Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_711.3899899843640.0
YJL076W (NET1)11894758042e-90
CAGL0H02783g17854626962e-75
Scas_675.2413193526763e-73
AAL181C12214125619e-59
Kwal_14.242112054075412e-56
KLLA0C09394g11844155002e-51
CAGL0B03179g9273333386e-32
YKR010C (TOF2)7711512126e-17
Kwal_14.2384528116750.87
CAGL0G05379g55070751.1
Kwal_26.8061126793696.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_711.38
         (998 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_711.38                                                          1685   0.0  
YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein r...   314   2e-90
CAGL0H02783g 251169..256526 some similarities with sp|P47035 Sac...   272   2e-75
Scas_675.24                                                           265   3e-73
AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF...   220   9e-59
Kwal_14.2421                                                          213   2e-56
KLLA0C09394g 817925..821479 weakly similar to sp|P47035 Saccharo...   197   2e-51
CAGL0B03179g complement(309816..312599) weakly similar to sp|P47...   134   6e-32
YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein t...    86   6e-17
Kwal_14.2384                                                           33   0.87 
CAGL0G05379g complement(505531..507183) similar to sp|Q01722 Sac...    33   1.1  
Kwal_26.8061                                                           31   6.3  

>Scas_711.38
          Length = 998

 Score = 1685 bits (4364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 869/998 (87%), Positives = 869/998 (87%)

Query: 1   MSMFRLQVELVPQNGQLAQQTSIENSQLNHTRSFIPSTENSFQYPYNRFLSFGLPLNFSI 60
           MSMFRLQVELVPQNGQLAQQTSIENSQLNHTRSFIPSTENSFQYPYNRFLSFGLPLNFSI
Sbjct: 1   MSMFRLQVELVPQNGQLAQQTSIENSQLNHTRSFIPSTENSFQYPYNRFLSFGLPLNFSI 60

Query: 61  PTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLDPDFIVEE 120
           PTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLDPDFIVEE
Sbjct: 61  PTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLDPDFIVEE 120

Query: 121 VFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQPLSNKVSQQQANGVYGIPR 180
           VFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQPLSNKVSQQQANGVYGIPR
Sbjct: 121 VFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQPLSNKVSQQQANGVYGIPR 180

Query: 181 KQYLAISSTKTPSNVGRRISTPLAQQIYPDIDEQLENEEDRNAADRSFLPPPAQPQSPQI 240
           KQYLAISSTKTPSNVGRRISTPLAQQIYPDIDEQLENEEDRNAADRSFLPPPAQPQSPQI
Sbjct: 181 KQYLAISSTKTPSNVGRRISTPLAQQIYPDIDEQLENEEDRNAADRSFLPPPAQPQSPQI 240

Query: 241 RVSSGIDRSKKIDGIAKDDSVSRSEVVDPDKSKQQRLLLGTPIMTTMTPNRVTLTGQRVV 300
           RVSSGIDRSKKIDGIAKDDSVSRSEVVDPDKSKQQRLLLGTPIMTTMTPNRVTLTGQRVV
Sbjct: 241 RVSSGIDRSKKIDGIAKDDSVSRSEVVDPDKSKQQRLLLGTPIMTTMTPNRVTLTGQRVV 300

Query: 301 SESHTSNSLQFIPNNKENSTQXXXXXXXXXXXXAVLKNIPEPKITEVEKVLKAGPSSPAS 360
           SESHTSNSLQFIPNNKENSTQ            AVLKNIPEPKITEVEKVLKAGPSSPAS
Sbjct: 301 SESHTSNSLQFIPNNKENSTQRLSSNSNRRVNSAVLKNIPEPKITEVEKVLKAGPSSPAS 360

Query: 361 LLPEKSERLPMKRPFLTGVXXXXXXXXXXXXXXXXXRPTLQRQSSIADNNGSPVKNSPNE 420
           LLPEKSERLPMKRPFLTGV                 RPTLQRQSSIADNNGSPVKNSPNE
Sbjct: 361 LLPEKSERLPMKRPFLTGVSSSYSDENISSDSSTHSRPTLQRQSSIADNNGSPVKNSPNE 420

Query: 421 ENNPDSMQLAELPLDKNVARVQNDLLSEIDNRRSRVEDNNLSHLFKPITQXXXXXXXXXX 480
           ENNPDSMQLAELPLDKNVARVQNDLLSEIDNRRSRVEDNNLSHLFKPITQ          
Sbjct: 421 ENNPDSMQLAELPLDKNVARVQNDLLSEIDNRRSRVEDNNLSHLFKPITQENRDDNDKTE 480

Query: 481 XXXXXIKHTSKNAVEKQSNITPSFIGDEERELLTNESEVGSTLPPTDKHQNRNGQITPSX 540
                IKHTSKNAVEKQSNITPSFIGDEERELLTNESEVGSTLPPTDKHQNRNGQITPS 
Sbjct: 481 DTDNNIKHTSKNAVEKQSNITPSFIGDEERELLTNESEVGSTLPPTDKHQNRNGQITPSE 540

Query: 541 XXXXXXXXXXXVRINPPGRGDKNSTNVSLQKVDVLKIFEGESLKIPSWLKGSKSKSQRRK 600
                      VRINPPGRGDKNSTNVSLQKVDVLKIFEGESLKIPSWLKGSKSKSQRRK
Sbjct: 541 ETDDEDEANTTVRINPPGRGDKNSTNVSLQKVDVLKIFEGESLKIPSWLKGSKSKSQRRK 600

Query: 601 PYTTVLYKDIDNSKPDPRNILPERTPRSAAKRAAQLLSGSQLARNQSKXXXXXXXXXXXX 660
           PYTTVLYKDIDNSKPDPRNILPERTPRSAAKRAAQLLSGSQLARNQSK            
Sbjct: 601 PYTTVLYKDIDNSKPDPRNILPERTPRSAAKRAAQLLSGSQLARNQSKEGEEEQEESNEE 660

Query: 661 VFDNXXXXXXXXXXXXXXGIETADSEEMERVMITENNKVKVIKAHALKEAVVPKLVTSSG 720
           VFDN              GIETADSEEMERVMITENNKVKVIKAHALKEAVVPKLVTSSG
Sbjct: 661 VFDNSEQEEFSSDEDSSSGIETADSEEMERVMITENNKVKVIKAHALKEAVVPKLVTSSG 720

Query: 721 AFSRSSGDMIEHVKELQMSAGVTENNKIEQDKIQELTKLPSSSEKLKNLKAKFSKQKPNS 780
           AFSRSSGDMIEHVKELQMSAGVTENNKIEQDKIQELTKLPSSSEKLKNLKAKFSKQKPNS
Sbjct: 721 AFSRSSGDMIEHVKELQMSAGVTENNKIEQDKIQELTKLPSSSEKLKNLKAKFSKQKPNS 780

Query: 781 FSLIGPSSINDDSFTVSINEESDSLNXXXXXXXXXXXXXXNFKNSKNNVADVSRAHGDKK 840
           FSLIGPSSINDDSFTVSINEESDSLN              NFKNSKNNVADVSRAHGDKK
Sbjct: 781 FSLIGPSSINDDSFTVSINEESDSLNETTSDSSSEVDEEVNFKNSKNNVADVSRAHGDKK 840

Query: 841 QNSSGKIVSDGGRMQQSDNVTPGKVPLTELLSSPISNKPTPTKVNTMLHNGLPPKVRPSL 900
           QNSSGKIVSDGGRMQQSDNVTPGKVPLTELLSSPISNKPTPTKVNTMLHNGLPPKVRPSL
Sbjct: 841 QNSSGKIVSDGGRMQQSDNVTPGKVPLTELLSSPISNKPTPTKVNTMLHNGLPPKVRPSL 900

Query: 901 NSLSDLIYKGIPDVKEKRLNASQPNFISKVKNVXXXXXXXXXXXXXXXXXXXXXXXXXXX 960
           NSLSDLIYKGIPDVKEKRLNASQPNFISKVKNV                           
Sbjct: 901 NSLSDLIYKGIPDVKEKRLNASQPNFISKVKNVELNETDETDDNLTSSDSDSSSSDSTLD 960

Query: 961 XKGEEHSLDPISTKTQLGXXXXXRSSGFASLIRESKQK 998
            KGEEHSLDPISTKTQLG     RSSGFASLIRESKQK
Sbjct: 961 NKGEEHSLDPISTKTQLGKKKKKRSSGFASLIRESKQK 998

>YJL076W (NET1) [2837] chr10 (295161..298730) Nucleolar protein
           required for rDNA chromatin silencing and nucleolar
           integrity, has similarity to Tof2p, component of RENT
           complex [3570 bp, 1189 aa]
          Length = 1189

 Score =  314 bits (804), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 212/475 (44%), Positives = 283/475 (59%), Gaps = 39/475 (8%)

Query: 3   MFRLQVELVPQNGQLAQQ-------TSIENSQL--NHTRSFIPSTENSFQYPYNRFLSFG 53
           M++LQV LVP + Q           T  E+SQL  N T     + + S QY   R  +  
Sbjct: 1   MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSANVS 60

Query: 54  LPLNFSIPTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLD 113
              ++   ++ +KFLLFTKPTN L  LS EI++KCE MYP L E++EI +L+D++ CDLD
Sbjct: 61  FTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLD 120

Query: 114 PDFIVEEVFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQPLSNKVSQQQAN 173
           PDF+V++VF+ +N+V+VILKN+ID      VS YKS+KR K N GS Q +  +     ++
Sbjct: 121 PDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGSPQSVQPQQQIPSSS 180

Query: 174 GVYGIPRKQ----YLAISSTKTPSNVGRRISTPLAQQIYPDIDEQL----ENEEDRNAAD 225
           GV  I +K+        ++ ++ +N   R+STPLA+QIYP    ++     ++ED +  +
Sbjct: 181 GVLRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLARQIYPPPSSKIVSNNSDDEDEDIGE 240

Query: 226 RSFLPPPAQPQSPQIRVSSGIDRSKKI-DGIAKDDSVSRSEVVDPDKSKQQRLLLGTPIM 284
           RSFLPPP QPQSP IR+SSGID  KKI   I ++D VSRS  VDPDK+KQQRLL GTPIM
Sbjct: 241 RSFLPPPTQPQSPPIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKTKQQRLLSGTPIM 300

Query: 285 TTMTPNRVTLTGQRVVSESHTSNSLQFIPNNKENSTQXXXXXXXXXX------------- 331
           +TMTPNRVTLTGQRVVSE    N L F  +   +S                         
Sbjct: 301 STMTPNRVTLTGQRVVSEHAHKNELVFSASASSSSFANGGTAAVTAQDINRKPPVTTPRI 360

Query: 332 XXAVLKNIPEPKITEVEKVLKAGPSSPASLLPEKSERLPMKRPFL------TGVXXXXXX 385
              +LK IPEP+I+E+EK LK GPSSPAS+LP K+ ++PMK+P+L               
Sbjct: 361 TSGMLK-IPEPRISEIEKELKEGPSSPASILPAKAAKIPMKKPYLENGENYESDDSSSSE 419

Query: 386 XXXXXXXXXXXRPTLQR-QSSIADNNGSPVKNSPNEENNPDSMQLAELPLDKNVA 439
                      + +LQR QSSIADNNGSPVKNSP  +  P ++ LAELP   N +
Sbjct: 420 NQETPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELPKASNTS 474

 Score =  113 bits (282), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 144/299 (48%), Gaps = 37/299 (12%)

Query: 552 VRINPPGRGDKNSTNVSLQKVDVLKIFEGESLKIPSWLKGSKSK----SQRRKPYTTVLY 607
           VRI P     ++S + S  K D+ K+ EG+   +P W KG  S+    S+  KPYTTVL 
Sbjct: 604 VRIVP-----QDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSRTSGNSKNSKPYTTVLN 658

Query: 608 KDIDNSKPDPRNILPERTPRSAAKRAAQLLSGSQLARNQSKXXXXXXXXXXXXVFDNXXX 667
           KDIDNSKPDPRNILP+RTPRSAAKRAAQLL+G++  +N+                D    
Sbjct: 659 KDIDNSKPDPRNILPQRTPRSAAKRAAQLLAGAK--KNEVPQKSTEDSSSAASTDD---- 712

Query: 668 XXXXXXXXXXXGIET---ADSEEMERVMITENNKVKVIKAHALKEAVVPKLVTSSGAFSR 724
                      GIET   +D +   + M   NN  K I  H+LK +VVP  V  S   ++
Sbjct: 713 -------ESESGIETDFSSDDDFKRKNMSVPNNGPKDISLHSLKGSVVP--VKDSKIINK 763

Query: 725 SSGDMIEHVKELQMSAGVTE----NNKIEQDKIQELTKLPSSSEKLKNLKAKFSKQ---K 777
              +     ++ Q  + V+E    N+KI +   +     P+S++K +N   K   +   +
Sbjct: 764 EVDEERNDKRDSQKKSAVSESSVTNSKISEQMAKSF--YPNSNKK-QNEATKVETKPATQ 820

Query: 778 PNSFSLIGPSSINDDSFTVSINEESDSLNXXXXXXXXXXXXXXNFKNSKNNVADVSRAH 836
            +SF ++G S       T S NEE +  N                K + + VAD+  A+
Sbjct: 821 ASSFPVVGGSPSVATKGTTSFNEEGNRKNVKTKAKNESAQIDRQQKETTSRVADLKSAN 879

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 55/78 (70%), Gaps = 4/78 (5%)

Query: 843  SSGKIVSDGGRMQQSDNVTPGKVPLTELL--SSPISNKP-TPTKVNTMLHNGLPPKVRPS 899
            SS KI +    + +  N TP K+P+T+L+  SSP S K  T +  +++LH+ LP KVRPS
Sbjct: 1024 SSSKIEAPSPSVNKKINATPDKIPVTQLMDMSSPPSVKSKTTSNPSSILHD-LPRKVRPS 1082

Query: 900  LNSLSDLIYKGIPDVKEK 917
            L+SLSDL+ +GIPDVKEK
Sbjct: 1083 LSSLSDLVSRGIPDVKEK 1100

>CAGL0H02783g 251169..256526 some similarities with sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1785

 Score =  272 bits (696), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 195/462 (42%), Positives = 267/462 (57%), Gaps = 47/462 (10%)

Query: 3   MFRLQVELVP---QN---------GQLAQQTSIENSQL-NHTRSFIPSTENSFQYPYNRF 49
           M++LQV LVP   QN         GQ     + ++ QL N       +T N    P +  
Sbjct: 1   MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNGTFNNTFNGQSQPDSSI 60

Query: 50  LSFGLPLNFSIPTKN-------KKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIE 102
                  N S+ T N       KKFL FTK  N L  LS EI +KC++MYP L  +L+I 
Sbjct: 61  FPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEINDKCKAMYPSLEADLDIL 120

Query: 103 TLRDSTDCDLDPDFIVEEVFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQP 162
           +L+DS  CDLDPDF+V++VF+  N+V+VIL +++D   +  VS+Y+SIKRR+ N     P
Sbjct: 121 SLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEITPVSSYRSIKRRRLN-----P 175

Query: 163 LSNKVSQQQAN-GVYG----IPRKQYLAISSTKTPSNVGRRISTPLAQQIY-PDIDEQLE 216
            S   S+ Q++ GV      + +K+    +  K  SN+  RISTPLA+Q+Y P    + +
Sbjct: 176 ESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRISTPLARQLYPPSAIFEPQ 235

Query: 217 NEEDRNAADRSFLPPPAQPQSPQIRVSSGIDRS-KKIDG-IAKDDSVSRSEVVDPDKSKQ 274
           N +D   ADRSFLPPP QP SP IR+SSGID + +KI   I + D+VSRS  VDPDKS+Q
Sbjct: 236 NSDDEEVADRSFLPPPIQPGSPPIRISSGIDTNVRKITSRIGEQDTVSRSATVDPDKSRQ 295

Query: 275 QRLLLGTPIMTTMTPNRVTLTGQRVVSESHTSNSLQFIPNNKENSTQXXXXXXXXXXXXA 334
           QRLL GTP+M+TMTPNRVTLTGQRV+SE   ++S+    N   N               +
Sbjct: 296 QRLLSGTPVMSTMTPNRVTLTGQRVISEQRPNDSVLTFTNRHIN------EPSHSRRITS 349

Query: 335 VLKNIPEPKITEVEKVLKAGPSSPASLLPEKSERLPMKRPFLTG--VXXXXXXXXXXXXX 392
            +  IPEPKI E+EK L  GPSSP+++LP   +++PMK+PF+                  
Sbjct: 350 GMLQIPEPKIAEMEKELLEGPSSPSTILPPIPDKIPMKKPFIETERYYSEDSSETESNSG 409

Query: 393 XXXXRPTLQRQSSIADNNGSPVK-NSPNEENNPDSMQLAELP 433
               + +L RQ+SIADNNGSP++ N  NE     ++ LA+LP
Sbjct: 410 EINAKSSLHRQTSIADNNGSPLRTNFLNE-----AVHLADLP 446

>Scas_675.24
          Length = 1319

 Score =  265 bits (676), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 168/352 (47%), Positives = 224/352 (63%), Gaps = 18/352 (5%)

Query: 41  SFQYPYNRFLSFGLPL--NFSIPTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEE 98
           S Q+  N  ++ G  +  N++   K KKFL FTKPTN L  LS E++ KCE MYP+L+E+
Sbjct: 54  SMQFSNNNTMTIGSIIRPNYTNQAKTKKFLHFTKPTNSLLALSDEVLAKCEKMYPNLNED 113

Query: 99  LEIETLRDSTDCDLDPDFIVEEVFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTG 158
           LEI TL+D   CDLDPDF V+++F+  N+V V++KN++D  S    S Y++ KR+K N G
Sbjct: 114 LEILTLQDINGCDLDPDFTVKDIFNIDNVVMVLIKNELDVSSAGSTSIYRNFKRQKLNNG 173

Query: 159 SYQPLSNKVS-QQQANGVYGIPRKQYLAISSTKTPSNVGR---RISTPLAQQIYPDIDEQ 214
             Q L  K S + Q+ G   I +K+    S  + P+  G    RISTPLA QIYP    +
Sbjct: 174 GAQQL--KTSPRTQSTGALKIEKKRPSTSSGIRNPTTNGNSTLRISTPLANQIYPSPIMK 231

Query: 215 LENEEDRNAAD---RSFLPPPAQPQSPQIRVSSGIDRSKKI-DGIAKDDSVSRSEVVDPD 270
           + N  D    D   RSFLPPP+QPQSP IR+SSGI++SK+I   I ++D+VSRS  VDPD
Sbjct: 232 MTNNSDDERDDVRERSFLPPPSQPQSPPIRISSGINQSKRIRSTIVEEDTVSRSGTVDPD 291

Query: 271 KSKQQRLLLGTPIMTTMTPNRVTLTGQRVVSE----SHTSNSLQFIPNNK--ENSTQXXX 324
           KSKQQ +L GTP   TMTPNRVTLTGQRV+SE    +  +N L F+ + +    S Q   
Sbjct: 292 KSKQQVMLPGTPANYTMTPNRVTLTGQRVLSENYNTNGNNNGLIFVSSTQGPNKSQQGQQ 351

Query: 325 XXXXXXXXXAVLKNIPEPKITEVEKVLKAGPSSPASLLPEKSERLPMKRPFL 376
                    + +  IPEP+I E+E+ L  GPSSPAS LP KS+R+PMK+P+L
Sbjct: 352 PTLSTPRITSGMLRIPEPRIAEIERELHEGPSSPASALPAKSDRIPMKKPYL 403

>AAL181C [6] [Homologous to ScYJL076W (NET1) - SH; ScYKR010C (TOF2)
           - SH] (20056..23721) [3666 bp, 1221 aa]
          Length = 1221

 Score =  220 bits (561), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 168/412 (40%), Positives = 234/412 (56%), Gaps = 57/412 (13%)

Query: 63  KNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLDPDFIVEEVF 122
           + +KFL FTKPTN L+ L+ EIVEKC  MYP L+EE EI TL+D  +CDLDPDF+V++VF
Sbjct: 78  RGRKFLHFTKPTNSLYELADEIVEKCAKMYPGLAEEPEIVTLQDVNECDLDPDFVVKDVF 137

Query: 123 SSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQPLSNKVSQQQANGVYGIPRKQ 182
           +  N V+V+L+ND+D  + ++ + Y  +K+RK NTG+    +   S Q A  V  + +K+
Sbjct: 138 NMDNTVRVLLRNDLDEAAGDR-TIY--MKKRKLNTGAAGVPAAGGSVQAA--VLNVAKKR 192

Query: 183 YLAISSTKTPSNVGRRISTPLAQQIYPDIDEQLENE--EDRNAADRSFLPPPAQPQSPQI 240
               +S KT      R+STPLA QIYP   ++  N   ED + AD+S L PP  PQSP I
Sbjct: 193 ----ASIKT---SALRVSTPLANQIYPPPTKKQVNSDFEDDDVADKSIL-PPPPPQSPPI 244

Query: 241 RVSSGIDRSKKIDGIAKDDSVSRSEVVDPDKSKQQRLLLGT---PIMTTMTPNRVTLTGQ 297
           R+SSG+D+ K+I+    D++VS+SE VDP+KS+QQRL  GT   P+    TPNRV+LTG 
Sbjct: 245 RISSGMDQ-KRIN--MNDNAVSKSETVDPNKSRQQRLPSGTPMRPVSMVETPNRVSLTGP 301

Query: 298 RVVSESHTSNSLQFIPNNKENSTQXXXXXXXXXXXXAVLKNIPEPKITEVEKVLKAGPSS 357
            V+SES  S      P                    + +  IPEP+++EVEK LK GP+S
Sbjct: 302 TVLSESTVSQKSTATP------------IITNIRITSGMLRIPEPRLSEVEKELKEGPAS 349

Query: 358 PASLLPEKSERLPMKRPFLTGVXXXXXXXXXXXXXX------------XXXRPTL---QR 402
           PA  LP +  R+PMK+P+   +                              PT+   Q 
Sbjct: 350 PAVDLPARPSRIPMKKPYNPSMQQDEDLSSSSSSTEDNVPAVPYENELERSGPTMATRQS 409

Query: 403 QSSIADNNGSPVKNSPNEENNPDSMQLAELP------LDKNVARVQNDLLSE 448
            S+IAD+ GSP K S  E+NN   + L ELP      L+K V+++   L S+
Sbjct: 410 SSTIADDQGSPTKKSRFEKNN---IGLVELPSPRKSSLEKKVSKLNKGLASD 458

>Kwal_14.2421
          Length = 1205

 Score =  213 bits (541), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 156/407 (38%), Positives = 226/407 (55%), Gaps = 55/407 (13%)

Query: 47  NRFLSFGLPLNFSIPTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRD 106
           N F+S     + S P K +K L FTKPTN LF+L+ EIVE+C+ +YP+L+  +E+ TL+D
Sbjct: 61  NLFMSSFASTHGSTP-KLRKLLHFTKPTNTLFSLAEEIVERCDKIYPNLTRPVEVLTLQD 119

Query: 107 STDCDLDPDFIVEEVFSSSNLVKVILKNDIDFQSLEQVSNYKSIKRRKSNTGSYQPLSNK 166
           S +CDLDPD++V++VF+  N+V+ +L+NDI+  S +Q     S KRR+ N+    P    
Sbjct: 120 SNECDLDPDYLVKDVFNVDNVVRAVLRNDIEL-SDDQSQTLYSAKRRRLNSSLPNPSG-- 176

Query: 167 VSQQQANGVYGIPRKQYLAISSTKTPSNVGRRISTPLAQQIYPDIDEQLENE--EDRNAA 224
               Q N ++   ++ ++  +S+        R+STPLA QIYP    +  N   ED +  
Sbjct: 177 ----QPNVLHIAKKRPHMLRNSS------AMRVSTPLANQIYPPATGRQVNSDYEDDDVG 226

Query: 225 DRSFLPPPAQPQSPQIRVSSGIDRSKKIDGIAKDDSVSRSEVVDPDKSKQQRLLLGTPIM 284
           DRS L PP QPQS  IR+SSG+  +KKI+    +D+VSRSE VDPDKS+QQRL  GTP+ 
Sbjct: 227 DRSVL-PPPQPQSQPIRISSGVGSAKKIN--FNEDTVSRSEAVDPDKSRQQRLPSGTPMR 283

Query: 285 -----TTMTPNRV-TLTGQRVVSESHTSNSLQFIPNNKENSTQXXXXXXXXXXXXAVLKN 338
                T  TPNR+  L G     E    +S   +  NK  ++              +L+ 
Sbjct: 284 HINNGTATTPNRLNVLDGTLQADEVTNKSSATPVATNKRITS-------------GMLR- 329

Query: 339 IPEPKITEVEKVLKAGPSSPASLLPEKSERLPMKRPFLTGVXXXXXXXXXXXXX------ 392
           IPEPKI+E+E  L+ GP+SP++ LP + +R+PMK+                         
Sbjct: 330 IPEPKISEIENELRQGPASPSAELPPRPDRIPMKKQQFPQSDDEEQSQSSGNENPTLMEK 389

Query: 393 ------XXXXRPTLQRQSSIADNNGSPVKNSPNEENNPDSMQLAELP 433
                     +P+  RQ+SIADNNGSP+K+     N   ++ LAELP
Sbjct: 390 ANNLILEHGSKPSASRQTSIADNNGSPIKDG----NKIGNVNLAELP 432

>KLLA0C09394g 817925..821479 weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 1184

 Score =  197 bits (500), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 163/415 (39%), Positives = 231/415 (55%), Gaps = 57/415 (13%)

Query: 49  FLSFGLPLNFSIPTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDST 108
           +LS  +  + + P K KKFL+FTKPTN L+ LS EI++KC  +YP+LS ELEI+TL+D  
Sbjct: 72  YLSSFMTSHITRP-KLKKFLIFTKPTNTLYQLSQEILDKCNKIYPNLSTELEIDTLQDVD 130

Query: 109 DCDLDPDFIVEEVFSSSNLVKVILKNDIDFQS--LEQVSNYKSIKRRKSNTGSYQPLSNK 166
           +CDLDPDF+V++VF+  N V+VIL+ND+D +S    Q S Y S KRRK N G+       
Sbjct: 131 ECDLDPDFVVKDVFNVYNTVRVILRNDVDLESNPDRQESLYSS-KRRKLNNGN------- 182

Query: 167 VSQQQANGVYGIPRKQYLAISSTKTPSNVGRRISTPLAQQIYP--------DIDEQLENE 218
            SQQ  +    + +   +A    +   N   RISTPLA QIYP         ++   E +
Sbjct: 183 -SQQNTSTGATLDQPVTVAKRRPQALKNSALRISTPLAHQIYPPPSQRNPKQVNSDYEED 241

Query: 219 E--DRNAADRSFLPPPAQPQSPQIRVSSGIDRSK-KIDGIAKDDSVSRSEVVDPDKSKQQ 275
           E  D    D+S LPPP  PQSP IR+SS I + + KI+G   +D+VS+SE VDP K+KQQ
Sbjct: 242 EYGDDEIGDKSILPPPTVPQSPPIRISSSIAQKRLKING--SEDTVSKSETVDPSKAKQQ 299

Query: 276 RLLLGTPI--MTTM-TPNRVTLTGQRVVSESHTS-NSLQFIPNNKENSTQXXXXXXXXXX 331
           RL  GTP+  M  + TPNR         ++     NS   + N +  S            
Sbjct: 300 RLPSGTPMKPMNVIETPNRPGFLAMPQQAQHLLRINSTPVVTNKRITS------------ 347

Query: 332 XXAVLKNIPEPKITEVEKVLKAGPSSPAS-LLPEKSERLPMKRPFL---------TGVXX 381
              +L+ IPEP+I+E+E+ +  G SSPA+ LLP KS ++PMK+ ++          G   
Sbjct: 348 --GMLR-IPEPRISEMERTMHEGLSSPAAGLLPPKSAKIPMKKQYIPDEHDSSSSEGEFT 404

Query: 382 XXXXXXXXXXXXXXXRP-TLQRQ--SSIADNNGSPVKNSPNEENNPDSMQLAELP 433
                           P ++Q +  SSIAD+NGSP K SP +     ++++A+LP
Sbjct: 405 EDKESVPVRVNSKAPLPVSVQSRAPSSIADDNGSPTKKSPLDATKRMNVKVADLP 459

 Score = 73.9 bits (180), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 55/94 (58%), Gaps = 12/94 (12%)

Query: 552 VRINPPGRGDKNSTNVSLQKVDVLKIFEGESLKIPSWLKGSKSKSQR-------RKPYTT 604
           V I+P  R D      S QK ++L++ +G    +P   + +    Q        RKPY T
Sbjct: 514 VCIHPTDRMDG-----SFQKSELLELLKGSKFDVPPAFRRAAGALQENDINKRSRKPYLT 568

Query: 605 VLYKDIDNSKPDPRNILPERTPRSAAKRAAQLLS 638
           VL KDIDNS+PDPRNILP + PR AA++AAQ +S
Sbjct: 569 VLNKDIDNSEPDPRNILPSKLPRQAAQKAAQFIS 602

>CAGL0B03179g complement(309816..312599) weakly similar to sp|P47035
           Saccharomyces cerevisiae YJL076w NET1 required for rDNA
           silencing and nucleolar integrity, start by similarity
          Length = 927

 Score =  134 bits (338), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 122/333 (36%), Positives = 170/333 (51%), Gaps = 63/333 (18%)

Query: 3   MFRLQVELV-PQNGQLAQQTSIENSQLNHTRSFIPSTENSFQYPYNRFLSFGLPLNFSIP 61
           M++LQV L+ PQN   A   SI+    N     I +  N                   I 
Sbjct: 1   MYKLQVVLIQPQNQLKANGYSIDGD--NSDDQTITTIRNGGHI---------------IR 43

Query: 62  TKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLS-EELEIETLRDSTDCDLDPDFIVEE 120
              +KFL FTKP N L  L+ EI  +   +Y +L+ E  EI +L+D   CDLD  ++V++
Sbjct: 44  DHTRKFLHFTKPENTLLQLADEIENRITKLYSNLNIESFEILSLQDINHCDLDATYLVKD 103

Query: 121 VFSSSNLVKVILKNDIDF------------QSLEQVSNYKSIKRRKSNTGSYQPLSNKVS 168
           VFS  N V VILKN+++F                ++S Y S+++R+S+            
Sbjct: 104 VFSMDNTVLVILKNELEFIDANGTLNANDLHDAGRISAYSSVRKRRSS------------ 151

Query: 169 QQQANGVYGIPRKQYLAISSTKTPSNVG-----RRISTPLAQQIYPD--------IDEQL 215
             +A G       Q L    +K P+N+       R+++PLA +I  D        I+  +
Sbjct: 152 --KAFGNSSRIEPQILVPKRSK-PNNLAPLSNNLRVTSPLANEISNDEINSSTVVINRNV 208

Query: 216 ENEEDRNAA---DRSFLPPPAQPQSPQIRVSSGIDRSKKIDGIAKD-DSVSRSEVVDPDK 271
                 N +   DRSFLPPPAQPQSP IR+SSGI   K+I   +++ D VSRSEVVDPDK
Sbjct: 209 STAFAANRSTLTDRSFLPPPAQPQSPAIRISSGIGDGKRIFSESQNLDVVSRSEVVDPDK 268

Query: 272 SKQQRLLLGTPIMTTMTPNRVTLTGQRVVSESH 304
           SKQQ ++   P+    TPNRV L+GQRV+SES 
Sbjct: 269 SKQQLIVPDIPMEFISTPNRVNLSGQRVISESQ 301

>YKR010C (TOF2) [3266] chr11 complement(458567..460882) Protein that
           interacts with DNA topoisomerase I [2316 bp, 771 aa]
          Length = 771

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 83/151 (54%), Gaps = 6/151 (3%)

Query: 65  KKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDLDPDFIVEEVFSS 124
           KKFL FT   N L  LS EI+ K + +YP+  E +EI +L+D   CDLD +FI+++VF +
Sbjct: 83  KKFLHFTDGDNTLLQLSNEILTKFDRLYPNFKESIEIVSLQDRHGCDLDSEFIIKDVFEN 142

Query: 125 SNLVKVILKNDIDFQSLEQVS--NYKSIKRRKSNTGSYQPL----SNKVSQQQANGVYGI 178
             +V VILK+++D+   + +S       +RR+ N  S + +      K+S++  + +   
Sbjct: 143 DGVVLVILKDELDWSRNQHISLLQLARQRRRQDNKPSTKSIVTEKRKKISKEDLSSISNK 202

Query: 179 PRKQYLAISSTKTPSNVGRRISTPLAQQIYP 209
                +A SS K       R+STPL  +I P
Sbjct: 203 DTMHLIAKSSLKNNFINKSRVSTPLMNEILP 233

>Kwal_14.2384
          Length = 528

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 9   ELVPQNGQLAQQTSIENSQLNHTRSFIPSTENSFQYPYNRFLSF------GLPLN----- 57
           +LV  N QL  + S+    L+ T S +P       +   +F  F      G P++     
Sbjct: 411 QLVLSNEQLYNRWSLLQKDLS-TSSLLPPNAGILGHISAKFFGFFLLDKAGAPVDNDMES 469

Query: 58  -FSIPTKNKKFLLFTKPTNDLFTLSGEIVEKCESMYPDLSEELEIETLRDSTDCDL 112
             +  ++N +     K   ++ +L G     C+    +  ++LEIETL D+ DC++
Sbjct: 470 VIARVSQNLRLSKLDKAVEEVVSLKGWPRVLCDEWVHEARKKLEIETLVDALDCEI 525

>CAGL0G05379g complement(505531..507183) similar to sp|Q01722
           Saccharomyces cerevisiae YNL199c GCR2 glycolytic genes
           transcriptional activator, start by similarity
          Length = 550

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 10/70 (14%)

Query: 739 SAGVTENNKIEQDKIQELTKLPSSSEKLKNLKAKFS--KQKPNSFSLIGPSSINDDSFTV 796
           S G  + N ++ D ++EL +LP+    L N K K++   +KP+S  +IG    NDDS   
Sbjct: 416 SLGSLDVNTLDDDTVEELLQLPN----LSNKKTKYTNDNEKPSSADVIG----NDDSGNN 467

Query: 797 SINEESDSLN 806
            +NE  D+ N
Sbjct: 468 YVNEGQDNSN 477

>Kwal_26.8061
          Length = 1267

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 14/93 (15%)

Query: 3   MFRLQVELV--PQNGQLAQQTSIENSQLNHTRSFIPSTE--NSFQYPYNRFLSFGLPLNF 58
           +F  Q +L+  P+NG L QQT +  + L + RS +  T+  +SFQ     F  F  P N 
Sbjct: 103 LFLAQFKLLQEPENGYLVQQTYLATNLLEY-RSIVLLTDLPSSFQLIEELFNIFYSPHNN 161

Query: 59  SIPTKNKKFLLFTKPTNDLFTLSGEIVEKCESM 91
           +I  +  +          +  L GE++ +C+S+
Sbjct: 162 AIQERLYRV---------IGGLLGEVISECDSL 185

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.308    0.126    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 29,984,867
Number of extensions: 1307290
Number of successful extensions: 4387
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4500
Number of HSP's successfully gapped: 57
Length of query: 998
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 887
Effective length of database: 12,753,511
Effective search space: 11312364257
Effective search space used: 11312364257
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 67 (30.4 bits)