Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_711.361219121960970.0
YJL080C (SCP160)1222117738340.0
CAGL0M03223g1209117832550.0
Kwal_14.23971206118829910.0
AAL177W1198117129020.0
KLLA0D02398g1205112127830.0
Kwal_27.12486299280950.004
Scas_515.634272820.15
Kwal_14.168939562810.19
KLLA0E00847g713121820.21
Scas_667.637881800.25
CAGL0G04037g778183800.35
YBR233W (PBP2)41354790.39
AER186C316255780.45
KLLA0F10703g417132751.1
YBL032W (HEK2)38195741.3
YLR352W80771713.6
Scas_652.344555713.8
AFR100W61426713.8
AFL099W772149704.8
Scas_628.15576112696.0
Kwal_55.1980421351677.1
AFR186W717175688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_711.36
         (1219 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_711.36                                                          2353   0.0  
YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein...  1481   0.0  
CAGL0M03223g complement(366828..370457) similar to sp|P06105 Sac...  1258   0.0  
Kwal_14.2397                                                         1156   0.0  
AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH] complement(...  1122   0.0  
KLLA0D02398g complement(202446..206063) similar to sp|P06105 Sac...  1076   0.0  
Kwal_27.12486                                                          41   0.004
Scas_515.6                                                             36   0.15 
Kwal_14.1689                                                           36   0.19 
KLLA0E00847g complement(87991..90132) some similarities with sgd...    36   0.21 
Scas_667.6                                                             35   0.25 
CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces c...    35   0.35 
YBR233W (PBP2) [411] chr2 (683385..684626) Protein required for ...    35   0.39 
AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH] (982057..98...    35   0.45 
KLLA0F10703g complement(984298..985551) similar to sp|P38151 Sac...    33   1.1  
YBL032W (HEK2) [162] chr2 (160149..161294) Protein with four KH ...    33   1.3  
YLR352W (YLR352W) [3734] chr12 (831115..833538) Protein containi...    32   3.6  
Scas_652.3                                                             32   3.8  
AFR100W [3292] [Homologous to ScYJL085W (EXO70) - SH] complement...    32   3.8  
AFL099W [3096] [Homologous to ScYPL207W - SH] complement(252709....    32   4.8  
Scas_628.15                                                            31   6.0  
Kwal_55.19804                                                          30   7.1  
AFR186W [3378] [Homologous to ScYLL032C - SH] complement(775246....    31   8.8  

>Scas_711.36
          Length = 1219

 Score = 2353 bits (6097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1170/1219 (95%), Positives = 1170/1219 (95%)

Query: 1    MSVFPEDQNQSIVNESASTMLSVSETDNGXXXXXXXXXXXXXXKPAPVPVPLPSLKDLPS 60
            MSVFPEDQNQSIVNESASTMLSVSETDNG              KPAPVPVPLPSLKDLPS
Sbjct: 1    MSVFPEDQNQSIVNESASTMLSVSETDNGVETAVTTEETASEEKPAPVPVPLPSLKDLPS 60

Query: 61   LGSNSIFANSKVTWGPNMQXXXXXXXXXXXXXXXXXXXXXGAKRMRSKNIQESFTLDLQS 120
            LGSNSIFANSKVTWGPNMQ                     GAKRMRSKNIQESFTLDLQS
Sbjct: 61   LGSNSIFANSKVTWGPNMQPSPPISCSPSLSSSLSPSPVSGAKRMRSKNIQESFTLDLQS 120

Query: 121  QLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATKVQDAKRDLVKQLTRPID 180
            QLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATKVQDAKRDLVKQLTRPID
Sbjct: 121  QLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATKVQDAKRDLVKQLTRPID 180

Query: 181  DVMTVPARCRAAIIGSGGKTIRGISEQYDVTINLARENNPDSYDEDLNDFTANVNFHGDF 240
            DVMTVPARCRAAIIGSGGKTIRGISEQYDVTINLARENNPDSYDEDLNDFTANVNFHGDF
Sbjct: 181  DVMTVPARCRAAIIGSGGKTIRGISEQYDVTINLARENNPDSYDEDLNDFTANVNFHGDF 240

Query: 241  ESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITVPEGVKCNFYRDTAEVNI 300
            ESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITVPEGVKCNFYRDTAEVNI
Sbjct: 241  ESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITVPEGVKCNFYRDTAEVNI 300

Query: 301  SGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTKALKKEFNVIVTFPSDPT 360
            SGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTKALKKEFNVIVTFPSDPT
Sbjct: 301  SGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTKALKKEFNVIVTFPSDPT 360

Query: 361  DELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLAHAKNLALYFTKYPALKD 420
            DELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLAHAKNLALYFTKYPALKD
Sbjct: 361  DELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLAHAKNLALYFTKYPALKD 420

Query: 421  IKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIKFARKELINFVNXXXXXXXXXX 480
            IKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIKFARKELINFVN          
Sbjct: 421  IKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIKFARKELINFVNTITPLDTLTI 480

Query: 481  XXXXYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYSSPEEDFKPSAEEINAEL 540
                YELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYSSPEEDFKPSAEEINAEL
Sbjct: 481  TDLDYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYSSPEEDFKPSAEEINAEL 540

Query: 541  EKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLILEDVSKEEGNLQIKLHT 600
            EKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLILEDVSKEEGNLQIKLHT
Sbjct: 541  EKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLILEDVSKEEGNLQIKLHT 600

Query: 601  PEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIARLVGTKGSNLNEIRE 660
            PEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIARLVGTKGSNLNEIRE
Sbjct: 601  PEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIARLVGTKGSNLNEIRE 660

Query: 661  KFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAKKWADIVTKELVVPQKYHG 720
            KFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAKKWADIVTKELVVPQKYHG
Sbjct: 661  KFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAKKWADIVTKELVVPQKYHG 720

Query: 721  SLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGVKQAFTELSALLDFERENGYKK 780
            SLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGVKQAFTELSALLDFERENGYKK
Sbjct: 721  SLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGVKQAFTELSALLDFERENGYKK 780

Query: 781  IVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETGEVELEITGTRAAIN 840
            IVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETGEVELEITGTRAAIN
Sbjct: 781  IVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETGEVELEITGTRAAIN 840

Query: 841  EAANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDIISKAGGDDIRNKNIDIPN 900
            EAANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDIISKAGGDDIRNKNIDIPN
Sbjct: 841  EAANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDIISKAGGDDIRNKNIDIPN 900

Query: 901  ANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIPEERHGALVGPGGMIRRQL 960
            ANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIPEERHGALVGPGGMIRRQL
Sbjct: 901  ANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIPEERHGALVGPGGMIRRQL 960

Query: 961  ETEFNVILEVPHKNETGPVRITGLPENVEKAEKKILTEIVRDSFDRELSVPASLHEFVSE 1020
            ETEFNVILEVPHKNETGPVRITGLPENVEKAEKKILTEIVRDSFDRELSVPASLHEFVSE
Sbjct: 961  ETEFNVILEVPHKNETGPVRITGLPENVEKAEKKILTEIVRDSFDRELSVPASLHEFVSE 1020

Query: 1021 RGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVRPATEDEKKEQFRAVIEEVG 1080
            RGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVRPATEDEKKEQFRAVIEEVG
Sbjct: 1021 RGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVRPATEDEKKEQFRAVIEEVG 1080

Query: 1081 EPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVEIDEAKKEETLNKVVKMIED 1140
            EPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVEIDEAKKEETLNKVVKMIED
Sbjct: 1081 EPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVEIDEAKKEETLNKVVKMIED 1140

Query: 1141 RVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAADVIINVPRRSDKVNDVIYVR 1200
            RVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAADVIINVPRRSDKVNDVIYVR
Sbjct: 1141 RVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAADVIINVPRRSDKVNDVIYVR 1200

Query: 1201 GTKEGVEKAEALILQALKH 1219
            GTKEGVEKAEALILQALKH
Sbjct: 1201 GTKEGVEKAEALILQALKH 1219

>YJL080C (SCP160) [2834] chr10 complement(285474..289142) Protein
            involved in control of mitotic chromosome transmission,
            contains 14 KH domains which are found in RNA-binding
            proteins such as Mer1p and mouse hnRNP X [3669 bp, 1222
            aa]
          Length = 1222

 Score = 1481 bits (3834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/1177 (62%), Positives = 927/1177 (78%), Gaps = 11/1177 (0%)

Query: 49   PVPLPSLKDLPSLGSNSIFANSKVTWGPNMQXXXXXXXXXXXXXXXXXXXXXGAKRMRSK 108
            P PLPSLKDLPSLGSN+ FAN KV+WGPNM+                     GAKRMRSK
Sbjct: 49   PTPLPSLKDLPSLGSNAAFANVKVSWGPNMKPAVSNSPSPSPSAPSLTTGL-GAKRMRSK 107

Query: 109  NIQESFTLDLQSQLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATKVQDAK 168
            NIQE+FTLDLQSQLSITKPELSRIVQSVK+ ++VSVESTLSKN+RTFL+SGVA  V +AK
Sbjct: 108  NIQEAFTLDLQSQLSITKPELSRIVQSVKKNHDVSVESTLSKNARTFLVSGVAANVHEAK 167

Query: 169  RDLVKQLTRPIDDVMTVPARCRAAIIGSGGKTIRGISEQYDVTINLARENNPDSYDEDLN 228
            R+LVK+LT+PI+ V+ VP++C+A+IIGSGG+TIR IS+ Y+V IN+++E N +SYDED++
Sbjct: 168  RELVKKLTKPINAVIEVPSKCKASIIGSGGRTIREISDAYEVKINVSKEVNENSYDEDMD 227

Query: 229  DFTANVNFHGDFESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITVPEG-- 286
            D T+NV+  GDFESVN+AK +I  IVKEETK  ++++ V+DEK +P+ID+S     EG  
Sbjct: 228  DTTSNVSLFGDFESVNLAKAKILAIVKEETKNATIKLVVEDEKYLPYIDVSEFASDEGDE 287

Query: 287  -VKCNFYRDTAEVNISGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTKAL 345
             VK  FY+ + ++ I GPR+  KATKT +QDYL +L+S L EEK+KIP+KFQFLID + L
Sbjct: 288  EVKVQFYKKSGDIVILGPREKAKATKTSIQDYLKKLASNLDEEKVKIPSKFQFLIDAEEL 347

Query: 346  KKEFNVIVTFPSDPTDELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLAHA 405
            K+++NVIVTFPS P DELVSFVG +DKV EAI +AR++SK++ V+SLDISK+HSKNL HA
Sbjct: 348  KEKYNVIVTFPSTPDDELVSFVGLRDKVGEAITYARSSSKSYVVESLDISKAHSKNLTHA 407

Query: 406  KNLALYFTKYPALKDIKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIKFARKEL 465
            KNL +YFTKY  LK ++E++P VKI LP+   L  A +V I+ISAKS+ AN+IK  RKEL
Sbjct: 408  KNLIMYFTKYSVLKGLEESHPNVKISLPSIQSLPTAETVTIHISAKSDEANDIKAVRKEL 467

Query: 466  INFVNXXXXXXXXXXXXXXYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYSSP 525
            I+FVN              YELF  SIK  LLA+E  V F+Q GDY+P ++SI+L   + 
Sbjct: 468  ISFVNNIPPSETLVITDLDYELFGGSIKHCLLASESSVAFVQFGDYYPNDNSILLVALTE 527

Query: 526  EEDFKPSAEEINAELEKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLILE 585
            +EDFKPS EEI A L K N SL  LR K N M  K Y    ++QD L  PSSAT  LI+E
Sbjct: 528  DEDFKPSIEEIQASLNKANESLNSLRTKQNNMETKTYEFSEEVQDSLFKPSSATWKLIME 587

Query: 586  DVSKEEGNLQIKLHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIA 645
            D+S++EG+LQIKLHTPE N++T+RGD+KA K ANK   SI+ +P+ KSK+TV + +NS+A
Sbjct: 588  DISEQEGHLQIKLHTPEENQLTVRGDEKAAKAANKIFESILNSPSSKSKMTVNIPANSVA 647

Query: 646  RLVGTKGSNLNEIREKFDCQIDVP---NHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAK 702
            RL+G KGSNL +IREKF CQID+P   N++  KDKT E+ LTG EYNL  AKK++AAEAK
Sbjct: 648  RLIGNKGSNLQQIREKFACQIDIPNEENNNASKDKTVEVTLTGLEYNLTHAKKYLAAEAK 707

Query: 703  KWADIVTKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGVKQA 762
            KWADI+TKEL+VP K+HGSLIG +G YRNRLQ+KY+VFINFPRD++IVTIRGPSRGV +A
Sbjct: 708  KWADIITKELIVPVKFHGSLIGPHGTYRNRLQEKYNVFINFPRDNEIVTIRGPSRGVNKA 767

Query: 763  FTELSALLDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKV 822
              EL ALLDFE ENG+K ++ VPAEHVPRIIGK G NINDIRA++GVEMDFLQKSTDPK 
Sbjct: 768  HEELKALLDFEMENGHKMVINVPAEHVPRIIGKNGDNINDIRAEYGVEMDFLQKSTDPKA 827

Query: 823  QETGEVELEITGTRAAINEAANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDI 882
            QETGEVELEITG+R  I +AA +V+ I+ EA+DF +E L +  KYH+ IVGSGGH LR+I
Sbjct: 828  QETGEVELEITGSRQNIKDAAKRVESIVAEASDFVTEVLKIDHKYHKSIVGSGGHILREI 887

Query: 883  ISKAGGDDIRNKNIDIPNANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIP 942
            ISKAGG++IRNK++DIPNA+SE+  ITVQGP+KFV  V+++INKIV+D ENSVTKT++IP
Sbjct: 888  ISKAGGEEIRNKSVDIPNADSENKDITVQGPQKFVKKVVEEINKIVKDAENSVTKTIDIP 947

Query: 943  EERHGALVGPGGMIRRQLETEFNVILEVPHKNE-TGPVRITGLPENVEKAEKKILTEIVR 1001
             ER GAL+GPGG++RRQLE+EFN+ L VP+K++ +G + ITG PENVEKAEKKIL EI+R
Sbjct: 948  AERKGALIGPGGIVRRQLESEFNINLFVPNKDDPSGKITITGAPENVEKAEKKILNEIIR 1007

Query: 1002 DSFDRELSVPASLHEFVSERGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVR 1061
            ++FDRE+ VPAS++E+VSERGAF QKLR++  VNV+ GN S++A +L R+ + IP+EKV 
Sbjct: 1008 ENFDREVDVPASIYEYVSERGAFIQKLRMDLSVNVRFGNTSKKANKLARAPIEIPLEKVC 1067

Query: 1062 PATEDEKKEQFRAVIEEVGEPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVE 1121
             +TE E  E+ +  IEEVG P +  E+GDI  RLTYEPID S +LS+   E KE T    
Sbjct: 1068 GSTEGENAEKTKFTIEEVGAPTSS-EEGDITMRLTYEPIDLSSILSD--GEEKEVTKDTS 1124

Query: 1122 IDEAKKEETLNKVVKMIEDRVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAAD 1181
             D AKKEE L+  VK+I++R+AKA S+T+AGY+W AD R+FN +VGPGGSNIKKIR+AAD
Sbjct: 1125 NDSAKKEEALDTAVKLIKERIAKAPSATYAGYVWGADTRRFNMIVGPGGSNIKKIREAAD 1184

Query: 1182 VIINVPRRSDKVNDVIYVRGTKEGVEKAEALILQALK 1218
            VIINVPR+SDKVNDV+Y+RGTK GVEKA  ++L++L+
Sbjct: 1185 VIINVPRKSDKVNDVVYIRGTKAGVEKAGEMVLKSLR 1221

>CAGL0M03223g complement(366828..370457) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy, hypothetical start
          Length = 1209

 Score = 1258 bits (3255), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/1178 (54%), Positives = 856/1178 (72%), Gaps = 14/1178 (1%)

Query: 45   PAPVPVPLPSLKDLPSL-GSNSIFANSKVTWGPNMQXXXXXXXXXXXXXXXXXXXXXGAK 103
            P P P PLPSLKDLPSL  SNS    +KV WGPNM+                     G  
Sbjct: 43   PKPEPKPLPSLKDLPSLVDSNSFKPATKVEWGPNMKPAAISSSVSPSMSRSASATSAG-- 100

Query: 104  RMRSKNIQESFTLDLQSQLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATK 163
            RMRS NIQE+FTLDLQSQLS+TK ELSRI+Q+VKQA NVSVESTLS+NSRTFLISG A K
Sbjct: 101  RMRSNNIQETFTLDLQSQLSVTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPK 160

Query: 164  VQDAKRDLVKQLTRPIDDVMTVPARCRAAIIGSGGKTIRGISEQYDVTINLARENNPDSY 223
            V++AKR+L+K LTRPI + + VP+RC+A IIGSGGK IR IS++YDV I++++E  PDSY
Sbjct: 161  VKEAKRELIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSY 220

Query: 224  DEDLNDFTANVNFHGDFESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITV 283
            +EDL+D  ++++  GDFESV  AK +I  IV E+ K ++ R+ V+D  +  F+++  ++ 
Sbjct: 221  NEDLDDDLSDISIFGDFESVKQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVS- 279

Query: 284  PEGVKCNFYRDTAEVNISGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTK 343
             + VK  +Y+DT    I+G  DD+K  KT ++DYL +LS+ L EE +KIP+KFQFLID  
Sbjct: 280  SDDVKVQYYQDTGSFTITGSLDDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDAD 339

Query: 344  ALKKEFNVIVTFPSDPTDELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLA 403
             +K  F VIV FP   +DE V F G KDKV EAI+FAR +SK + VDSLDISK+H+KNL 
Sbjct: 340  EVKDRFGVIVKFPKSSSDETVQFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLD 399

Query: 404  HAKNLALYFTKYPALKDIKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIKFARK 463
            HAK L +YF KY  L  + E +P+VK VLP+   L++A  V I +SAK++  +EIK AR+
Sbjct: 400  HAKRLVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSEIKAARR 459

Query: 464  ELINFVNXXXXXXXXXXXXXXYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYS 523
            E+I  VN              YELFH++IK  LL  E +  FIQ+GDYF G+DS+VLF +
Sbjct: 460  EIIAIVNDITPAETLVIDDLDYELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLFAT 519

Query: 524  SPEEDFKPSAEEINAELEKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLI 583
            S +EDFKPS +EI   LEKVNA+L  LR K N +    Y L+++ QD+     S  L LI
Sbjct: 520  STDEDFKPSTDEIKESLEKVNANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVALKLI 579

Query: 584  LEDVSKEEGNLQIKLHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNS 643
            LED+S ++G++QIKLH+PE NK+T+RGD++AVK ANK + SIVENP+  +KITVEV   S
Sbjct: 580  LEDISGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKDIKSIVENPSTTAKITVEVPVAS 639

Query: 644  IARLVGTKGSNLNEIREKFDCQIDVPNHDEI-KDKTAEIVLTGQEYNLEQAKKFIAAEAK 702
            ++RL+G KG+NL ++R K++C ID+P   E  +DKT EI + G ++ +E AKK IA EAK
Sbjct: 640  VSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDIANEAK 699

Query: 703  KWADIVTKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGVKQA 762
            + ADIVTKELV   KYH +L G  G+YR RLQ+KY+VFINF ++++ +TI+GPSRGV +A
Sbjct: 700  RLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLKENNTITIKGPSRGVNKA 759

Query: 763  FTELSALLDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKV 822
            + EL ALLDFE ENG+K IV VP EH+ RIIGK G  IN +  +FGVE+DFLQKS DPK 
Sbjct: 760  YDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQKSDDPKA 819

Query: 823  QETGEVELEITGTRAAINEAANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDI 882
             ETG VELEITG R AI EA+ K+  I+ EAAD  +E L + RKYH+ IVG+GGH LR+I
Sbjct: 820  VETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTEKLDIDRKYHKTIVGAGGHTLREI 879

Query: 883  ISKAGGDDIRNKNIDIPNANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIP 942
            IS AGGD++R + +DIPNA+SES +IT+QGPKKFV++V+K INKIVE+ +NS+TK +E+P
Sbjct: 880  ISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVEESQNSITKKIEVP 939

Query: 943  EERHGALVGPGGMIRRQLETEFNVILEVPHKNETGP-VRITGLPENVEKAEKKILTEIVR 1001
             ER GAL+GPGG++R+QLE+EFN+ L VP ++E    V +TGLPEN+EKAEKKI TEI+R
Sbjct: 940  GERLGALIGPGGIVRKQLESEFNIQLYVPKRDEEETRVSLTGLPENIEKAEKKIFTEIIR 999

Query: 1002 DSFDRELSVPASLHEFVSERGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVR 1061
            D+FD E+ VPA++  +VS+RG   Q+LR+E+FVNV++GNA+++A  LNR+ V IP EKV 
Sbjct: 1000 DNFDLEIMVPANVQNYVSDRGNLPQRLRLEKFVNVRYGNATKKANNLNRTPVDIPYEKVA 1059

Query: 1062 PATEDEKKEQFRAVIEEVGEPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVE 1121
             A    + E+ +  +EE G    +  DG+IPWRL YEPIDF  +L E++ E KEA+    
Sbjct: 1060 GA----EGEKVKFTVEETGPSVVENVDGEIPWRLIYEPIDFDSILDEENGEKKEAS---- 1111

Query: 1122 IDEAKKEETLNKVVKMIEDRVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAAD 1181
            +DE KK++ L +  ++IE+R+  A ++T++GY+W +DP KF KVVG GGSN+KKIR++ +
Sbjct: 1112 VDENKKQQLLKEAKEIIENRINDAPNATYSGYVWTSDPSKFFKVVGMGGSNVKKIRESTN 1171

Query: 1182 VIINVPRRSDKVNDVIYVRGTKEGVEKAEALILQALKH 1219
             I+ VP++SDK+N+VI+++G KE VEKA   I+++LK 
Sbjct: 1172 CIVYVPKKSDKINNVIFIKGAKENVEKAGEAIIKSLKQ 1209

>Kwal_14.2397
          Length = 1206

 Score = 1156 bits (2991), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/1188 (49%), Positives = 818/1188 (68%), Gaps = 34/1188 (2%)

Query: 45   PAPVPVPLPSLKDLPSLGSNSIFAN-SKVTWGPNMQXXXXXXXXXXXX------XXXXXX 97
            P   P PLPS KD P+LGS +  A  SKV+WGPNM+                        
Sbjct: 40   PEQAPKPLPSKKDFPTLGSGAFLAAASKVSWGPNMKTQTASSASGASSTSNSAVQSRSTT 99

Query: 98   XXXGAKRMRSKNIQESFTLDLQSQLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLI 157
                AK  RSK IQE+F+LDLQSQ+S++KP+ SRI+Q +K  ++VSVESTLSK+SRTFLI
Sbjct: 100  PALSAKPARSKTIQEAFSLDLQSQISMSKPDFSRIIQGIKTTHSVSVESTLSKSSRTFLI 159

Query: 158  SGVATKVQDAKRDLVKQLTRPIDDVMTVPARCRAAIIGSGGKTIRGISEQYDVTINLARE 217
             G    V+ A+R++VK+LT+P+   + VP++ R+AIIG+GGK IR ISE  +V I++ +E
Sbjct: 160  FGKPQDVKAARREIVKKLTKPVTVTIEVPSKTRSAIIGAGGKKIREISEPLEVRIDIGKE 219

Query: 218  NNPDSYDEDLNDFTANVNFHGDFESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFID 277
               D+YDEDL+D   +V+ HGD ESV +A+++I  IVKE+TK  S++V V+D+ ++PFI+
Sbjct: 220  IKEDTYDEDLDDSMVDVSIHGDLESVRIAQQKISAIVKEDTKNASIQVNVEDKNLVPFIN 279

Query: 278  LSAITVPEGVKCNFYRDTAEVNISGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQ 337
            L  + +P  V   F   + ++ +SG RD+V+A K  +  YL +LSS +   K+KIP KFQ
Sbjct: 280  LEGLKLP--VDAKFNTASGQIQLSGLRDEVQAAKANILQYLRELSSQIKTLKVKIPVKFQ 337

Query: 338  FLIDTKALKKEFNVIVTFPSDPTDELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKS 397
            FLID   +K++FNV V  P+   +E VSFVG    + EA++FAR NSK + V+SL+ISK+
Sbjct: 338  FLIDESEIKEKFNVTVHLPTAGGEE-VSFVGPAVHLDEAVSFARENSKKYIVESLEISKA 396

Query: 398  HSKNLAHAKNLALYFTKYPALKDIKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANE 457
            H KN+AHAKN+A+YF  Y  L+ IK+A+P V+  +P+P  L+DA +V I IS  SE+A++
Sbjct: 397  HGKNVAHAKNIAIYFEIYNVLEPIKKAFPNVRFAIPSPQELQDADAVAIRISTTSENADD 456

Query: 458  IKFARKELINFVNXXXXXXXXXXXXXXYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDS 517
            +K  RK++IN VN              YEL+ K IK  LL  +    F+QLGD+FPGND 
Sbjct: 457  LKTVRKDIINLVNELPTSQVLVVEDLDYELYSKDIKHLLLQQQQNADFVQLGDFFPGNDK 516

Query: 518  IVLFYSSPEEDFKPSAEEINAELEKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSS 577
            I+LF    +EDF+PS +E+   L  VN++LEPLRAK + ++ K++ + ++ QD    PS+
Sbjct: 517  ILLFARLSDEDFRPSDDELKQTLADVNSALEPLRAKQSNLSLKIFEIPSEKQDAFFKPST 576

Query: 578  ATLHLILEDVSKEEGNLQIKLHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITV 637
             T  LI +D++ E G+ Q KLH P A+++TIRGD KAVK A  A+ SIV N  +K +   
Sbjct: 577  FTRELIEQDIATEGGHAQFKLHAPTADQLTIRGDTKAVKVATAAIESIVANSGEKFETKF 636

Query: 638  EVASNSIARLVGTKGSNLNEIREKFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFI 697
             V+SNS+ RL+G+KG+NLN IREK+ C IDV    E      E+ +TG +Y++E AK ++
Sbjct: 637  AVSSNSVPRLIGSKGANLNAIREKYQCNIDVAQ--ESSGNQTEVTVTGLKYSVEHAKAYL 694

Query: 698  AAEAKKWADIVTKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINFPR--DSDIVTIRGP 755
             +E+KKWAD++TKEL V  KY G LIG+ G YRNRLQ KYSV I+FP   +++ VTIRGP
Sbjct: 695  LSESKKWADVITKELNVLPKYRGRLIGSQGTYRNRLQTKYSVHIHFPMEGENEGVTIRGP 754

Query: 756  SRGVKQAFTELSALLDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQ 815
            SRGV +A+ EL ALLDFE ENG+  I+ VP EHVPRIIGK G NINDIRAD GVE+DFLQ
Sbjct: 755  SRGVAKAYDELKALLDFEIENGHTSIITVPTEHVPRIIGKNGDNINDIRADCGVELDFLQ 814

Query: 816  KSTDPKVQETGEVELEITGTRAAINEAANKVQEIIDEAADFDSETLSVARKYHRIIVGSG 875
            K+TDPK  ETG+VELEITG+R AI EA  KV+ I+ EA+D ++E+  V  KY R IVG+G
Sbjct: 815  KTTDPKAVETGKVELEITGSRQAIKEATQKVEAIVKEASDVETESFEVNPKYIRDIVGAG 874

Query: 876  GHNLRDIISKAGGDDIRNKNIDIPNANSESDVITVQGPKKFVASVLKQINKIVEDGENSV 935
            G  L+ +ISKAGGD+IRNK++DIP+ANS+   IT+QGP  FV +++K+I  I+++ E+SV
Sbjct: 875  GRVLKSLISKAGGDEIRNKSVDIPDANSQDKKITIQGPHAFVQTMVKEIKLIIKEREDSV 934

Query: 936  TKTLEIPEERHGALVGPGGMIRRQLETEFNVILEVPH-KNETGPVRITGLPENVEKAEKK 994
             K L++P +R GAL+GPGGM+RRQLE+EFN+ L +P   +++  V+I GLP+N+   EKK
Sbjct: 935  EKELDVPADRVGALIGPGGMVRRQLESEFNIKLSLPDIGDKSSKVKILGLPDNIAACEKK 994

Query: 995  ILTEIVRDSFDRELSVPASLHEFVSERGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVV 1054
            I T+++RDS D E+ VPASLHEFVSE+GA  Q+LR + FVNV+ GN++ +A +L RSN+ 
Sbjct: 995  IFTQLIRDSCDAEVQVPASLHEFVSEKGALIQRLRSDYFVNVRFGNSNGKANKLARSNLN 1054

Query: 1055 IPVEKVRPATEDEKK---EQFRAVIEEVGEPRNDKEDGDIPWRLTYEPIDFSEVLSEDSD 1111
            IPVEK     E+  K   E+    IEE          G IPWRL+YEP+D S++L+E+  
Sbjct: 1055 IPVEKATGTAEESIKFTTEEIPLAIEE--------SQGFIPWRLSYEPVDLSDILTEEE- 1105

Query: 1112 ETKEATPKVEIDEAKKEETLNKVVKMIEDRVAKAASSTFAGYIWCADPRKFNKVVGPGGS 1171
                   K    E KKEE L  V K+I+DR+  A  ++  GY+W +   +F KVVG  GS
Sbjct: 1106 -------KANEKEPKKEEVLETVEKLIKDRIELATKASTVGYLWSSKSSEFRKVVGSMGS 1158

Query: 1172 NIKKIRDAADVIINVPRRSDKVNDVIYVRGTKEGVEKAEALILQALKH 1219
            NIKKIR+A   +INVP+++DKV+D+IY+RGTKEGV+KA  +I Q LK+
Sbjct: 1159 NIKKIREATGTLINVPKKNDKVSDIIYIRGTKEGVQKASEMITQKLKN 1206

>AAL177W [10] [Homologous to ScYJL080C (SCP160) - SH]
            complement(27774..31370) [3597 bp, 1198 aa]
          Length = 1198

 Score = 1122 bits (2902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1171 (50%), Positives = 799/1171 (68%), Gaps = 26/1171 (2%)

Query: 49   PVPLPSLKDLPSLGSNSIFANSKVTWGPNMQXXXXXXXXXXXXXXXXXXXXXGAKRMRSK 108
            P  +P+  D P L S+ IF   KV WGPNM+                      AK MRSK
Sbjct: 50   PKRMPTRADFPPL-SSVIFETQKVQWGPNMKKPESQSASPSPSPGPVGSG---AKPMRSK 105

Query: 109  NIQESFTLDLQSQLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVATKVQDAK 168
             +QE+F+LDLQ+Q++I+K E S+ V SVKQ+++VS+ESTLSK SRTFLI+G  T V +AK
Sbjct: 106  TMQEAFSLDLQTQVTISKAEFSKFVVSVKQSHSVSIESTLSKLSRTFLITGSPTNVYNAK 165

Query: 169  RDLVKQLTRPIDDVMTVPARCRAAIIGSGGKTIRGISEQYD-VTINLARENNPDSYDEDL 227
            R+LVK+LTRP+  V+ VP++  ++IIG GG+ IR I+     + I++A+    D+YD DL
Sbjct: 166  RELVKKLTRPVTVVIQVPSKTVSSIIGPGGRMIREITNAAGGIKIDIAKTAEADAYDADL 225

Query: 228  NDFTANVNFHGDFESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAITVPEGV 287
            +D   N++ HGD  SVN AK +I  IVKEETK  ++ V V+++++IPFI L+ + + E V
Sbjct: 226  DDQLINISLHGDVASVNFAKDKILSIVKEETKNATISVAVENKQLIPFISLADVEISEDV 285

Query: 288  KCNFYRDTAE-VNISGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFLIDTKALK 346
                + + +E + + GPRD+ K  K  VQ+YLN L+S ++E+KI IP KFQ LID + ++
Sbjct: 286  TVKAFPNGSEKIVLMGPRDEAKEAKVNVQNYLNTLASKVSEKKISIPRKFQPLIDAEDVR 345

Query: 347  KEFNVIVTFPSDPTDELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHSKNLAHAK 406
            +++ V V FP+   D+ VSF G    + +AIA+AR +SK + V+SL++SK+H KN+AHAK
Sbjct: 346  EKYKVSVIFPTALGDDTVSFYGLSANLDDAIAYARQSSKQYIVESLEVSKAHGKNVAHAK 405

Query: 407  NLALYFTKYPALKDIKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIKFARKELI 466
            NL  YF KY  LKDIKE++ EVK+VLP P  L    +V INI +K++ A + K  RK++I
Sbjct: 406  NLMFYFAKYDILKDIKESFKEVKLVLPTPEELPGLDNVSINIISKADIAEQTKTVRKQII 465

Query: 467  NFVNXXXXXXXXXXXXXXYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIVLFYSSPE 526
            N VN              YELFHK IK  L   E  +PF+QLGD++ G+++++LF    E
Sbjct: 466  NIVNRLTPSHVLAVDDLDYELFHKDIKQALSKAE--IPFVQLGDHYEGDNTVLLFAKVDE 523

Query: 527  EDFKPSAEEINAELEKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSATLHLILED 586
            EDF+PS EE+   LEKV A L+ +R K +K+  K+   DA+ Q    S  S T +L+LE+
Sbjct: 524  EDFQPSPEEVKEHLEKVAAVLDEVRTKQSKLFTKIVNFDAEFQVLHFSDDSVTWNLVLEN 583

Query: 587  VSKEEGNLQIKLHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIAR 646
            ++   G+ QIKLHTP  +++TIRGD+KAVK A KA  SI ENP+KKSK+TV V +N+++R
Sbjct: 584  ITSAGGHAQIKLHTPSEDEITIRGDEKAVKAAVKAFESIAENPSKKSKLTVSVPANTVSR 643

Query: 647  LVGTKGSNLNEIREKFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAKKWAD 706
            L+G KG+NL +IR+KFD QIDVP+  E  D   EI LTG EYNL+ AK  IA+EAKKWAD
Sbjct: 644  LIGPKGTNLAQIRQKFDVQIDVPS--ESNDTNTEITLTGLEYNLQHAKTHIASEAKKWAD 701

Query: 707  IVTKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGVKQAFTEL 766
            I TKEL+VP KYHGSLIG+ G YR RL++KYSV I FP++ ++VTI+GPSRGV +A  EL
Sbjct: 702  ITTKELIVPTKYHGSLIGSQGTYRIRLENKYSVRIQFPKEGEVVTIKGPSRGVNKAHAEL 761

Query: 767  SALLDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETG 826
             ALLDFE ENG+K ++ VP EHVPR+IGK G  IN IRA+ GVE+  LQ +   K Q   
Sbjct: 762  KALLDFEIENGHKSVINVPVEHVPRVIGKNGDVINGIRAELGVELKLLQNTKTAKEQNLD 821

Query: 827  EVELEITGTRAAINEAANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLRDIISKA 886
             V+LEITG+R AI EA+  V  II EA+DF ++ L +  KYH++IVG GG  L+D ISKA
Sbjct: 822  TVQLEITGSRQAIKEASKAVDAIIAEASDFTTKQLEIDAKYHKLIVGPGGSTLKDFISKA 881

Query: 887  GGDDIRNKNIDIPNANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIPEERH 946
            GGDDIRNK +D+PNA S + VIT+ GPK FV  + K +N+IV+D + SV K L IP +R 
Sbjct: 882  GGDDIRNKTVDVPNAESTNKVITISGPKTFVEKMSKALNQIVQDIKASVAKELNIPADRQ 941

Query: 947  GALVGPGGMIRRQLETEFNVILEVPHKNETGPVRITGLPENVEKAEKKILTEIVRDSFDR 1006
            GAL+GPGG +RRQLE++FNV +EVP K + G V I G PE VEK EK+I + I+RDS+D+
Sbjct: 942  GALIGPGGSVRRQLESQFNVRIEVPDKGKEGKVTIHGRPEAVEKCEKEIFSTIIRDSYDQ 1001

Query: 1007 ELSVPASLHEFVSERGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPVEKVRPATED 1066
            E+ VPA  H FVSERG    KLR+  F+NVKHGN+S++A +L+RS   IP+E+VR +   
Sbjct: 1002 EIMVPAVYHAFVSERGQLINKLRMTYFINVKHGNSSKKANKLSRSEQPIPIERVRGS--- 1058

Query: 1067 EKKEQFRAVIEEVGEPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEATPKVEIDEAK 1126
             + E  +  IEEV  P     D +IPWRLTYE +D S++L E   E K A          
Sbjct: 1059 -EGEGTKLTIEEVSAPEASAND-NIPWRLTYEHVDLSDILGE---EGKHAM--------T 1105

Query: 1127 KEETLNKVVKMIEDRVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIRDAADVIINV 1186
            KE+ L      I++R+  A  +   GY+WC + +KFNKVVGPGGSNIK+IR+  + +INV
Sbjct: 1106 KEQALEAAADQIKERIELAPKANCIGYLWCENVKKFNKVVGPGGSNIKQIRETTNTLINV 1165

Query: 1187 PRRSDKVNDVIYVRGTKEGVEKAEALILQAL 1217
            P++SDKV+D+IYVRGTKE VEKA  +I  AL
Sbjct: 1166 PKKSDKVSDIIYVRGTKESVEKACKMICDAL 1196

>KLLA0D02398g complement(202446..206063) similar to sp|P06105
            Saccharomyces cerevisiae YJL080c SCP160 required for
            maintenance of exact ploidy singleton, start by
            similarity
          Length = 1205

 Score = 1076 bits (2783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/1121 (50%), Positives = 766/1121 (68%), Gaps = 23/1121 (2%)

Query: 102  AKRMRSKNIQESFTLDLQSQLSITKPELSRIVQSVKQAYNVSVESTLSKNSRTFLISGVA 161
            AK +RS+NIQE F+LDL +Q  ITK E S IVQSVKQ Y+VSVESTLSK SRTFLISG +
Sbjct: 104  AKPLRSRNIQEVFSLDLDAQYQITKTEFSSIVQSVKQKYDVSVESTLSKTSRTFLISGSS 163

Query: 162  TKVQDAKRDLVKQLTRPIDDVMTVPARCRAAIIGSGGKTIRGISEQYDVTINLARENNPD 221
             K+  AKR+LVK+LT+P++    VP++ R+AIIGSGGKTIR IS+   V I + +E +  
Sbjct: 164  DKIGLAKRELVKKLTKPVNVTFEVPSKTRSAIIGSGGKTIRAISDAAGVKIVVPKEVDEG 223

Query: 222  SYDEDLNDFTANVNFHGDFESVNMAKRRIEEIVKEETKTLSLRVPVKDEKIIPFIDLSAI 281
            +YD DL D++  ++ HGD ESV +AK +I ++VKEETK   + +PV+D K++PFIDL ++
Sbjct: 224  TYDSDLEDYSVTISLHGDAESVLVAKSKILDVVKEETKNAKIVLPVEDSKLVPFIDLESV 283

Query: 282  TVPEGVKCNFY--RDTAEVNISGPRDDVKATKTGVQDYLNQLSSTLTEEKIKIPTKFQFL 339
             +P  VK   +   D AE+ ++GPRD+VK  K  V +YLN+L   +  +K K+P KF  L
Sbjct: 284  EIPADVKAQLFTNNDPAEIALNGPRDNVKLAKVKVINYLNELGLKIVVKKEKVPFKFHPL 343

Query: 340  IDTKALKKEFNVIVTFPSDPTDELVSFVGQKDKVTEAIAFARANSKTFTVDSLDISKSHS 399
            +    L ++F+V V  PS   D+   F+G  D V EAI +A+ +SK  TV+SL+ISK+H 
Sbjct: 344  VKPSELNEKFHVEVQAPSISGDDQFVFIGSSDNVNEAIVYAKNSSKFHTVESLEISKAHG 403

Query: 400  KNLAHAKNLALYFTKYPALKDIKEAYPEVKIVLPAPSLLKDAASVVINISAKSESANEIK 459
            KN+ HAKNL LYF KY  L  I E +P+V++VLP    +    SV I + + +++A+ IK
Sbjct: 404  KNVKHAKNLILYFQKYNVLDQITEDFPQVQVVLPKVESIPALESVSITLISNNDAADAIK 463

Query: 460  FARKELINFVNXXXXXXXXXXXXXXYELFHKSIKSTLLATEDKVPFIQLGDYFPGNDSIV 519
              RK+++  VN              Y LFHK IK  L++TE  VPFIQLGD FPGND I+
Sbjct: 464  TVRKQIVALVNELSPEQTLTISDLDYHLFHKDIKQILVSTESDVPFIQLGDCFPGNDDIL 523

Query: 520  LFYSSPEEDFKPSAEEINAELEKVNASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPSSAT 579
            L     E+DFKPS +E+  +LE VN  LEP+R K + + + V +L  K QD+LL  S  T
Sbjct: 524  LITKINEDDFKPSDDELKVKLESVNQQLEPIRKKQSLLASNVVSLAKKEQDELLGESKVT 583

Query: 580  LHLILEDVSKEEGNLQIKLHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEV 639
            L+LI E VS    +  IKL TP  N++TIRGDD   K A+ A+ SIVEN + +SKIT +V
Sbjct: 584  LNLINEAVSHAGAHALIKLSTPSVNQITIRGDDHGCKIASAAVKSIVENSSTESKITFQV 643

Query: 640  ASNSIARLVGTKGSNLNEIREKFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFIAA 699
             +N ++RL+G KG+NL +IREKFD Q  +P     KD+  ++ LTG +YNL+QAK +I A
Sbjct: 644  PTNVVSRLIGPKGANLQQIREKFDVQTFIPQDS--KDENTDVTLTGLQYNLDQAKTYILA 701

Query: 700  EAKKWADIVTKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINFPRDSDIVTIRGPSRGV 759
            EAKKW+DI+TKEL+VP KYH +L G  G YR RL++KYSVFI FP+DS++VTIRGPSRGV
Sbjct: 702  EAKKWSDIITKELIVPMKYHRTLSGPQGTYRIRLENKYSVFIRFPKDSELVTIRGPSRGV 761

Query: 760  KQAFTELSALLDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTD 819
            K A+ EL ALLDFE ENG+K+++ VP ++V R+IGK+G  INDI+A++GVE++FL K+  
Sbjct: 762  KAAYDELKALLDFEIENGHKELLKVPVDYVTRVIGKSGETINDIKAEYGVELNFLDKTDS 821

Query: 820  PKVQETGEVELEITGTRAAINEAANKVQEIIDEAADFDSETL-SVARKYHRIIVGSGGHN 878
             K +E GEVELEITG+R++I EAANKV+ IID+A++F++ TL  +  KY+  I+G  G  
Sbjct: 822  EKAKEAGEVELEITGSRSSIKEAANKVKSIIDQASNFETVTLEDIDSKYYSDIIGRSGSQ 881

Query: 879  LRDIISKAGGDDIRNKNIDIPNANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKT 938
            L++IISKAGGD+IRNK ++IP+A+SE  VIT+ GP  FV  V+KQI  +V   ENS+T+ 
Sbjct: 882  LKEIISKAGGDEIRNKRVNIPDASSEDKVITIFGPSDFVKKVVKQIKGVVSGLENSITEE 941

Query: 939  LEIPEERHGALVGPGGMIRRQLETEFNVILEVPHKNETG-PVRITGLPENVEKAEKKILT 997
            L IP+E+ GAL+GP G +RR+LETEF V + VP+KN +   V ++G P N+E  +KKI  
Sbjct: 942  LNIPQEKFGALIGPAGSVRRELETEFKVRIHVPNKNSSDEKVTVSGSPANIESCKKKIEK 1001

Query: 998  EIVRDSFDRELSVPASLHEFVSERGAFTQKLRIEEFVNVKHGNASRRATRLNRSNVVIPV 1057
            EI+RDSFD E++VPA  H +VS  G   Q LR E  ++V HGN +R A  L+R+N  +P 
Sbjct: 1002 EIIRDSFDLEIAVPAKYHSYVSNSGLIFQTLRNEFSIDVSHGNLTRTAQSLSRANYKVP- 1060

Query: 1058 EKVRPATEDEKKEQFRAVIEEVGEPRNDKEDGDIPWRLTYEPIDFSEVLSEDSDETKEAT 1117
            E V     +      ++V E   E + D     IPWRLTY PID S+VL ED  +     
Sbjct: 1061 ENVAGGENESSNVLIQSVTET--EAKVDT----IPWRLTYSPIDLSDVLGEDYKK----- 1109

Query: 1118 PKVEIDEAKKEETLNKVVKMIEDRVAKAASSTFAGYIWCADPRKFNKVVGPGGSNIKKIR 1177
                 DE  K++ L K  K+IEDR+A+A      G++W  D +KFN +VGP G NI++IR
Sbjct: 1110 -----DEESKDQVLEKASKLIEDRIAEAKLVNTEGFVWSKDAKKFNSIVGPNGRNIREIR 1164

Query: 1178 DAADVIINVPRRSDKVNDVIYVRGTKEGVEKAEALILQALK 1218
            +A   +I+VPR+SDKVN+VIYV G++EGV+KA  LI + LK
Sbjct: 1165 NATKTVIHVPRKSDKVNNVIYVLGSEEGVKKAAELICKRLK 1205

>Kwal_27.12486
          Length = 299

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 115/280 (41%), Gaps = 61/280 (21%)

Query: 769 LLDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETGEV 828
           + + E ++     V+V  +   RIIG  G  I  IR    V++        P  +   + 
Sbjct: 1   MAELENQDTISHRVLVSLKEAARIIGAQGMTIQKIRESSNVKIGI-----SPHERGCSDR 55

Query: 829 ELEITGTRAAINEAANKVQEIIDE------------------------------AADFDS 858
            L  +G+  A+  A   V E++++                              A    +
Sbjct: 56  ILSCSGSAQAVANAIGDVVEVLNQDESEPETHSYKPLNFILPRPSEVEIQDPESAKRIGN 115

Query: 859 ETLSVARKYHRIIVGSGGHNLRDIISKAGGDDIRNKNIDIPNANSESDVITVQGPKKFVA 918
             L V+      I+G+ G  ++ +I K G   + +KN  +P+  S+  V+ +QG    +A
Sbjct: 116 LRLIVSNSQVSSIIGTQGSRIKALIEKHGVKVVASKNF-LPD--SQDRVVEIQGFPGSIA 172

Query: 919 SVLKQINKIV-----------------EDGENSVTKTLEIPEERHGALVGPGG----MIR 957
           S + +I++++                    E SVTK + IP E  GAL+G GG     +R
Sbjct: 173 SCIIEISELLATETKPSHEKQYYPHTKSQEEGSVTKEVAIPVEFVGALLGRGGNRVSSLR 232

Query: 958 RQLETEFNVILEVPHKNETGPVRITGLPEN-VEKAEKKIL 996
           +  +T+  ++ + P++       ITG  +N V+ AE  +L
Sbjct: 233 KYTKTKV-IVSDEPNEENNRVFTITGNNQNSVKLAETMLL 271

>Scas_515.6
          Length = 342

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 708 VTKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINF--PRDSD---IVTIRGPSRGVKQA 762
           +TK +  P KY   +IG  G Y N L++  S  I    P D +   I++IRGP   V  A
Sbjct: 266 ITKVVTYPDKYSSKVIGREGTYINMLRESTSCSIRLKSPDDKEDLAIISIRGPPLCVDAA 325

Query: 763 FTELSALLDFER 774
              ++  ++  +
Sbjct: 326 LLLIAHRIELSK 337

>Kwal_14.1689
          Length = 395

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 7/62 (11%)

Query: 1160 RKFNKVVGPGGSNIKKIRDAADVIINVPRRSDKVND----VIYVRGTKEGVEKAEALILQ 1215
            ++ + VVGPGG  I ++++  +  INV   SD +      VI++RG  E V K   +I++
Sbjct: 68   KQASMVVGPGGEKISRMKEKTNTRINV---SDNIRGVPERVIFIRGRCEDVAKVFGMIVR 124

Query: 1216 AL 1217
            A+
Sbjct: 125  AI 126

>KLLA0E00847g complement(87991..90132) some similarities with
           sgd|S0003955 Saccharomyces cerevisiae YLL032c,
           hypothetical start
          Length = 713

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 49/121 (40%), Gaps = 19/121 (15%)

Query: 649 GTKGSNLNEIREKFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAKKWADIV 708
           G K   L +I ++  C I + N     D +  +++  Q  + +Q +   +   ++     
Sbjct: 395 GKKNGKLMKIMDRKKCAISLEN-----DSSGHMLVILQGEDWQQIQDSFSLLLQELP--C 447

Query: 709 TKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINFPRD------------SDIVTIRGPS 756
            K   +P+ YH  +IG  G     +  KY+VFI F                D V IR PS
Sbjct: 448 EKSFFIPEAYHRPVIGTGGSVIQTIMRKYNVFIQFSNSFQLPQGDWTFTRYDNVIIRCPS 507

Query: 757 R 757
           +
Sbjct: 508 K 508

>Scas_667.6
          Length = 378

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 9/81 (11%)

Query: 162 TKVQDAKR-DLVKQLTRPIDDV----MTVPARCRAAIIGSGGKTIRGISEQYDVTINLAR 216
           TK QDA   +L  Q+  P+D +    + VP R  ++IIG GG  I+ + E Y V I  ++
Sbjct: 137 TKKQDANEANLEDQV--PVDKIGNLRLIVPNRHLSSIIGKGGVRIKALIETYGVKIVASK 194

Query: 217 ENNPDSYDE--DLNDFTANVN 235
              PDS +   ++  F A+++
Sbjct: 195 HFLPDSSERVLEIQGFPASIS 215

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 47/99 (47%), Gaps = 6/99 (6%)

Query: 782 VVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETGEVELEITGTRAAINE 841
           ++VP  H+  IIGK G  I  +   +GV++     ++   + ++ E  LEI G  A+I++
Sbjct: 161 LIVPNRHLSSIIGKGGVRIKALIETYGVKI----VASKHFLPDSSERVLEIQGFPASISK 216

Query: 842 AANKVQEIIDEAADFDSETLSVARKYHRIIVGSGGHNLR 880
              ++ EI+    D D   +     Y  +   S G N R
Sbjct: 217 VLIEISEIL--LNDVDINFIPEKHYYPHLKHQSNGFNTR 253

>CAGL0G04037g 383068..385404 similar to tr|Q07834 Saccharomyces
           cerevisiae YLL032c, hypothetical start
          Length = 778

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 74/183 (40%), Gaps = 23/183 (12%)

Query: 649 GTKGSNLNEIREKFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQAKKFIAAEAKKWADIV 708
           G K   L  I EK   Q+D+   ++ K+    I+ + +  NLE A   +  E        
Sbjct: 399 GKKNGKLTRIMEKSQAQLDLNFEEDDKNMFLSII-SNKVNNLESAFTLLLDELP-----C 452

Query: 709 TKELVVPQKYHGSLIGANGVYRNRLQDKYSVFINF------PRDS------DIVTIRGP- 755
                +P+ YH   IG+ G        K++VFI F      P+        D V IR P 
Sbjct: 453 EGTFFIPEVYHRPAIGSGGSIIQTTMRKHNVFIQFSNTFLLPQSGLSFVRFDNVIIRCPF 512

Query: 756 --SRGVKQAFTELSALL-DFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMD 812
              +G+  A  +L  L+ ++  +     I + PA++   ++ +    I  +     V +D
Sbjct: 513 KNRKGIDLAIEDLKVLIQEYSEQQPSTNIRLSPAQY-KHVLFEHINTIGHLEKQNNVFLD 571

Query: 813 FLQ 815
           F Q
Sbjct: 572 FPQ 574

>YBR233W (PBP2) [411] chr2 (683385..684626) Protein required for
            proper chromosome segregation during meiosis, confers
            resistance to the antimalarial drug mefloquine when
            overproduced, contains KH RNA-binding domains [1242 bp,
            413 aa]
          Length = 413

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 1165 VVGPGGSNIKKIRDAADVIINVPRRSDKVND-VIYVRGTKEGVEKAEALILQAL 1217
            +VG  G+ I +I+      IN+      V + ++YVRGT + V KA  +I++AL
Sbjct: 81   IVGHKGATISRIKSETSARINISNNIRGVPERIVYVRGTCDDVAKAYGMIVRAL 134

>AER186C [2688] [Homologous to ScYBL032W (HEK2) - SH]
           (982057..983007) [951 bp, 316 aa]
          Length = 316

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 102/255 (40%), Gaps = 74/255 (29%)

Query: 791 RIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETGEVELEITGTRAAINEAANKVQEII 850
           RI+G+ G  I++IR   GV++    K      +   +  LE+TG   +I+  AN + +++
Sbjct: 46  RILGRGGNTIDNIRKANGVKIGISTKE-----KSCSDRLLEVTG---SIDAVANSLADVV 97

Query: 851 ----------------------------------DEAAD------FDSETLSVARKYHRI 870
                                             DEA D        +  L V       
Sbjct: 98  KVLTADDTNEEDAEPEPEQHIFKHLNFILPPPSPDEAEDPMKVKQIGNLRLIVTNSQVSS 157

Query: 871 IVGSGGHNLRDIISKAGGDDIRNKNIDIPNANSESDVITVQGPKKFVASVLKQINK-IVE 929
           I+G+ G  ++ +I       + +K   +P+  S+  ++ +QG    +A+ +K I++ +++
Sbjct: 158 IIGTAGSKIKKLIDTHSSKLVVSKTF-LPD--SQDRILEIQGFPNSIANCIKDISQTLIK 214

Query: 930 DG-----------------ENSVTKTLEIPEERHGALVGPGG----MIRRQLETEFNVIL 968
           D                  +  VT T+ IP E  GAL+G GG     +R+   T+  V  
Sbjct: 215 DDVLDTKEKRYYPHSKHSKDIHVTATVAIPAEYVGALLGHGGNRIANLRKYTRTKITVAQ 274

Query: 969 EVPHKNETGPVRITG 983
           E P++N      ITG
Sbjct: 275 E-PNQNNEREFTITG 288

>KLLA0F10703g complement(984298..985551) similar to sp|P38151
            Saccharomyces cerevisiae YBR233w PBP2 PAB1 binding
            protein singleton, hypothetical start
          Length = 417

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 58/132 (43%), Gaps = 13/132 (9%)

Query: 1095 LTYEPIDFSEVLSEDSD-ETKEATPKVEIDEAKKEETLNKVVKMIEDRVAKAASSTFAGY 1153
            L+ EP+     L    D ET EA  K    E  + E  N  +      + +  S     Y
Sbjct: 7    LSLEPVSSPNSLKRKPDHETLEAGIKRVALEDNEAEPQNSELNGDGTHLTEKDSGQVPNY 66

Query: 1154 I----WCADPRKFNKVVGPGGSNIKKIRDAADVIINVPRRSDKVND----VIYVRGTKEG 1205
            I     C   ++ +KVVG  G  + +I+   +  INV   SD +N     VI+VRG  E 
Sbjct: 67   INLRMLCLM-KQASKVVGGKGERVNRIKSETNTRINV---SDNINGVMERVIFVRGKCEE 122

Query: 1206 VEKAEALILQAL 1217
            V +A   I++A+
Sbjct: 123  VARAFGKIVRAI 134

>YBL032W (HEK2) [162] chr2 (160149..161294) Protein with four KH
           RNA-binding domains that is required for ASH1 mRNA
           localization to the bud tip, has similarity to mouse
           hnRNP X protein [1146 bp, 381 aa]
          Length = 381

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 46/95 (48%), Gaps = 16/95 (16%)

Query: 777 GYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEM----DFLQKSTDPKVQETGEVELEI 832
           GY +++V  + H+  IIGKAGA I  +    GV++    DFL  S D ++       +EI
Sbjct: 157 GYVRLIVANS-HISSIIGKAGATIKSLINKHGVKIVASKDFLPAS-DERI-------IEI 207

Query: 833 TGTRAAINEAANKVQEIIDEAADFDSETLSVARKY 867
            G   +I     ++ EII   +D D    S  R Y
Sbjct: 208 QGFPGSITNVLIEISEII--LSDVDVR-FSTERSY 239

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 90/200 (45%), Gaps = 42/200 (21%)

Query: 861  LSVARKYHRIIVGSGGHNLRDIISKAGGDDIRNKNIDIPNANSESDVITVQGPKKFVASV 920
            L VA  +   I+G  G  ++ +I+K G   + +K+  +P   S+  +I +QG    + +V
Sbjct: 161  LIVANSHISSIIGKAGATIKSLINKHGVKIVASKDF-LPA--SDERIIEIQGFPGSITNV 217

Query: 921  LKQINKIV--------------------EDGENSVTKT-------LEIPEERHGALVGPG 953
            L +I++I+                      GE +   T       L+IPE   GA++G G
Sbjct: 218  LIEISEIILSDVDVRFSTERSYFPHLKKSSGEPTSPSTSSNTRIELKIPELYVGAIIGRG 277

Query: 954  GMIRRQLE--TEFNVILE-----VPHKNETGPVRITGLPENVEKAEKKIL----TEI-VR 1001
                + L+  T+ N+++E        +N    +  +  P+NV+ AE  +L    TEI  R
Sbjct: 278  MNRIKNLKTFTKTNIVVERKDDDDKDENFRKFIITSKFPKNVKLAESMLLKNLNTEIEKR 337

Query: 1002 DSFDRELSVPASLHEFVSER 1021
            +++ R+L         V+ER
Sbjct: 338  ENYKRKLEAAEGDATVVTER 357

>YLR352W (YLR352W) [3734] chr12 (831115..833538) Protein containing
           leucine rich repeats, which mediate protein-protein
           interactions [2424 bp, 807 aa]
          Length = 807

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 32/71 (45%), Gaps = 5/71 (7%)

Query: 318 LNQLSSTLTEEKIKIPTKFQFLIDTKALKKEFNVIVTFPSDPTDELVSFVGQKDKVTEAI 377
           +N++   LT E     T  +FL+ TKA  +EF        D  D ++ ++    KV   +
Sbjct: 120 MNKMIKNLTNE-----TLLEFLMLTKANLREFLACENIQDDLDDNIIKYILSPGKVLSVV 174

Query: 378 AFARANSKTFT 388
            F   +  TFT
Sbjct: 175 DFCGCSGTTFT 185

>Scas_652.3
          Length = 445

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 1165 VVGPGGSNIKKIRDAADVIINVPRRSDKVND-VIYVRGTKEGVEKAEALILQALK 1218
            VVGP G +I KI+      INV      V + +IYVRG  + V  A   I +A++
Sbjct: 89   VVGPKGESISKIKKDTSTRINVSENIRGVPERIIYVRGACDNVANAYLNIAKAIR 143

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 43/85 (50%), Gaps = 15/85 (17%)

Query: 767 SALLDFERENGYKKIVVVPAEHVPRIIGKAGANINDIRADFGVEMDFLQKSTDPKVQETG 826
           S L+  +RE      + +  E V  IIG+ G NIN I+   G  + F+    D  V+ + 
Sbjct: 359 SQLMSVQRE------IYINEEFVGNIIGREGRNINSIKETTGCSI-FI----DDPVEGSY 407

Query: 827 EVELEITGT----RAAINEAANKVQ 847
           E +L I GT    +AAI   +NK++
Sbjct: 408 ERKLVIKGTQMGSQAAIMLISNKIE 432

>AFR100W [3292] [Homologous to ScYJL085W (EXO70) - SH]
           complement(614795..616639) [1845 bp, 614 aa]
          Length = 614

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 216 RENNPDSYDEDLNDFTANVNFHGDFE 241
           ++N P  YDEDLND  A +++ GD E
Sbjct: 164 KQNFPYYYDEDLNDIAAILDYFGDTE 189

>AFL099W [3096] [Homologous to ScYPL207W - SH]
           complement(252709..255027) [2319 bp, 772 aa]
          Length = 772

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 67/149 (44%), Gaps = 11/149 (7%)

Query: 518 IVLFYSSPEEDFKPSAEEINAELEKVN-ASLEPLRAKLNKMTNKVYTLDAKIQDDLLSPS 576
           I +FYSS +   K SAE + AEL ++    LEP+   L+++ +    LD    D    P 
Sbjct: 179 IYIFYSSLQGAAKRSAELVLAELRELKPLELEPILLNLDEIDD----LDKYFVD---VPC 231

Query: 577 SATLHLILEDVSKEEGNLQIKLHTPEANKVTIRGDDKAV-KTANKALTSIVENPTKKSKI 635
              L++++      +  L + L T E N    R D+  + K    ++  I ++     K 
Sbjct: 232 ENALYVLVLPSYDSDSPLDLFLETLEENFNDFRIDNYPLRKLVGYSILGIGDSEMWPEKF 291

Query: 636 TVEV--ASNSIARLVGTKGSNLNEIREKF 662
             +   A  SIA+L G +   + E+  KF
Sbjct: 292 CYQAREADLSIAKLGGRRIYPVGEVCVKF 320

>Scas_628.15
          Length = 576

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 53/112 (47%), Gaps = 12/112 (10%)

Query: 891 IRNKNIDIPNANSESDVITVQGPKKFVASVLKQINKIVEDGENSVTKTLEIPEERH---- 946
           +  K + +PN+N+ S  I  +  +KF         +I+ED E+    T+ +  + +    
Sbjct: 7   LNTKFLILPNSNTTSIEILSELIRKFGG-------EIIEDLEDLDKNTVILINDSYIGDS 59

Query: 947 GALVGPGGMIRRQLETEFNVILEVPHKNETGPVRITGLPENVEKAEKKILTE 998
           G+L+    + RR+    F  + +  H NE   VR++ +   +++   +IL E
Sbjct: 60  GSLIQQD-LFRRECHVNFTTLEDFVHANELQIVRVSCVSRWIKQGAFQILGE 110

>Kwal_55.19804
          Length = 213

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 191 AAIIGSGGKTIRGISEQYDVTINLARENNPDSYDEDLNDFTANVNFHGDFE 241
           AA++ S   +   I+ ++D  I L +  NP  Y ED+ D  A+   HGDF+
Sbjct: 108 AAMLVSTDASRNSINRRWDELI-LDKSTNPFVYVEDVKDLIADSLEHGDFQ 157

>AFR186W [3378] [Homologous to ScYLL032C - SH]
           complement(775246..777399) [2154 bp, 717 aa]
          Length = 717

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 36/175 (20%), Positives = 75/175 (42%), Gaps = 24/175 (13%)

Query: 598 LHTPEANKVTIRGDDKAVKTANKALTSIVENPTKKSKITVEVASNSIARLVGTKGSNLNE 657
           L  P+     + GD   ++   + ++  + N   + K  VE+  +    + G K   ++ 
Sbjct: 341 LAEPDHWNFVLVGDQGKLEKVLEWVSKNMLNTPLQVKYFVELDPSYKDFVSGKKNGKISR 400

Query: 658 IREKFDCQIDVPNHDEIKDKTAEIVLTGQEYNLEQA---KKFIAAEAKKWADIVTKELVV 714
           I +  D  I++    ++++    ++LT    +++ A   +K ++ E         +   +
Sbjct: 401 IMDSTDVVINL----DLQNGHGNMILTMFANDIKNAILGQKLVSDELPS-----ERSFFI 451

Query: 715 PQKYHGSLIGANGVYRNRLQDKYSVFINF------PRDS------DIVTIRGPSR 757
           P+ YH  +IG  G     +  K++VFI F      P++       D V IR PS+
Sbjct: 452 PEAYHRPVIGTGGSVIQTIMRKHNVFIQFSNSFQLPQNKLAHIRYDNVVIRCPSK 506

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.131    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 37,431,173
Number of extensions: 1673635
Number of successful extensions: 5882
Number of sequences better than 10.0: 99
Number of HSP's gapped: 5826
Number of HSP's successfully gapped: 108
Length of query: 1219
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1106
Effective length of database: 12,684,275
Effective search space: 14028808150
Effective search space used: 14028808150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)