Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_711.3726726712321e-173
CAGL0G07667g2582725863e-75
YKR013W (PRY2)3291395611e-70
Scas_675.272901445492e-69
Sklu_956.13191265341e-66
YJL079C (PRY1)2991345172e-64
Kwal_14.24103731405014e-61
YJL078C (PRY3)8811445264e-61
KLLA0D02442g3681385005e-61
AAL179W3601394631e-55
Kwal_14.24092381364052e-48
CAGL0F05137g2271484016e-48
AAL178W2051373953e-47
KLLA0D02420g2121383797e-45
KLLA0C01496g4561602987e-31
AFR700W4341602961e-30
Kwal_33.131927991422374e-22
CAGL0C01375g683104643.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_711.37
         (267 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_711.37                                                           479   e-173
CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces c...   230   3e-75
YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed u...   220   1e-70
Scas_675.27                                                           216   2e-69
Sklu_956.1 YJL079C, Contig c956 998-1957                              210   1e-66
YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein w...   203   2e-64
Kwal_14.2410                                                          197   4e-61
YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein w...   207   4e-61
KLLA0D02442g complement(207613..208719) some similarities with s...   197   5e-61
AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH] complement(255...   182   1e-55
Kwal_14.2409                                                          160   2e-48
CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces c...   159   6e-48
AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY...   156   3e-47
KLLA0D02420g complement(206544..207182) some similarities with s...   150   7e-45
KLLA0C01496g complement(113533..114903) some similarities with s...   119   7e-31
AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285...   118   1e-30
Kwal_33.13192                                                          96   4e-22
CAGL0C01375g 146471..148522 similar to sp|P40483 Saccharomyces c...    29   3.9  

>Scas_711.37
          Length = 267

 Score =  479 bits (1232), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 236/267 (88%), Positives = 236/267 (88%)

Query: 1   MKASLFLLISLAMLVDSAPIVTKHTVTQTINALVYVDGTKTITTFATASNVNATSTSKVP 60
           MKASLFLLISLAMLVDSAPIVTKHTVTQTINALVYVDGTKTITTFATASNVNATSTSKVP
Sbjct: 1   MKASLFLLISLAMLVDSAPIVTKHTVTQTINALVYVDGTKTITTFATASNVNATSTSKVP 60

Query: 61  LLNATVSEAAFQALRSALQQQSEVXXXXXXXXXXXMPAEKXXXXXXXXXXXXXXXXXXXX 120
           LLNATVSEAAFQALRSALQQQSEV           MPAEK                    
Sbjct: 61  LLNATVSEAAFQALRSALQQQSEVATSTSDSTTATMPAEKSATSEVVTPATTTTAAVSDA 120

Query: 121 QQTDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPY 180
           QQTDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPY
Sbjct: 121 QQTDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPY 180

Query: 181 GENLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAW 240
           GENLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAW
Sbjct: 181 GENLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAW 240

Query: 241 GTYLICSYNSAGNFDGEYEANVLPLIN 267
           GTYLICSYNSAGNFDGEYEANVLPLIN
Sbjct: 241 GTYLICSYNSAGNFDGEYEANVLPLIN 267

>CAGL0G07667g 728351..729127 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, hypothetical start
          Length = 258

 Score =  230 bits (586), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 125/272 (45%), Positives = 164/272 (60%), Gaps = 22/272 (8%)

Query: 1   MKASLFLLISLAMLVDSAPIVT-------KHTVTQTINALVYVDGTKTITTFATASNVNA 53
           MK S+ LL   A  V +AP V        +H V +T+  +VYV G +T T++ T      
Sbjct: 1   MKLSIPLLSLAATSVLAAPAVVTVTEVAHEHDV-KTVRGVVYVQGGETKTSYTT------ 53

Query: 54  TSTSKVPLLNATVSEAAFQALRSALQQQSEVXXXXXXXXXXXMPAEKXXXXXXXXXXXXX 113
                  L ++T +  A     + +Q  ++             PA               
Sbjct: 54  -------LDDSTPTSVAEPVQENQVQNNAQAPAPSSSSSPTPAPAPAASPSSSSPAAASP 106

Query: 114 XXXXXXXQQTDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQL 173
                  Q ++LSDF  S+L EHN KRALH++T PLTWS+ELAQYAQ YA+N Y+C G L
Sbjct: 107 SPSPSPAQDSNLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANN-YDCSGNL 165

Query: 174 IHSGGPYGENLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAI 233
           +HSGGPYGENLA GY+ +GSVDAWY+EI +Y+Y+NPGFSESTGHFTQ+VWK +++VGCA+
Sbjct: 166 VHSGGPYGENLAIGYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSSTKVGCAV 225

Query: 234 KSCNNAWGTYLICSYNSAGNFDGEYEANVLPL 265
           KSC   WG Y+ICSY+ AGNF GE+  NV PL
Sbjct: 226 KSCGGVWGDYVICSYDPAGNFLGEFAQNVAPL 257

>YKR013W (PRY2) [3268] chr11 (463602..464591) Protein expressed
           under starvation conditions [990 bp, 329 aa]
          Length = 329

 Score =  220 bits (561), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 112/139 (80%), Gaps = 1/139 (0%)

Query: 127 DFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAA 186
           DF +S++ EHN KRALH++TG LTWS+ LA YAQ YAD+ Y+C G L+HSGGPYGENLA 
Sbjct: 191 DFSTSMVNEHNTKRALHKDTGSLTWSDTLATYAQNYADS-YDCSGNLVHSGGPYGENLAL 249

Query: 187 GYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLIC 246
           GY   GSVDAWYNEI+ YDYSNPGFSES GHFTQ+VWK TS+VGC +KSC   WG Y+IC
Sbjct: 250 GYGTTGSVDAWYNEITSYDYSNPGFSESAGHFTQVVWKGTSEVGCGLKSCGGEWGDYIIC 309

Query: 247 SYNSAGNFDGEYEANVLPL 265
           SY +AGN  GE+  NV+PL
Sbjct: 310 SYKAAGNVIGEFADNVMPL 328

>Scas_675.27
          Length = 290

 Score =  216 bits (549), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 117/144 (81%), Gaps = 2/144 (1%)

Query: 123 TDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGE 182
           ++LS+F SS+L EHN KRALH+NT  L+WS++LA YAQ YAD  Y+C G L+HSGGPYGE
Sbjct: 147 SNLSEFASSVLNEHNAKRALHQNTPALSWSDDLASYAQNYAD-AYDCSGNLVHSGGPYGE 205

Query: 183 NLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCN-NAWG 241
           NLA GY  +GSVDAWYNEIS YDYSNPGFSE+ GHFTQ+VWK ++QVGC IK C+   WG
Sbjct: 206 NLALGYDAVGSVDAWYNEISSYDYSNPGFSENAGHFTQVVWKSSTQVGCGIKDCSATGWG 265

Query: 242 TYLICSYNSAGNFDGEYEANVLPL 265
           +Y+ICSYN AGNF GE+  NV PL
Sbjct: 266 SYVICSYNPAGNFIGEFAENVEPL 289

>Sklu_956.1 YJL079C, Contig c956 998-1957
          Length = 319

 Score =  210 bits (534), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (84%), Gaps = 1/126 (0%)

Query: 124 DLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGEN 183
           DLSDF SS+L+EHNKKRALH++T  LTWSE LA YAQ YAD+ Y+C G L HSGGPYGEN
Sbjct: 168 DLSDFASSILDEHNKKRALHKDTSALTWSETLADYAQKYADS-YDCSGSLTHSGGPYGEN 226

Query: 184 LAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTY 243
           LA GY+  G+VDAWY EIS YD+SNP +S STGHFTQ+VWK TS+VGC IKSC+N+WG+Y
Sbjct: 227 LALGYSATGAVDAWYGEISSYDWSNPAYSSSTGHFTQVVWKSTSEVGCGIKSCDNSWGSY 286

Query: 244 LICSYN 249
           +ICSYN
Sbjct: 287 VICSYN 292

>YJL079C (PRY1) [2835] chr10 complement(289791..290690) Protein with
           similarity to plant pathenogenesis-related proteins, may
           have a role in mating efficiency [900 bp, 299 aa]
          Length = 299

 Score =  203 bits (517), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 92/134 (68%), Positives = 108/134 (80%), Gaps = 1/134 (0%)

Query: 132 LLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAGYTLL 191
           +L EHNKKRALH++T  L+WS+ LA YAQ YADN Y+C G L HSGGPYGENLA GY   
Sbjct: 166 VLAEHNKKRALHKDTPALSWSDTLASYAQDYADN-YDCSGTLTHSGGPYGENLALGYDGP 224

Query: 192 GSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLICSYNSA 251
            +VDAWYNEIS YD+SNPGFS +TGHFTQ+VWK T+QVGC IK+C  AWG Y+ICSY+ A
Sbjct: 225 AAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTTQVGCGIKTCGGAWGDYVICSYDPA 284

Query: 252 GNFDGEYEANVLPL 265
           GN++GEY  NV PL
Sbjct: 285 GNYEGEYADNVEPL 298

>Kwal_14.2410
          Length = 373

 Score =  197 bits (501), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 107/140 (76%), Gaps = 1/140 (0%)

Query: 126 SDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLA 185
           SDF S++L+ HN KR+LH++T  L+WS+ELA YAQ YAD  Y+C G L HSGGPYGENLA
Sbjct: 234 SDFASTILKAHNNKRSLHKDTSDLSWSDELASYAQDYADK-YDCSGSLSHSGGPYGENLA 292

Query: 186 AGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLI 245
            GY+  GSVDAWY EI +YD+SNP +S STGHFTQ+VWK +S +GC IKSC    G Y+I
Sbjct: 293 VGYSTTGSVDAWYGEIKDYDWSNPNYSSSTGHFTQVVWKGSSALGCGIKSCGGGTGDYVI 352

Query: 246 CSYNSAGNFDGEYEANVLPL 265
           CSY +AGNF GE+  NV  L
Sbjct: 353 CSYKTAGNFLGEFAENVKGL 372

>YJL078C (PRY3) [2836] chr10 complement(291252..293897) Protein with
           similarity to plant pathogenesis-related proteins, may
           have a role in mating efficiency, shows
           daughter-specific expression [2646 bp, 881 aa]
          Length = 881

 Score =  207 bits (526), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 90/144 (62%), Positives = 107/144 (74%), Gaps = 1/144 (0%)

Query: 122 QTDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYG 181
           QT   +F+S +L EHNK RALH +T PLTWS+ LA YAQ YAD  Y+C G L HS GPYG
Sbjct: 19  QTTFPNFESDVLNEHNKFRALHVDTAPLTWSDTLATYAQNYAD-QYDCSGVLTHSDGPYG 77

Query: 182 ENLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWG 241
           ENLA GYT  G+VDAWY EIS+Y+YSNPGFSESTGHFTQ+VWK T+++GC  K C   W 
Sbjct: 78  ENLALGYTDTGAVDAWYGEISKYNYSNPGFSESTGHFTQVVWKSTAEIGCGYKYCGTTWN 137

Query: 242 TYLICSYNSAGNFDGEYEANVLPL 265
            Y++CSYN  GN+ GE+   V PL
Sbjct: 138 NYIVCSYNPPGNYLGEFAEEVEPL 161

>KLLA0D02442g complement(207613..208719) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 368

 Score =  197 bits (500), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 107/138 (77%), Gaps = 1/138 (0%)

Query: 128 FQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAG 187
           F SS+L+EHN KRALH++T  L+WS+ELA YAQ YAD+ Y+C G L HSGGPYGENLA G
Sbjct: 231 FASSMLDEHNAKRALHKDTPTLSWSDELASYAQNYADD-YDCSGSLTHSGGPYGENLAIG 289

Query: 188 YTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLICS 247
           Y   G+VDAWY+EI +Y +SNP +S STGHFTQ+VWK T++VGC IK C   WG Y+ICS
Sbjct: 290 YGTTGAVDAWYSEIKDYSFSNPDYSSSTGHFTQVVWKSTTKVGCGIKQCGGVWGDYIICS 349

Query: 248 YNSAGNFDGEYEANVLPL 265
           Y+ AGN  G + +NV PL
Sbjct: 350 YDPAGNMLGTFASNVEPL 367

>AAL179W [8] [Homologous to ScYJL079C (PRY1) - SH]
           complement(25509..26591) [1083 bp, 360 aa]
          Length = 360

 Score =  182 bits (463), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 80/139 (57%), Positives = 103/139 (74%), Gaps = 2/139 (1%)

Query: 128 FQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAG 187
           F+  +L  HN +R LH++T PLTWSEELA++A+ +A N Y+C G+L+HS  PYGENLA G
Sbjct: 222 FEEEILRAHNSRRQLHKDTKPLTWSEELAKFARDFA-NQYDCSGRLVHSDSPYGENLAVG 280

Query: 188 Y-TLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLIC 246
           Y T   +V AWY+EIS+Y YS+P FS STGHF+QLVWKDT  +GCA+K C  + G YLIC
Sbjct: 281 YPTPEKAVKAWYDEISDYSYSHPSFSFSTGHFSQLVWKDTKHLGCAVKKCGGSVGDYLIC 340

Query: 247 SYNSAGNFDGEYEANVLPL 265
           SY+ AGNF   +  NV P+
Sbjct: 341 SYDPAGNFLRRFGENVAPI 359

>Kwal_14.2409
          Length = 238

 Score =  160 bits (405), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 93/136 (68%), Gaps = 2/136 (1%)

Query: 128 FQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAG 187
           FQS +LE HN+ R LH+    L WS +L  +AQ YA+N YNC+G LIHSG PYGENLA G
Sbjct: 103 FQSQMLETHNRFRDLHDAPA-LRWSSDLQDFAQKYANN-YNCNGTLIHSGSPYGENLALG 160

Query: 188 YTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLICS 247
           +    +  AWY+E+  Y+Y  PGFSE TGHFTQLVWK +  +GCA   C + +G Y ICS
Sbjct: 161 FNTTAAASAWYDEVKFYNYQKPGFSEKTGHFTQLVWKSSIHLGCARIDCGDYYGQYTICS 220

Query: 248 YNSAGNFDGEYEANVL 263
           Y+  GN  G+Y+ NVL
Sbjct: 221 YDPPGNVAGQYQDNVL 236

>CAGL0F05137g 523941..524624 similar to sp|P47032 Saccharomyces
           cerevisiae YJL079c PRY1, start by similarity
          Length = 227

 Score =  159 bits (401), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (67%), Gaps = 4/148 (2%)

Query: 121 QQTDLSDFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGG-- 178
           ++++LS++Q  +L++HNKKR LH++T  L W++ LA  AQ+YAD  Y+C G L H+    
Sbjct: 80  KRSNLSEWQQKMLDQHNKKRELHKDTDSLVWNDNLAILAQSYAD-RYDCSGNLAHNPEFI 138

Query: 179 -PYGENLAAGYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCN 237
              GENLA GY  + ++DAWY+EI  YDYSNP     T HFTQLVWKDT  VGCA K+C 
Sbjct: 139 EAIGENLAVGYDDIDAIDAWYDEIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCG 198

Query: 238 NAWGTYLICSYNSAGNFDGEYEANVLPL 265
                Y++C Y+ AGN+ GE+  NV PL
Sbjct: 199 GDLYNYIVCEYDPAGNWAGEFADNVKPL 226

>AAL178W [9] [Homologous to ScYJL079C (PRY1) - SH; ScYKR013W (PRY2)
           - SH] complement(26881..27498) [618 bp, 205 aa]
          Length = 205

 Score =  156 bits (395), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 72/137 (52%), Positives = 92/137 (67%), Gaps = 2/137 (1%)

Query: 128 FQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAG 187
           F S++L+ HN  R  H    PL W+  L  +AQ YA N   C+G L+HSG P+GENLA G
Sbjct: 71  FASAVLDLHNDYRRRHHAV-PLRWNSTLYTHAQHYA-NRILCNGSLVHSGLPHGENLALG 128

Query: 188 YTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLICS 247
           Y+   +V AWY+EI+EYD+S PGFS +TGHFTQLVW+ T+ VGCA   C   +G Y+IC 
Sbjct: 129 YSPAAAVTAWYDEIAEYDFSTPGFSHATGHFTQLVWRSTTSVGCAYVMCGPCYGLYIICQ 188

Query: 248 YNSAGNFDGEYEANVLP 264
           Y+  GN   +Y ANVLP
Sbjct: 189 YDPPGNVADQYVANVLP 205

>KLLA0D02420g complement(206544..207182) some similarities with
           sp|P36110 Saccharomyces cerevisiae YKR013w PRY2,
           hypothetical start
          Length = 212

 Score =  150 bits (379), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 70/138 (50%), Positives = 92/138 (66%), Gaps = 2/138 (1%)

Query: 127 DFQSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAA 186
           DF++ +L+ HN  R  H+    L W+ ELA  AQ +A N Y C+GQL HS  PYGENLA 
Sbjct: 75  DFKTEILDVHNSLRKKHQ-VSSLVWAPELASRAQNFA-NSYVCNGQLEHSKLPYGENLAL 132

Query: 187 GYTLLGSVDAWYNEISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYLIC 246
           GY    +V AWYNE+  YD++NP F+ +TGHFTQLVWK+TS++GCA   C   +G Y +C
Sbjct: 133 GYNTTSAVLAWYNEVKLYDFNNPQFAANTGHFTQLVWKNTSKLGCAFIRCGQYYGQYTVC 192

Query: 247 SYNSAGNFDGEYEANVLP 264
            Y+  GN  G++  NVLP
Sbjct: 193 EYDPPGNVIGKFSENVLP 210

>KLLA0C01496g complement(113533..114903) some similarities with
           sp|P47032 Saccharomyces cerevisiae YJL079c PRY1,
           hypothetical start
          Length = 456

 Score =  119 bits (298), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 94/160 (58%), Gaps = 26/160 (16%)

Query: 129 QSSLLEEHNKKRALHENTGPLTWSEELAQYAQAYADNHYN-----CDGQLIHSGGPYGEN 183
           + S+L  HN+ RA H++T PL W+EELA YA  Y    +      C+ +L HSGGPYGEN
Sbjct: 298 RESVLNAHNEYRARHQSTNPLVWNEELAAYAYDYTQTLFGSDNDPCNYKLQHSGGPYGEN 357

Query: 184 LAAGY-----TLLGSVDAWYNEISEYDYSN-PGFSES---TGHFTQLVWKDTSQVGCAIK 234
           LAAG       L+G    WY+EI+ YDY+N  G S +    GHFTQLVW  ++ VGC++ 
Sbjct: 358 LAAGTNSDPAALVG---LWYDEINYYDYNNVTGISHNGHDVGHFTQLVWAASTDVGCSVT 414

Query: 235 SCNNAWGTYLICSYNSAGNFD---GE-----YEANVLPLI 266
            C++    YLIC Y+ AGN     G      Y+ NV PL+
Sbjct: 415 KCSSG-SVYLICEYSPAGNVKVVGGNDAYVLYKQNVKPLL 453

>AFR700W [3893] [Homologous to NOHBY] complement(1731981..1733285)
           [1305 bp, 434 aa]
          Length = 434

 Score =  118 bits (296), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 92/160 (57%), Gaps = 24/160 (15%)

Query: 130 SSLLEEHNKKRALHENTGPLTWSEELAQYAQAYAD-----NHYNCDGQLIHSGGPYGENL 184
           S L++ HN KR LHE+T PL W+ +L+ +A +Y       +   C   L HS GPYGEN+
Sbjct: 272 SELVKAHNAKRVLHEDTQPLKWNNKLSDFAYSYVSELVGTSEDPCTYVLKHSNGPYGENI 331

Query: 185 AAGYT-----LLGSVDAWYNEISEYDYSN-PGF---SESTGHFTQLVWKDTSQVGCAIKS 235
           A+G +     +   V++WYNEI +YDY++  G     ++ GHFTQLVW  + +VGCA+  
Sbjct: 332 ASGLSSETPNVTEYVNSWYNEIEDYDYNDIDGIYHRGKAVGHFTQLVWAKSQEVGCAVVY 391

Query: 236 C-NNAWGTYLICSYNSAGNFDGE---------YEANVLPL 265
           C NN  G Y++C Y+  GN +           Y+ NV PL
Sbjct: 392 CSNNGKGIYILCEYHPVGNIEDSTPGKDRYRLYKENVKPL 431

>Kwal_33.13192
          Length = 799

 Score = 95.9 bits (237), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 61/142 (42%), Positives = 81/142 (57%), Gaps = 18/142 (12%)

Query: 130 SSLLEEHNKKRALHENTGPLTWSEELAQYAQAYAD-----NHYNCDGQLIHSGGP--YGE 182
           S++L+EHN KR+LH NT  L W + L+ +A  YA+     N   C G L HS      GE
Sbjct: 633 SAILQEHNLKRSLHINTPDLEWDDGLSAWAYNYANSLSGTNRDVCSGFLQHSSTRDNQGE 692

Query: 183 NLAAGYTLLGS--VDAWYNEISEYDYSN-PGF---SESTGHFTQLVWKDTSQVGCAIKSC 236
           N+A G T   +  VD WY+EIS+YDY +  G     +  GHFTQ+VW  T +VGCA+  C
Sbjct: 693 NIAFGTTSNPNQLVDYWYDEISDYDYDDVTGIYHNGKMVGHFTQMVWASTQKVGCAVVQC 752

Query: 237 NN--AWG---TYLICSYNSAGN 253
           +    +G    YL+C Y  AGN
Sbjct: 753 DTMAKYGQNSIYLLCEYKDAGN 774

>CAGL0C01375g 146471..148522 similar to sp|P40483 Saccharomyces
           cerevisiae YIL108w, start by similarity
          Length = 683

 Score = 29.3 bits (64), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 44/104 (42%), Gaps = 2/104 (1%)

Query: 141 ALHENTGPLTWSEELAQYAQAYADNHYNCDGQLIHSGGPYGENLAAGYTLLGSVDAWYNE 200
           AL +  GP T +E+  Q A  + D H+  DG+LI      G   A     +      Y+ 
Sbjct: 216 ALKKYGGPFTQNEKPVQAACVFLDTHW--DGKLIRGHAALGGGDADIKLAIFGSHGMYSW 273

Query: 201 ISEYDYSNPGFSESTGHFTQLVWKDTSQVGCAIKSCNNAWGTYL 244
            +  +   P F++ T   T+ V  D ++ G   +  N   G ++
Sbjct: 274 PTCMEQLIPYFTDETRASTKEVANDCNECGTHWECLNITLGAFM 317

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.126    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,403,468
Number of extensions: 284402
Number of successful extensions: 674
Number of sequences better than 10.0: 33
Number of HSP's gapped: 643
Number of HSP's successfully gapped: 34
Length of query: 267
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 167
Effective length of database: 13,134,309
Effective search space: 2193429603
Effective search space used: 2193429603
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 60 (27.7 bits)