLKTYNCLHEKYLTEGGSI--LEE 405

Query: 400 RNEWIQN---EIEESDKTLQGLVDIKNKILIERDEINSKVRSLDEDIDNLNDSIEGPNVT 456
           +   + N   EI+E  +      DI  + + E  E++     LD  +++L  S+   N  
Sbjct: 406 KIAVLNNDKREIQEELERFNKRADISKRRITE--ELSITGEKLDTQLNDLRVSLNEKNAL 463

Query: 457 GELEVIQDELEKLKSEYAASIDKRKELWRNEQKIETVLQNLLENVKVLERNVNETM-DRS 515
               +   EL+KL+S+  ++ ++       E  +   L+  L  +  L  N  ETM +R 
Sbjct: 464 HTERL--HELKKLQSDIESANNQ-------EYDLNFKLRETLVKIDDLSANQRETMKERK 514

Query: 516 LANGIKSVKEIATKLKLPEDSVFGTLGELINV-NEKYKICAEVVGGNSLFHIVVDTEETA 574
           L   I  +K     +K       G + +L +   EKY +    + G +   ++V+    A
Sbjct: 515 LRENIAMLKRFFPGVK-------GLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVA 567

Query: 575 TIIMKELYKMKGGRVTFIPLNRIYLDANIQYPPNDQTSFTPLINKIKYDQRFDKAVRHIF 634
              +  L K + G  +FIPL+ I  +      P+ Q  +   IN I Y+  ++KA++++ 
Sbjct: 568 QECIAFLKKQRAGTASFIPLDTIETELPTLSLPDSQ-DYILSINAIDYEPEYEKAMQYVC 626

Query: 635 GKTIVVKDLTTG--LRISKKFKLNSITLDGDRADKRGVLTGG 674
           G +I+   L     L+  K  +   +T++G    K G++TGG
Sbjct: 627 GDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIHKAGLMTGG 668

>AGL023W [4288] [Homologous to ScYFL008W (SMC1) - SH]
            complement(670883..674551) [3669 bp, 1222 aa]
          Length = 1222

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 55/95 (57%), Gaps = 5/95 (5%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD-KQYRTAVANIIKQLSVNAQF 1178
            ++ LSGG+KT+ A+AL+ AI    P+PF++ DE+DAALD        A I +  S   QF
Sbjct: 1121 MDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIRRHASPKMQF 1180

Query: 1179 ICTTFRTDMLQVADRF---FRVKYENKISTVIEVD 1210
            I  + ++++   ++     FR ++EN  S VI  D
Sbjct: 1181 IVISLKSNLFSKSESMAGVFRNQHENS-SMVITTD 1214

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 64/128 (50%), Gaps = 3/128 (2%)

Query: 549 EKYKICAEVVGGNSLFHIVVDTEETATIIMKELYKMKGGRVTFIPLNRIYLDANIQYPPN 608
           EKY +    + G +   ++VD+   A   +  L K + G  +FIPL+ I   +    P  
Sbjct: 538 EKYAVGVSTILGKNFDSVIVDSLSVAQQCISYLKKHRSGVASFIPLDTIDTSSPT-LPAG 596

Query: 609 DQTSFTPLINKIKYDQRFDKAVRHIFGKTIVVK--DLTTGLRISKKFKLNSITLDGDRAD 666
           D T     ++ I+Y+   +KA++++   +I+    D+   L+ ++  K   +TL+G    
Sbjct: 597 DNTGCILTLDAIEYESSLEKAMQYVCSDSIICDSLDIARNLKWNRNVKSKLVTLEGALIH 656

Query: 667 KRGVLTGG 674
           + G++TGG
Sbjct: 657 RAGLMTGG 664

>Kwal_23.5043
          Length = 1225

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 80/349 (22%), Positives = 155/349 (44%), Gaps = 58/349 (16%)

Query: 867  RDVDSMTSKLEAVQNQCNSALQHVDTIQKEIE----DLKSEKRNNDKILE--KANSQQRL 920
            R +D    +L+++Q++ +  L  ++ + ++I+    DL + KR N+ + E  + N+ +RL
Sbjct: 880  RIIDEEQKQLDSLQDEASQNLAGLNALDEQIQEINDDLSASKRKNEALSEDLETNTLERL 939

Query: 921  LLKKLETFQKDVEKTMIKKTALITRRDELQQKIREIGLLAEDALNAFNDLS--SEELLKR 978
                     K+ +   IK     +  DEL      +  + E  LNA ND+S     L K+
Sbjct: 940  ------NVLKNCKMQNIKLPEGSSSLDELP-----LDKVDEFTLNAANDVSINYAGLSKK 988

Query: 979  LNSVSED--ISGLK-------------NVNKRAYENFRKFDEKQKELVERATELDESKTS 1023
            L    E+   +GLK               N +A   +     + + + +   +    +  
Sbjct: 989  LRQSGEEETGAGLKKSIDELNELLTILQPNSKAAGRYEDAKLRYESIYKETEKCKAKEKK 1048

Query: 1024 IQDLITRLRQQKVTAVDSTFLKVAENFETVFEKLV--PIGKAKLIIHRVDNNARMETNSN 1081
            + +  TR+++ +  A +  F  V+ + + ++ +L   P  +A+L       NA +     
Sbjct: 1049 VNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAEL----AGGNASLTLE-- 1102

Query: 1082 XXXXXXXXXXXXINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQM 1141
                         + +E    G+    +  +K  + +  E LSGG+KT+ A+AL+ AI  
Sbjct: 1103 -------------DEDEPYLAGIRYHATPPAKRFKDM--EYLSGGEKTIAALALLFAINS 1147

Query: 1142 VDPAPFYLFDEIDAALDKQYRTAVANII-KQLSVNAQFICTTFRTDMLQ 1189
              P+PF++ DE+DAALD      VA+ I ++   + QFI  + +  M +
Sbjct: 1148 FQPSPFFVLDEVDAALDISNVERVASYIRRKAGADLQFIVISLKNTMFE 1196

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/160 (22%), Positives = 75/160 (46%), Gaps = 10/160 (6%)

Query: 521 KSVKEIATKLKLPEDSVFGTLGELINVN-EKYKICAEVVGGNSLFHIVVDTEETATIIMK 579
           K ++E  + L+     V G + +L +   EK+ +    V G +   ++VD    A   + 
Sbjct: 514 KKLRENVSMLRRLFPGVRGLVHDLCHPKKEKFAVAVSTVLGKNFDAVIVDNFLVAQQCVS 573

Query: 580 ELYKMKGGRVTFIPLNRIYLDANIQYPPNDQTSFTPL---INKIKYDQRFDKAVRHIFGK 636
            L K + G V+FIPL+ +    ++   P   + F      I+ I Y+   ++A++++   
Sbjct: 574 FLKKQRSGVVSFIPLDTV----DVSKVPMIASEFKGCILAIDAIDYEPDLERAMQYVCSD 629

Query: 637 TIVVKDLTTGLRISKKFKLNS--ITLDGDRADKRGVLTGG 674
           +I+   L     +  K  + S  ++++G    + G++TGG
Sbjct: 630 SIICDTLQIAKDLKWKHNIRSKLVSINGSIVHRAGLMTGG 669

>CAGL0G02497g 223375..228717 similar to sp|Q02455 Saccharomyces
            cerevisiae YKR095w MLP1, hypothetical start
          Length = 1780

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 60/107 (56%), Gaps = 4/107 (3%)

Query: 864  SLRRDVDSMTSKLEAVQNQCNSALQHVDTIQKEIEDLKSEKRNNDKILEKANSQQRLLLK 923
            SLRR+ D + +K+  ++ + NS  Q +D IQ E+E+ K     +  +LE   S+   L+ 
Sbjct: 1168 SLRRERDILDTKINVIETEKNSLQQKLDDIQNELENTKR----SAALLESEYSEHSDLIN 1223

Query: 924  KLETFQKDVEKTMIKKTALITRRDELQQKIREIGLLAEDALNAFNDL 970
              +T + D+E+  + + + +T R+EL+Q + E   +A+D     N+L
Sbjct: 1224 NYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNEL 1270

>AEL337C [2168] [Homologous to ScYOL034W - SH] (14613..17906) [3294
            bp, 1097 aa]
          Length = 1097

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%)

Query: 1124 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAV 1165
            SGG++ V  +  ++A+Q    APF + DEI+  +D +Y   V
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIV 1033

>KLLA0F07997g complement(748561..751920) similar to sgd|S0005394
            Saccharomyces cerevisiae YOL034w, start by similarity
          Length = 1119

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 1104 VSISVSF-NSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR 1162
            + I V F ++ E +QL+    SGG++ V  +  ++A+Q    +PF + DEI+  +D+   
Sbjct: 993  IEIKVKFRDNSELQQLNPHVQSGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNE 1052

Query: 1163 TAVANII 1169
              V  I+
Sbjct: 1053 RIVHRIM 1059

>KLLA0E05247g complement(472583..475879) similar to sp|Q12749
            Saccharomyces cerevisiae YLR383w RHC18 recombination
            repair protein, start by similarity
          Length = 1098

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (45%), Gaps = 18/114 (15%)

Query: 1102 TGVSISVSFN-----------SKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLF 1150
            +G S S+SF            + ++   +V+ LSGG+K+   IAL+LA  +   +     
Sbjct: 970  SGYSGSLSFTDSGQLNVMVKTTNDHHARNVDTLSGGEKSFSQIALLLATWLTMRSRIIAL 1029

Query: 1151 DEIDAALDKQYRTAVANII-----KQLSVNAQFICTTFR--TDMLQVADRFFRV 1197
            DE D  +D+  R    N+I     K +  + Q I  T +    M  + D++F +
Sbjct: 1030 DEFDVFMDQVNRKIGTNLIIRRLGKDVKSDTQTIIITPQDIGKMANIDDKYFNI 1083

>Scas_636.14
          Length = 608

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ-------- 1171
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +I++        
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520

Query: 1172 -LSVNAQFICTTFRTD 1186
               V   FI  T+  D
Sbjct: 521  AFVVEHDFIMATYLAD 536

>CAGL0F01155g complement(116762..120079) similar to tr|Q08204
            Saccharomyces cerevisiae YOL034w, hypothetical start
          Length = 1105

 Score = 37.4 bits (85), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 1124 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ 1171
            SGG++ V  +  ++A+Q    APF + DEI+  +D  +   V   + Q
Sbjct: 1000 SGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNFERLVHKAMVQ 1047

>YDR091C (YDR091C) [943] chr4 complement(626702..628528) Putative
            ortholog of human Rnase L inhibitor (RLI) of the
            interferon-regulated 2-5A pathway, putative ortholog of
            C. elegans Y39E4B.1, member of the non-transporter group
            in the ATP-binding cassette (ABC) superfamily [1827 bp,
            608 aa]
          Length = 608

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ-------- 1171
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +I++        
Sbjct: 465  VQHLSGGELQRVAIVLALGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520

Query: 1172 -LSVNAQFICTTFRTD 1186
               V   FI  T+  D
Sbjct: 521  AFIVEHDFIMATYLAD 536

>CAGL0G08041g complement(758811..760634) highly similar to tr|Q03195
            Saccharomyces cerevisiae YDR091c, start by similarity
          Length = 607

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ-------- 1171
            V+ LSGG+    AI L L I    PA  YL DE  A LD + R   + +I++        
Sbjct: 464  VKHLSGGELQRVAIVLSLGI----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1172 -LSVNAQFICTTFRTDMLQVAD 1192
               V   FI  T+  D + V D
Sbjct: 520  AFIVEHDFIMATYLADKVIVFD 541

>Scas_643.11
          Length = 1095

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 1124 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158
            SGG++ V  +  ++A+Q    APF + DEI+  +D
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMD 1024

>Kwal_26.7204
          Length = 1117

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 1124 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158
            SGG++ V  +  ++A+Q    APF + DEI+  +D
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMD 1046

>Kwal_56.23429
          Length = 539

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLS------ 1173
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   + +I++        
Sbjct: 465  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 520

Query: 1174 ---VNAQFICTTFRTD 1186
               V   FI  T+  D
Sbjct: 521  AFLVEHDFIMATYLAD 536

>AGR125W [4436] [Homologous to ScYDR091C (RLI1) - SH]
            complement(987083..988906) [1824 bp, 607 aa]
          Length = 607

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQL 1172
            V+ LSGG+    AI L L +    PA  YL DE  A LD + R   + +I++ 
Sbjct: 464  VQHLSGGELQRVAIVLALGL----PADIYLIDEPSAYLDSEQRIICSKVIRRF 512

>YOL034W (SMC5) [4782] chr15 (259923..263204) Protein containing an
            SMC domain N-terminal domain, which bind ATP in
            chromosome-associated proteins, has low similarity to S.
            pombe Spr18p, which is likely to be involved in the
            maintenance of chromosome structure [3282 bp, 1093 aa]
          Length = 1093

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 1124 SGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158
            SGG++ V  +  ++A+Q    APF + DEI+  +D
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMD 1021

>CAGL0G08756g complement(829778..833842) highly similar to sp|P32597
           Saccharomyces cerevisiae YIL126w STH1 subunit of the RSC
           complex, hypothetical start
          Length = 1354

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%)

Query: 195 ARIAKEMDELNSKLKEMEQERKELEKYNALEKNRKVFQFTLYDREL 240
           A+I +E DE N++LKE++  R  L KY++ +  ++V    L +R+L
Sbjct: 69  AQITQEQDEFNARLKELQDLRDSLSKYDSEKLRKQVLALQLLERDL 114

>Kwal_33.15024
          Length = 369

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 72/140 (51%), Gaps = 16/140 (11%)

Query: 868 DVDSMTSKLEAVQNQCNSALQHVDTI-------QKEIEDLKSEKRNNDKILEKANSQQRL 920
           D++ + +K + +Q + +   QHV++I       QK +EDLKS   ++ K+ E+  +Q +L
Sbjct: 222 DIEYIYAKRKFIQERYSQESQHVESIEHQLVREQKALEDLKS---SHAKLAERVTNQTKL 278

Query: 921 LLKKL-ETFQKDVEKTMIKKTALITRRDELQQKI-REIGLLAEDALNAFNDLSSEELLKR 978
           L ++L +     + K M+    L+   D  ++   R++  L    +N  +D S   + K 
Sbjct: 279 LTEQLSKNLHPALSKAMVNSFGLLKDNDANKECFNRDVDDLNLQLVNPVDDCSDPSIQKY 338

Query: 979 LNSVS---EDISGLKN-VNK 994
           L S+    + + GL++ VNK
Sbjct: 339 LPSLQKYEQSVQGLRDEVNK 358

>CAGL0L01221g 137742..140726 similar to sp|P32618 Saccharomyces
           cerevisiae YEL043w, hypothetical start
          Length = 994

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 54/90 (60%), Gaps = 9/90 (10%)

Query: 144 YNIVPQGKIISLTNAKDKERLQL-LEDVVGAKSFEV----KLKASLKKMEE----TEQKR 194
           ++++ Q K IS    + + +LQ+ L+++  + S E+     LK+S+K +E     T+ K 
Sbjct: 247 HDVLAQEKSISEDFQESQVQLQMELDNLKTSWSHEMNLRKSLKSSIKSLENSKLLTDTKS 306

Query: 195 ARIAKEMDELNSKLKEMEQERKELEKYNAL 224
            ++ K+++EL  K+  ME++ KE EK N+L
Sbjct: 307 EKVKKKINELRFKISRMEKDMKEWEKENSL 336

>KLLA0B14256g 1248654..1252469 similar to sp|P12866 Saccharomyces
            cerevisiae YKL209c STE6 ATP-binding cassette transporter
            protein, hypothetical start
          Length = 1271

 Score = 34.7 bits (78), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 1115 NEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSV 1174
            N ++H   +SGGQ    +IA  L  Q        + DE  +ALD     A+A +I+ +  
Sbjct: 1163 NTRVHDGLMSGGQAQRLSIARTLLRQ----PKIIILDECTSALDAANSFAIAELIRTVLK 1218

Query: 1175 NAQFICTTFRTDMLQVADRFFRVK 1198
            N   I  T    ++Q+ DR   +K
Sbjct: 1219 NVTVIVITHSEQLMQICDRVLVLK 1242

>AER044W [2549] [Homologous to ScYLR383W (RHC18) - SH]
            complement(714355..717666) [3312 bp, 1103 aa]
          Length = 1103

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRT-AVANIIKQLSVN--A 1176
            V+ LSGG+K+   I L+L+      A     DE D  +D+  RT     I+K+ S N   
Sbjct: 1004 VDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMIMKKFSTNIRT 1063

Query: 1177 QFICTTFRTDMLQVAD 1192
            Q I  T + D+ ++AD
Sbjct: 1064 QTIIITPQ-DIGKIAD 1078

>Scas_698.3
          Length = 1314

 Score = 33.9 bits (76), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (58%), Gaps = 4/78 (5%)

Query: 707  IKQAIQEVDSNIDTLNNSIRKHNTNRESLLSNIEGMKSK---LRNKKNDKILLEESLQAL 763
            I +A    DS++D+  ++I   NT  +SLL+ + G+  K   LR +K+ K++  +S ++L
Sbjct: 1223 IMEASTRKDSDVDSGTDNIDGENTAVDSLLAQLRGVDKKPEPLRTRKSVKVVTIKSGESL 1282

Query: 764  AIKTEKNEINIRVTADKK 781
             +  E+ E N  VT D+K
Sbjct: 1283 PVPDEEKE-NKTVTGDEK 1299

>KLLA0C01991g 160778..162898 similar to sp|P33310 Saccharomyces
            cerevisiae YLR188w MDL1 ATP-binding cassette transporter
            family member, hypothetical start
          Length = 706

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 43/95 (45%), Gaps = 5/95 (5%)

Query: 1122 QLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSVNAQ-FIC 1180
            QLSGGQK   A+A      ++DP+   + DE  +ALD Q    VA  ++Q S   +  I 
Sbjct: 569  QLSGGQKQRIALARAF---LLDPS-ILILDEATSALDSQSEEVVAQSLQQRSARGKTTIS 624

Query: 1181 TTFRTDMLQVADRFFRVKYENKISTVIEVDKQDAI 1215
               R   +Q + R   +     ++     DK  AI
Sbjct: 625  IAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAI 659

>KLLA0C17556g complement(1544404..1546227) highly similar to
            sgd|S0002498 Saccharomyces cerevisiae YDR091c RLI1, start
            by similarity
          Length = 607

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 36/82 (43%), Gaps = 13/82 (15%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ-------- 1171
            V+ LSGG+    AI L L +     A  YL DE  A LD + R   + +I++        
Sbjct: 464  VQHLSGGELQRVAIVLSLGMN----ADIYLIDEPSAYLDSEQRIICSKVIRRFILHNKKT 519

Query: 1172 -LSVNAQFICTTFRTDMLQVAD 1192
               V   FI  T+  D + V D
Sbjct: 520  AFIVEHDFIMATYLADKVIVFD 541

>KLLA0B11121g 976252..976965 weakly similar to sp|P53271
           Saccharomyces cerevisiae YGR120c SEC35 required for ER
           to golgi vesicle docking singleton, start by similarity
          Length = 237

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 78/164 (47%), Gaps = 19/164 (11%)

Query: 417 GLVDIKNKILIERDEINSKVRSLDE---DIDNLNDSIEGPNVTGELEVIQDELEKLKSEY 473
           G +DI +K+L+E    N +  SLDE   ++  L  S+E        + I DE+     EY
Sbjct: 29  GCLDI-DKLLLEN---NFQYVSLDELSYEVSALKQSME--------QTILDEINDNYPEY 76

Query: 474 AASIDKRKELWRNEQKIETVLQNLLENVKVLERNVNETMDRSLANGIKSVKEIATKLKLP 533
               D+      NE  +   L+ +L +++   + + +  D S+A   +      + LK  
Sbjct: 77  MEICDRFNTSDNNE--VLNKLKQVLNDLQQFNKQLLQLCDSSVAETREKTVTALSYLK-S 133

Query: 534 EDSVFGTLGELINVNEKYKICAEVVGG-NSLFHIVVDTEETATI 576
            D++FG L ++  ++E  KIC ++V    S+  + +D E + T+
Sbjct: 134 LDNLFGKLDDITKLSESLKICQQLVSSLQSMVQLNIDDELSFTV 177

>AGL335W [3977] [Homologous to ScYMR301C (ATM1) - SH]
            complement(82640..84715) [2076 bp, 691 aa]
          Length = 691

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 1123 LSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ 1171
            +SGG+K   AIA +L    +  AP   FDE  +ALD     A+ + I+Q
Sbjct: 572  ISGGEKQRLAIARVL----LKDAPLMFFDEATSALDTHTEQALLHTIQQ 616

>Scas_538.2
          Length = 521

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 3/74 (4%)

Query: 219 EKYNALEKNRKVFQFTLYDRELN-DIINQVERLDDDYNVTANSSEQYIKELDKREEIISN 277
           E YN   K + +F +T+    LN D +   ER++DD  + +      I +LD+ E  +S 
Sbjct: 372 ELYNV--KEQILFDWTMLTETLNGDFVLWNERINDDLEIISKRVSSTIDKLDELESSLSQ 429

Query: 278 ISKNLSEIDSTLKI 291
            S+  S++ +TL I
Sbjct: 430 FSRTFSKLLNTLNI 443

>AEL085W [2421] [Homologous to ScYDL030W (PRP9) - SH]
            complement(467583..469166) [1584 bp, 527 aa]
          Length = 527

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 976  LKRLNSV-SEDISGLKNVNKRAYENFRKFDEKQKELVERATELDESKTSIQDLITRLRQQ 1034
            +KRLN+  S+DI  L++ N     NF  F+   KEL ER  E  +S+++I  L  + R+ 
Sbjct: 93   VKRLNAFKSDDIESLRDPNM----NFETFEADIKELQERQAEGADSESAISSLERKRREY 148

Query: 1035 KVTAVDS 1041
             + +  S
Sbjct: 149  SMFSASS 155

>Scas_719.6
          Length = 1096

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1119 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYR----TAVANIIKQLSV 1174
            +V+ LSGG+K+   +AL+LA      +     DE D  +D+  R    T V   +K L+ 
Sbjct: 993  NVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLAR 1052

Query: 1175 NAQFICTTFRTDMLQVAD 1192
                I T    D+ ++AD
Sbjct: 1053 TQTIIITP--QDIGKIAD 1068

>CAGL0G02937g complement(268985..270679) highly similar to sp|P06169
           Saccharomyces cerevisiae YLR044c PDC1 or sp|P16467
           Saccharomyces cerevisiae YLR134w PDC5 or sp|P26263
           Saccharomyces cerevisiae YGR087c PDC6, start by
           similarity
          Length = 564

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 5/75 (6%)

Query: 86  EHKMILPSGVVPRENNDEICIRRTVGLKKDDYQLNDRNVTKGDVVRMLESTGFSMSNPYN 145
           +H +ILP+       N  +    T G   D   +ND+   K D +RM+E    +M  P N
Sbjct: 495 DHSLILPAFGAKNYENKRVA---TYGEWND--MVNDKQFNKNDKLRMIEVMLPTMDGPEN 549

Query: 146 IVPQGKIISLTNAKD 160
           +  Q K+ +  NAK+
Sbjct: 550 LKKQAKLTASINAKN 564

>AAL064W [123] [Homologous to ScYDR299W (BFR2) - SH]
           complement(234786..236372) [1587 bp, 528 aa]
          Length = 528

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 56/138 (40%), Gaps = 21/138 (15%)

Query: 571 EETATIIMKELYKMKGGRVTFIPLNRIYLDANIQYPPNDQTSFTPLINKIKYD-----QR 625
           E T  ++ K   K    R TF    RI     I Y P+ + S   L  +  +D     + 
Sbjct: 238 ESTCKLLHKVAGKCAELRTTFQNKERIN-QTEIDYQPSKKRSIDALAEQC-HDLDSQLRD 295

Query: 626 FDKAVRHIFGKTIVVKDLTTGLRISKKFKLN---SITLDGDRAD-----------KRGVL 671
           +  AV H++   +      T L  SK   +N   ++ +D   AD           +RGV+
Sbjct: 296 YRGAVLHMWSSKVAATSGKTALSSSKFKAINQPANVQVDNQLADMPRLVKRTQLNRRGVV 355

Query: 672 TGGYYDQYKQSRLDSLST 689
             G+ + YKQ RL  L +
Sbjct: 356 PLGFEEDYKQKRLPLLDS 373

>Kwal_26.9480
          Length = 719

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 1123 LSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQ 1171
            +SGG+K   AIA +L    +  AP   FDE  +ALD     A+   IK+
Sbjct: 600  ISGGEKQRLAIARVL----LKDAPIMFFDEATSALDTHTEQALLRTIKE 644

>CAGL0L06908g complement(777557..778876) highly similar to sp|Q07478
           Saccharomyces cerevisiae YDL084w SUB2, start by
           similarity
          Length = 439

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 68/139 (48%), Gaps = 12/139 (8%)

Query: 201 MDELNSKLKEMEQERKELEKYNALEKNRKVFQFTL-YDRELNDII-----NQVE-RLDDD 253
           +DE +  L+E++  R   E + A  ++++V  F+    +E+  I      N +E  +DD+
Sbjct: 207 IDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDE 266

Query: 254 YNVTANSSEQYIKELDKREEIISNISKNLSEIDSTLKIKTTTDLPQAKSRHSELTNQLTN 313
             +T +  +QY  +L++RE+     ++ L+++   L+        ++ SR +ELT  L  
Sbjct: 267 AKLTLHGLQQYYIKLEEREK-----NRKLAQLLDDLEFNQVIIFVKSTSRANELTKLLNA 321

Query: 314 LQVQIKDLKLQIKAQERQA 332
                  +   +K +ER A
Sbjct: 322 SNFPAITVHGHMKQEERIA 340

>Scas_719.46
          Length = 415

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 30/102 (29%)

Query: 400 RNEWIQNEIEESDKTLQGLVDIKNKILIERDEINSKVRSLDEDIDN-------------L 446
           R+EW  N ++E          + +++ I +D+I  +V  LD+ IDN             L
Sbjct: 74  RDEWGNNVLKE----------LVSEMRIWQDKITDQVSRLDQ-IDNVLVHTETGTLNPKL 122

Query: 447 NDSIEGPNVT------GELEVIQDELEKLKSEYAASIDKRKE 482
           +D I   NV        E+ VIQ ++E +KS+YA+ + K KE
Sbjct: 123 SDYISRDNVNILDERLMEMPVIQKQIESIKSQYASMLKKVKE 164

>Kwal_47.17178
          Length = 367

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 849 DILSQMSQEGLSYLSSLRR-DVDSMTSKLEAVQNQCNSALQHVDTIQKEIEDLKSEKRNN 907
           D L+    +GL+ +  L+R +++   S     +N+     Q  DT +K +E  ++    N
Sbjct: 83  DYLADCQAKGLTNVPFLQRLEINGWLSG----ENKSTRPEQSSDTTEKPVEISETAATIN 138

Query: 908 DKILEKANSQQRLLL 922
           D +LE+A +Q+++LL
Sbjct: 139 DPVLEEALAQEKVLL 153

>Scas_710.50
          Length = 602

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 1120 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANIIKQLSV 1174
            ++ +SGG+K      + + IQ+++  P  L DE  + LD      +  I+K+LSV
Sbjct: 145  IKGISGGEKR----RVTMGIQLLNDPPIVLLDEPTSGLDSFTSATILEILKKLSV 195

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,838,315
Number of extensions: 1655590
Number of successful extensions: 12504
Number of sequences better than 10.0: 797
Number of HSP's gapped: 11744
Number of HSP's successfully gapped: 1648
Length of query: 1227
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1114
Effective length of database: 12,684,275
Effective search space: 14130282350
Effective search space used: 14130282350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)