Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_709.561281126164090.0
YMR012W (CLU1)1277126537830.0
CAGL0M07722g1267125833780.0
Kwal_26.81611229125429870.0
ABR050W1228121726760.0
KLLA0F25322g1269127722650.0
Kwal_47.18763966161910.020
YOL093W (TRM10)29382780.47
Sklu_1773.323357731.6
AAR115C964169732.3
CAGL0L07040g248113703.3
Scas_694.7286155704.0
YGL067W (NPY1)384115704.6
Scas_631.41398106705.7
CAGL0E00473g1025109706.0
Kwal_26.9422365115687.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_709.56
         (1281 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_709.56                                                          2473   0.0  
YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiat...  1461   0.0  
CAGL0M07722g complement(774048..777851) similar to sp|Q03690 Sac...  1305   0.0  
Kwal_26.8161                                                         1155   0.0  
ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH] complement(4...  1035   0.0  
KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690 S...   877   0.0  
Kwal_47.18763                                                          40   0.020
YOL093W (TRM10) [4727] chr15 (142814..143695) Member of the prot...    35   0.47 
Sklu_1773.3 YNR057C, Contig c1773 4329-5030                            33   1.6  
AAR115C [302] [Homologous to ScYOR160W (MTR10) - SH] (549051..55...    33   2.3  
CAGL0L07040g 786070..786816 similar to tr|Q07508 Saccharomyces c...    32   3.3  
Scas_694.7                                                             32   4.0  
YGL067W (NPY1) [1912] chr7 (376102..377256) Peroxisomal NADH pyr...    32   4.6  
Scas_631.4                                                             32   5.7  
CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces cer...    32   6.0  
Kwal_26.9422                                                           31   7.2  

>Scas_709.56
          Length = 1281

 Score = 2473 bits (6409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1212/1261 (96%), Positives = 1212/1261 (96%)

Query: 1    MSAPATTAVEGQEGTNEHIKISIKLPTLXXXXXXXXXXXXXXXXELLFQFNKDAKVETII 60
            MSAPATTAVEGQEGTNEHIKISIKLPTL                ELLFQFNKDAKVETII
Sbjct: 1    MSAPATTAVEGQEGTNEHIKISIKLPTLAHSHHHHAKKSNNKKNELLFQFNKDAKVETII 60

Query: 61   NVLAFTEQTKYLTNIQLRWNDKILNEEDTIFDVINGKVSDMVHLSIEVKPYTARDSLKHL 120
            NVLAFTEQTKYLTNIQLRWNDKILNEEDTIFDVINGKVSDMVHLSIEVKPYTARDSLKHL
Sbjct: 61   NVLAFTEQTKYLTNIQLRWNDKILNEEDTIFDVINGKVSDMVHLSIEVKPYTARDSLKHL 120

Query: 121  LTVRDFIGFASETSDGLSEFAVSTGSKFTELPLGEIRVPTXXXXXXXXXXXXXXXXXXNV 180
            LTVRDFIGFASETSDGLSEFAVSTGSKFTELPLGEIRVPT                  NV
Sbjct: 121  LTVRDFIGFASETSDGLSEFAVSTGSKFTELPLGEIRVPTAEEEEQKDEAAEDKEVKKNV 180

Query: 181  FKVSDEEKDNFAKVVHEIFESSKKTTINQVLTADSNVVTPCVRSLTLSAYNPVPVFYKSQ 240
            FKVSDEEKDNFAKVVHEIFESSKKTTINQVLTADSNVVTPCVRSLTLSAYNPVPVFYKSQ
Sbjct: 181  FKVSDEEKDNFAKVVHEIFESSKKTTINQVLTADSNVVTPCVRSLTLSAYNPVPVFYKSQ 240

Query: 241  GHLFYLQVVTLEGETFHVTATQSGFYINKSTSTKFDPSERLSEEHNNESKIFYSLYDLLA 300
            GHLFYLQVVTLEGETFHVTATQSGFYINKSTSTKFDPSERLSEEHNNESKIFYSLYDLLA
Sbjct: 241  GHLFYLQVVTLEGETFHVTATQSGFYINKSTSTKFDPSERLSEEHNNESKIFYSLYDLLA 300

Query: 301  SHSKKFVSHVETFEKKLAGMESVSYVKPVSTFLHKPWLVTPPTNPPDFFRLQLDSQNVSV 360
            SHSKKFVSHVETFEKKLAGMESVSYVKPVSTFLHKPWLVTPPTNPPDFFRLQLDSQNVSV
Sbjct: 301  SHSKKFVSHVETFEKKLAGMESVSYVKPVSTFLHKPWLVTPPTNPPDFFRLQLDSQNVSV 360

Query: 361  ETNFNDQFQAIRDLPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFNDNLPPLNPESP 420
            ETNFNDQFQAIRDLPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFNDNLPPLNPESP
Sbjct: 361  ETNFNDQFQAIRDLPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFNDNLPPLNPESP 420

Query: 421  TNEQIFLSGHIFYSFVTSIKDNGINEDAARAISNHDLKTIXXXXXXXXXXXXXXXTTIVD 480
            TNEQIFLSGHIFYSFVTSIKDNGINEDAARAISNHDLKTI               TTIVD
Sbjct: 421  TNEQIFLSGHIFYSFVTSIKDNGINEDAARAISNHDLKTINLLNRVNLNDVRYVLTTIVD 480

Query: 481  FAGRRLLAQTPVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKYGLDEEEGKILFDADF 540
            FAGRRLLAQTPVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKYGLDEEEGKILFDADF
Sbjct: 481  FAGRRLLAQTPVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKYGLDEEEGKILFDADF 540

Query: 541  DAALGKEFAKIFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKRKYILDLANTYPLDIN 600
            DAALGKEFAKIFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKRKYILDLANTYPLDIN
Sbjct: 541  DAALGKEFAKIFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKRKYILDLANTYPLDIN 600

Query: 601  FVKENYDNVADTKRYPHRQTLMRPELVEKWWNAQVEKNKDLTMDAAYDGNMFSYNPDAFV 660
            FVKENYDNVADTKRYPHRQTLMRPELVEKWWNAQVEKNKDLTMDAAYDGNMFSYNPDAFV
Sbjct: 601  FVKENYDNVADTKRYPHRQTLMRPELVEKWWNAQVEKNKDLTMDAAYDGNMFSYNPDAFV 660

Query: 661  VDGVEDPTVEEISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVDTLHKNGINLRYLGKFI 720
            VDGVEDPTVEEISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVDTLHKNGINLRYLGKFI
Sbjct: 661  VDGVEDPTVEEISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVDTLHKNGINLRYLGKFI 720

Query: 721  ELVQTELSKQVAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIAERQAKINKLIQEGKEV 780
            ELVQTELSKQVAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIAERQAKINKLIQEGKEV
Sbjct: 721  ELVQTELSKQVAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIAERQAKINKLIQEGKEV 780

Query: 781  PKELTEDLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLPV 840
            PKELTEDLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLPV
Sbjct: 781  PKELTEDLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLPV 840

Query: 841  LMVPSLIAFVLNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTRTTLLEAISKESYLRFR 900
            LMVPSLIAFVLNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTRTTLLEAISKESYLRFR
Sbjct: 841  LMVPSLIAFVLNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTRTTLLEAISKESYLRFR 900

Query: 901  YELPTDWISKYSESPFIAIRSLSYKIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVAP 960
            YELPTDWISKYSESPFIAIRSLSYKIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVAP
Sbjct: 901  YELPTDWISKYSESPFIAIRSLSYKIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVAP 960

Query: 961  LNTFSVKDLTIIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKDALTLFAQAITVMEEVSSI 1020
            LNTFSVKDLTIIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKDALTLFAQAITVMEEVSSI
Sbjct: 961  LNTFSVKDLTIIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKDALTLFAQAITVMEEVSSI 1020

Query: 1021 LHPSVAEKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSFEMLRALTNLAMLETS 1080
            LHPSVAEKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSFEMLRALTNLAMLETS
Sbjct: 1021 LHPSVAEKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSFEMLRALTNLAMLETS 1080

Query: 1081 NKSPYNAAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLCD 1140
            NKSPYNAAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLCD
Sbjct: 1081 NKSPYNAAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLCD 1140

Query: 1141 LIVSFEGKESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIFSKELGTNHVTTAQSRQ 1200
            LIVSFEGKESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIFSKELGTNHVTTAQSRQ
Sbjct: 1141 LIVSFEGKESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIFSKELGTNHVTTAQSRQ 1200

Query: 1201 WINGLTNVVNDMQKQLNQTQAAVNAKSNAPAKKHKNKKDEPNAELADKSVDELLNFIEGD 1260
            WINGLTNVVNDMQKQLNQTQAAVNAKSNAPAKKHKNKKDEPNAELADKSVDELLNFIEGD
Sbjct: 1201 WINGLTNVVNDMQKQLNQTQAAVNAKSNAPAKKHKNKKDEPNAELADKSVDELLNFIEGD 1260

Query: 1261 Q 1261
            Q
Sbjct: 1261 Q 1261

>YMR012W (CLU1) [3976] chr13 (291133..294966) Translation initiation
            factor eIF3, p135 subunit [3834 bp, 1277 aa]
          Length = 1277

 Score = 1461 bits (3783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/1265 (56%), Positives = 947/1265 (74%), Gaps = 28/1265 (2%)

Query: 12   QEGTNEHIKISIKLP---TLXXXXXXXXXXXXXXXXELLFQFNKDAKVETIINVLAFTEQ 68
            +E  N  +K+++KLP                     ++ F+  K++K++T+++VLA    
Sbjct: 6    EEVKNATVKVTVKLPKEDNHSHNTKHLKKTQSSKNNDISFEIGKESKIQTVLDVLAMIPS 65

Query: 69   TKYLTNIQLRW--NDKILNEEDTIFDVINGKVSDMVHLSIEVKPYTARDSLKHLLTVRDF 126
            +KYLTN+ L+    D  L++E +I +++ G+ S++  L + +KPY+AR++LKH++TVRDF
Sbjct: 66   SKYLTNVGLKTIEGDSQLSDEMSIKEIV-GEKSEL-KLQLILKPYSAREALKHVITVRDF 123

Query: 127  IGFASETSDGLSEFAVSTGSKFTELPLGEIRVPTXXXXXXXXXXXXXXXXXXNVFK-VSD 185
            IGFA ETSDGLSEFA+STGS F+ LPLG I+                     N FK V+D
Sbjct: 124  IGFAQETSDGLSEFAISTGSSFSSLPLGPIK---ERSKQEEKDEKSDPEEKKNTFKDVTD 180

Query: 186  EEKDNFAKVVHEIFESSKKTTINQVLTADSNVVTPCVRSLTLSAYNPVPVFYKSQGHLFY 245
            EEK  F ++VHE+F S K ++IN++LT++SN++TPCVRSL+ + YNPVP FY+S+GHLFY
Sbjct: 181  EEKLKFNEMVHEVFSSFKNSSINKLLTSESNIITPCVRSLSFAPYNPVPPFYRSKGHLFY 240

Query: 246  LQVVTLEGETFHVTATQSGFYINKSTSTKFDPSERL-SEEHNNESKIFYSLYDLLASHSK 304
            LQ+VTLEGE+F++TA  SGFY+NKS STKFDPS +  ++E+ + S I+YSL+DL+AS SK
Sbjct: 241  LQIVTLEGESFYITAIPSGFYVNKSNSTKFDPSPKENTDENAHSSLIYYSLFDLIASRSK 300

Query: 305  KFVSHVETFEKKLAGMESVSYVKPVSTFLHKPWLVTP-PTNPPDFFRLQLDSQNVSVETN 363
            KF+SHV+ FEKKL+ ++S SYV+P +TFLHKPW V+  P N PD+ RLQ  + + + E N
Sbjct: 301  KFISHVQAFEKKLSALDSTSYVRPSNTFLHKPWFVSSLPPNNPDYLRLQTAALDTTPERN 360

Query: 364  FNDQFQAIRDLPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFNDNLPPLNPESPTNE 423
            FND+FQAI+DL T++L +RIE ERL +K++HEFSV A  GAMSIF  +   +NPESPT +
Sbjct: 361  FNDEFQAIKDLTTSTLQDRIEMERLFSKVVHEFSVTAASGAMSIFYSDFVAMNPESPTRD 420

Query: 424  QIFLSGHIFYSFVTSIKDN---GINEDAARAISNHDLKTIXXXXXXXXXXXXXXXTTIVD 480
            QIFL  +IFYS+V+ +  N      ++AA A SN DLKTI               TT+V+
Sbjct: 421  QIFLKDNIFYSYVSDVSGNYEGKGGDEAAIAASNQDLKTINILNRLHMHEVRYLLTTVVE 480

Query: 481  FAGRRLLAQTPVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKYGLDEEEGKILFDADF 540
            FAGRR+LAQTPVPGLL +MG ++ KD  TGEE  +D  ND+ VKYGLDE  GKI++DADF
Sbjct: 481  FAGRRILAQTPVPGLLATMGNKIVKDANTGEEVTEDFVNDINVKYGLDEGLGKIVYDADF 540

Query: 541  DAALGKEFAKIFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKRKYILDLANTYPLDIN 600
            D+ L K+F K FHLKKH+V NG      ++ FSS+S+GIVGFDKR+YILDLANTYPLDIN
Sbjct: 541  DSVLEKKFVKAFHLKKHKV-NG-----TELAFSSQSKGIVGFDKRRYILDLANTYPLDIN 594

Query: 601  FVKENYDNVADT-KRYPHRQTLMRPELVEKWWNAQVEKNKDLTMDAAYDGNMFSYNPDAF 659
            F ++N+DN+ +T  RYPHRQTL+RPELVEKWWN +VEK + +  + AY+ N+FSYNPDA+
Sbjct: 595  FARQNFDNIEETGNRYPHRQTLLRPELVEKWWNNKVEK-EGVEFEKAYEENLFSYNPDAY 653

Query: 660  VVDGVEDPTVEEISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVDTLHKNGINLRYLGKF 719
             V+G+ED  V+E+S YL KEV+P V+ DY+  N++ PYNGEHL DTLHKNGIN+RYLGK 
Sbjct: 654  QVEGIEDANVDEMSNYLQKEVIPSVIQDYLSGNLSTPYNGEHLADTLHKNGINMRYLGKI 713

Query: 720  IELVQTELSKQVAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIAERQAKINKLIQEGKE 779
            IEL Q EL  Q+  + + LK V + N EYE+WEK YL KIE +I ERQAKINKL+QEGKE
Sbjct: 714  IELSQKELDSQIVHYEQNLKAVEQDNKEYEDWEKSYLQKIENMIKERQAKINKLVQEGKE 773

Query: 780  VPKELTEDLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLP 839
            VPKELTEDLKLND+EI+KPTD +P+VVA DEL  LI I+ELEI++RSLKHVL+  SKD+P
Sbjct: 774  VPKELTEDLKLNDEEIKKPTDGKPVVVAYDELVPLIKISELEIVSRSLKHVLKDLSKDVP 833

Query: 840  VLMVPSLIAFVLNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTRTTLLEAISKESYLRF 899
            V +VPSL+A+V N+L G  YN  P  E +D F+P+   SF KLTR+ LLEA+SK+++LRF
Sbjct: 834  VFLVPSLVAYVFNMLVGINYNADPKPEPVDEFYPVNKCSFAKLTRSELLEAVSKQAFLRF 893

Query: 900  RYELPTDWISKYSESPFIAIRSLSYKIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVA 959
            R++LP++WI  Y E+PF  IRS+SYK GIQL+NK+YFFT E  E++KQS DKKIRNK V 
Sbjct: 894  RHQLPSNWIEAYMENPFTLIRSVSYKFGIQLLNKEYFFTREQLESYKQSLDKKIRNKFVE 953

Query: 960  PLNTFSVKDLTIIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKDALTLFAQAITVMEEVSS 1019
            P  TFS+ DLTIIPRVK SE++S V ++FW QG   I E  + ALTL AQ+ITV+E+V++
Sbjct: 954  PPTTFSLSDLTIIPRVKFSEYTSSVSEEFWAQGASMINEDKQSALTLLAQSITVLEDVNN 1013

Query: 1020 ILHPSVAEKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSFEMLRALTNLAMLET 1079
            ILHP+VAEKYLS+S +YN+L L  EA+AFCRKAC IYERV G+DSFEM+RALTNLA+LE 
Sbjct: 1014 ILHPAVAEKYLSLSAIYNKLALYPEAIAFCRKACTIYERVSGIDSFEMMRALTNLAILEF 1073

Query: 1080 SNKSPYNAAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLC 1139
            SN+SPYNA VVY RL E L+ + L  +HHP+ TSI++++EQL+LGV++ KL++ VL  L 
Sbjct: 1074 SNESPYNATVVYNRLAEILKVYELPKIHHPAPTSIFNHLEQLALGVQDTKLAIEVLGQLS 1133

Query: 1140 DLIVSFEGKESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIFSKELGTNHVTTAQSR 1199
              +V  EGK+SLAY +TESRLGNL+  +KDF  AL+HI VT+ IF+K+LG NH  +AQSR
Sbjct: 1134 SYVVELEGKDSLAYGYTESRLGNLFAALKDFHRALEHITVTQGIFTKQLGMNHTHSAQSR 1193

Query: 1200 QWINGLTNVVNDM--QKQLNQTQAAVNAKSNAPAKK--HKNKKDEPNAELADKSVDELLN 1255
            QW+NGL++++ D+  +KQL Q Q +    ++A  KK  H+ KKD+   ELA+KSVDELL 
Sbjct: 1194 QWVNGLSSLIMDLKQKKQLAQDQMSTTGSNSAGHKKTNHRQKKDDVKPELANKSVDELLT 1253

Query: 1256 FIEGD 1260
            FIEGD
Sbjct: 1254 FIEGD 1258

>CAGL0M07722g complement(774048..777851) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w translation initiation
            factor eIF3, hypothetical start
          Length = 1267

 Score = 1305 bits (3378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 665/1258 (52%), Positives = 880/1258 (69%), Gaps = 33/1258 (2%)

Query: 19   IKISIKLPTLXXXXXXXXXXXXXXXXELLFQFNKDAKVETIINVLAFTEQTKYLTNIQLR 78
            +K+ + LPTL                E+  QF KD+K++ +++ L+    TKY TN  L+
Sbjct: 8    VKVIVALPTLSKKPQQGKKKKSKELEEITLQFRKDSKLQNVLDFLSIAPATKYFTNYNLK 67

Query: 79   --WNDKILN-EEDTIFDVINGKVSDMVHLSIEVKPYTARDSLKHLLTVRDFIGFASETSD 135
                D +L+ EE T+ ++ + K  D   +++E+KPY    +LKH+LT RDF GFASET D
Sbjct: 68   NSTGDLLLSSEEKTLRELCSDK--DEYKVALELKPYNQYQALKHVLTSRDFFGFASETED 125

Query: 136  GLSEFAVSTGSKFTELPLGEIRVPTXXXXXXXXXXXXXXXXXXNVFKVSDEEKDNFAKVV 195
            GLS  AVSTGSKF +LPL EI+  +                      V+DEEK  F  +V
Sbjct: 126  GLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTENKKPTS-----MNVTDEEKVEFNHMV 180

Query: 196  HEIFESSKKTTINQV---LTADSNVVTPCVRSLTLSAYNPVPVFYKSQGHLFYLQVVTLE 252
            H +FE+ KK     +   +  D++VVTPC+RS+  S YNPVP FY+++GHLFYLQ+VTLE
Sbjct: 181  HGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSINFSPYNPVPAFYRTKGHLFYLQIVTLE 240

Query: 253  GETFHVTATQSGFYINKSTSTKFDPSERLSEEHNNESKIFYSLYDLLASHSKKFVSHVET 312
            GE+  VTA  SGFYINKST++KFDPS + ++ H +   + Y+LYDLLAS SK FV+H+ +
Sbjct: 241  GESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVD--TVHYTLYDLLASSSKNFVTHISS 298

Query: 313  FEKKLAGMESVSYVKPVSTFLHKPWLVTP-PTNPPDFFRLQLDSQNVSVETNFNDQFQAI 371
             EKK   +ESV+YV+P  T L+KPWL+   PTN PD+ R Q+DS N   E NFND+FQ+I
Sbjct: 299  LEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQIDSFNFEPERNFNDEFQSI 358

Query: 372  RDLPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFNDNLPPLNPESPTNEQIFLSGHI 431
            +++PTN+L  RIE ER+  K+ HEF++ A KGAM I   N   +NP+SP  EQIFL  +I
Sbjct: 359  KEIPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNGTAMNPDSPLEEQIFLKNNI 418

Query: 432  FYSFVTSIK----DNGINEDAARAISNHDLKTIXXXXXXXXXXXXXXXTTIVDFAGRRLL 487
            FYSFV  +     D G +E AA A +N DL+T+               TTIVDF G+R+L
Sbjct: 419  FYSFVGDLNQTYADKGGDE-AAIASANQDLRTLNMLTRLNLPNIHHLLTTIVDFGGKRIL 477

Query: 488  AQTPVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKYGLDEEEGKILFDADFDAALGKE 547
            AQTPVPGLL  MG ++  + ET EET+ +L++D+ VKYGLDE E K++F+ +FD  L  +
Sbjct: 478  AQTPVPGLLSPMGVKITTNEETKEETVSELSSDICVKYGLDENEKKVVFNEEFDEILNDQ 537

Query: 548  FAKIFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKRKYILDLANTYPLDINFVKENYD 607
            FAK FHLKKH +      +  ++ FSS+S+GIVG DKR YILDLANTYPLD+ F KEN+D
Sbjct: 538  FAKSFHLKKHTI------QGTELVFSSQSKGIVGSDKRHYILDLANTYPLDVEFAKENFD 591

Query: 608  NVAD-TKRYPHRQTLMRPELVEKWWNAQVEKNKDLTMDAAYDGNMFSYNPDAFVVDGVED 666
            +V + +K+YPHRQTL+RPELVEKWW  ++E +K + +  AY+ N++SYNPDA+ V GVED
Sbjct: 592  DVKEASKKYPHRQTLIRPELVEKWWATKIENDK-VELVKAYEENLYSYNPDAYQVPGVED 650

Query: 667  PTVEEISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVDTLHKNGINLRYLGKFIELVQTE 726
             TV EIS YL +E++P VV DY+  N+  PYNGEHL DT HKNG+N+RYLGKF  LV+ E
Sbjct: 651  ETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNGVNMRYLGKFANLVKEE 710

Query: 727  LSKQVAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIAERQAKINKLIQEGKEVPKELTE 786
            L KQ   H  KL  V   N EYE WEK YL KIE +I ERQAKINKL+QEGKEVPKELTE
Sbjct: 711  LRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAKINKLVQEGKEVPKELTE 770

Query: 787  DLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLPVLMVPSL 846
            DLKL+D+EI+KP+ E+P+VV+ DEL  LI  AELEII+RSLKH+LR YS+ LP +++P+L
Sbjct: 771  DLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLKHILRKYSRSLPPIVIPAL 830

Query: 847  IAFVLNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTRTTLLEAISKESYLRFRYELPTD 906
            I+FV NLLFG  YN +P  E +D  +P+  + F  LT  TLL+ I +E+ +R+RYEL  D
Sbjct: 831  ISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDTLLKEIEQEAVVRYRYELEGD 890

Query: 907  WISKYSESPFIAIRSLSYKIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVAPLNTFSV 966
            W +++   PF  IRS+  K G+QL+NK YFF+TE  E +KQS DKK R K VAPL TFSV
Sbjct: 891  WFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYKQSLDKKSRAKYVAPLTTFSV 950

Query: 967  KDLTIIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKDALTLFAQAITVMEEVSSILHPSVA 1026
             DLT+IP++K  ++SS + ++ W+QG   I E  KD LTL AQ+I   EEV+SILH SVA
Sbjct: 951  SDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDGLTLLAQSIGFKEEVNSILHSSVA 1010

Query: 1027 EKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSFEMLRALTNLAMLETSNKSPYN 1086
            EKYL++ST+YN+LGL +EA+AFCRK+C IYERVCGVDSFE+LRALTNLA LE +N+SPYN
Sbjct: 1011 EKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDSFELLRALTNLATLEFANESPYN 1070

Query: 1087 AAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLCDLIVSFE 1146
             A++Y+R+I+T+  + L  +HHP  T+I++ +EQLSLGV++ KL++ VLK L D +VS +
Sbjct: 1071 VALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSLGVQDAKLAVEVLKSLGDFLVSID 1130

Query: 1147 GKESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIFSKELGTNHVTTAQSRQWINGLT 1206
            G ESL YA+ +S+LGNL      F  AL  I V E IF+KELGTNH +TAQ+RQW++GLT
Sbjct: 1131 GTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAERIFTKELGTNHGSTAQARQWVDGLT 1190

Query: 1207 NVVNDM--QKQLNQTQAAVNAKSNAP--AKKHKNKKDEPNAELADKSVDELLNFIEGD 1260
            N++ D+  +KQL Q Q A +     P  +K   NKK+  N +LADKSVDELL+FIEG+
Sbjct: 1191 NLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNKKETTNPDLADKSVDELLSFIEGE 1248

>Kwal_26.8161
          Length = 1229

 Score = 1155 bits (2987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/1254 (46%), Positives = 829/1254 (66%), Gaps = 52/1254 (4%)

Query: 15   TNEHIKISIKLPTLXXXXXXXXXXXXXXXXELLFQFNKDAKVETIINVLAFTEQTKYLTN 74
            T + I +SIKLP                  E+     K + V+ +  VL F+  T+ LTN
Sbjct: 5    TVDAILVSIKLPN--------------QKQEVQLSLVKSSTVQIVGEVLQFSPSTRCLTN 50

Query: 75   IQLRWNDKILNEEDTIFDVINGKVSDMVHLSIEVKPYTARDSLKHLLTVRDFIGFASETS 134
            ++     K L+ E+++ D+ +    D V L ++   YTARD+++H+  VRD IGF SET 
Sbjct: 51   LEFYHRGKKLSGEESLLDLAS---EDKVKLDVKFMAYTARDAMRHVSMVRDTIGFTSETL 107

Query: 135  DGLSEFAVSTGSKFTELPLGEIRVPTXXXXXXXXXXXXXXXXXXNVFKVSDEEKDNFAKV 194
            DG+S+FAVSTG +F ++PL  +                        FK+S++EK++F + 
Sbjct: 108  DGISDFAVSTGVQFCDMPLRPVE---------HAAPQEEDKTASTAFKISEDEKNDFQRT 158

Query: 195  VHEIFESSKKTTINQVLTADSNVVTPCVRSLTLSAYNPVPVFYKSQGHLFYLQVVTLEGE 254
            V +     K  T+N+VL   S ++TPC+R+L LS YNPVP FY+++GHL YLQ  +LEGE
Sbjct: 159  VKDTLNQGK--TVNEVLKTRSGIITPCLRALALSGYNPVPPFYRTKGHLLYLQATSLEGE 216

Query: 255  TFHVTATQSGFYINKSTSTKFDPSERLSEEHNNESKIFYSLYDLLASHSKKFVSHVETFE 314
             FH+TAT  GFY+NKST+ KFDPS R     ++      SL DLL++HSKKF  H++  E
Sbjct: 217  VFHITATSQGFYVNKSTANKFDPSPR-----DDAGATKVSLLDLLSTHSKKFKDHLKNLE 271

Query: 315  KKLAGMESVSYVKPVSTFLHKPWLV-TPPTNPPDFFRLQLDSQNVSVETNFNDQFQAIRD 373
            ++++  ++V + +P +TFL KPWL+ T PT+  D+ RLQL   + + E NFND+FQAI+D
Sbjct: 272  QRVSSFDTVFHARPSTTFLGKPWLISTMPTSSGDYARLQLSEVDFNTERNFNDEFQAIKD 331

Query: 374  LPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFNDNLPPLNPESPTNEQIFLSGHIFY 433
            + ++     ++ E+L  K+  EF+  A++ AMSIF  +L  +NPE+PT EQIFL  +IFY
Sbjct: 332  MTSSDYQSIVDTEKLTAKVYQEFTETAVRDAMSIFYADLVAMNPEAPTQEQIFLKNNIFY 391

Query: 434  SFVTSIKDN--GINEDAAR-AISNHDLKTIXXXXXXXXXXXXXXXTTIVDFAGRRLLAQT 490
            SFV  +  N   I  DAA  A SN DL+T+                TI+DFAGRR+LAQT
Sbjct: 392  SFVGDVNGNYSKIGGDAAAFAASNQDLQTVKLLHRVSLPEIHYLLCTIIDFAGRRILAQT 451

Query: 491  PVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKYGLDEEEGKILFDADFDAALGKEFAK 550
            PVPGLL +MGT  ++DP+TGE   +DL +DV + YG DE  G +L++ +FD AL + F+K
Sbjct: 452  PVPGLLSAMGTITKEDPKTGESVTEDLVSDVNIVYGQDEASGDVLYNQEFDDAL-ESFSK 510

Query: 551  IFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKRKYILDLANTYPLDINFVKENYDNVA 610
            +FHL+KH+  +      V+I  SS S+GI+G DKRKYILDLAN+ PLD+ F   NYD V 
Sbjct: 511  VFHLRKHKAGS------VEIKTSSHSKGIIGSDKRKYILDLANSQPLDVEFATGNYDGVP 564

Query: 611  DTKRYPHRQTLMRPELVEKWWNAQVEKNKDLTMDAAYDGNMFSYNPDAFVVDGVEDPTVE 670
            +++RYPHRQTL+R ELV+KWW  +++++K L  + A++ N F+ NPDA+VV+GVED  V 
Sbjct: 565  ESERYPHRQTLVRNELVDKWWANKLDESK-LDFNKAFEENKFAINPDAYVVEGVEDSLVM 623

Query: 671  EISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVDTLHKNGINLRYLGKFIELVQTELSKQ 730
            +IS YL  +VLP VV +Y   N+ +PY+G+HL ++LHKNGIN+RYLGK I L + E   Q
Sbjct: 624  DISKYLNNDVLPSVVNEYAAGNLTVPYDGDHLTESLHKNGINMRYLGKLISLAEKEYESQ 683

Query: 731  VAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIAERQAKINKLIQEGKEVPKELTEDLKL 790
            + QH  KL  V  GN ++E WEKEYL K+EK I ERQ KINKL+ EGKE+P+EL  DLKL
Sbjct: 684  IEQHKTKLAGVMAGNEDHEKWEKEYLAKVEKQIKERQEKINKLVHEGKEIPEELKGDLKL 743

Query: 791  NDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLPVLMVPSLIAFV 850
            ++++IRKPT  + ++V KD++  LI +++LEI+ RSLKH+LR YSK LPV +VPS++A+ 
Sbjct: 744  DENDIRKPTKGEAVIVNKDQICCLIKVSQLEIVARSLKHILRDYSKGLPVSLVPSVVAYF 803

Query: 851  LNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTRTTLLEAISKESYLRFRYELPTDWISK 910
             NLLFG  YN SP  E +D F    +FSF  L+R  LL+AI  ++  RF Y+L  + +  
Sbjct: 804  FNLLFGTSYNSSPEVEIVDEFFLSTNFSFKDLSRGDLLKAIQGQAKRRFIYDLSEEALED 863

Query: 911  YSESPFIAIRSLSYKIGIQLVNKQYFFTTESFETFKQSQDKKIRNKLVAPLNTFSVKDLT 970
                PF  IR++S + GIQL+NK+YFF +E +ETFKQSQDKK R+KL  PL+TFS  D+T
Sbjct: 864  LCAKPFALIRAVSKRFGIQLLNKEYFFNSEEYETFKQSQDKKTRSKLSKPLSTFSANDIT 923

Query: 971  IIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKDALTLFAQAITVMEEVSSILHPSVAEKYL 1030
            +IP +K  ++ SL G +FW QG   + E   D L L +QA+ + EEV+  +H SVAE Y+
Sbjct: 924  VIPTIKDGDYRSLTGDNFWNQGAAILNEKEADGLVLLSQALKIKEEVNGTVHQSVAESYM 983

Query: 1031 SVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSFEMLRALTNLAMLETSNKSPYNAAVV 1090
            ++ST+Y+ L    EA+ FCR+AC IYER CGVDSFE+LR LTNLA+LE SNKSP NAAVV
Sbjct: 984  AMSTIYHTLKRIPEAITFCRRACGIYERTCGVDSFEVLRCLTNLAVLELSNKSPSNAAVV 1043

Query: 1091 YKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLCDLIVSFE-GKE 1149
             +R++ T+ +  ++   HP+  + Y+ ++Q SL  ++ +L++ VLK L   I+  E G+ 
Sbjct: 1044 LQRILCTMNALCVTI--HPATINSYTMLQQASLACKDARLAIEVLKKLSSTILEIEDGQH 1101

Query: 1150 SLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIFSKELGTNHVTTAQSRQWINGLTNVV 1209
            SLAY + +SR+G+LYVT+KD+ S+L+ I+  + +F++ELG N  TTAQ RQW+  L  ++
Sbjct: 1102 SLAYGYNQSRIGDLYVTMKDYTSSLKAISEAKNVFTRELGVNDETTAQCRQWVQALEGLL 1161

Query: 1210 ND--MQKQLNQTQAAVNAKSNAPAKKHKNKKDE--PNAELADKSVDELLNFIEG 1259
                 Q+ LNQ Q A N+      +K KN K++  P  +LA+KSVDELL+FIEG
Sbjct: 1162 QSQKQQQTLNQQQTAANSAGTTRMRKQKNSKNDEKPRPDLANKSVDELLSFIEG 1215

>ABR050W [641] [Homologous to ScYMR012W (CLU1) - SH]
            complement(483635..487321) [3687 bp, 1228 aa]
          Length = 1228

 Score = 1035 bits (2676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/1217 (44%), Positives = 766/1217 (62%), Gaps = 39/1217 (3%)

Query: 51   NKDAKVETIINVLAFTEQTKYLTNIQLRWNDKILNEEDTIFDVINGKVSDMVHLSIEVKP 110
            ++ A+V++I+  LAF   +KY TN +L  N   ++E+  I ++   +    VHL + +KP
Sbjct: 27   SRRARVQSIMYFLAFNAASKYYTNYELLHNGVEVDEQQLISELAGNE--QTVHLQLRLKP 84

Query: 111  YTARDSLKHLLTVRDFIGFASETSDGLSEFAVSTGSKFTELPLGEIRVPTXXXXXXXXXX 170
            Y   + ++H +T R++IGF  ++ D ++  A+S  +KF ELPL +I   +          
Sbjct: 85   YNTGEVIRHFVTFREYIGFVGDSDDDITSLALSNVAKFRELPLTDIAAASGKTEVADDRQ 144

Query: 171  XXXXXXXXNVFKVSDEEKDNFAKVVHEIFESSKKTTINQVLTADSNVVTPCVRSLTLSAY 230
                      F+VSD EK  F K +  I E   + +   VL   S +  PC+RSL +S Y
Sbjct: 145  KEE-------FQVSDAEKAVFTKELDSILE--LRPSAQDVLKGGSALSKPCLRSLIISGY 195

Query: 231  NPVPVFYKSQGHLFYLQVVTLEGETFHVTATQSGFYINKSTSTKFDPSERLSEEHNNESK 290
            NPVP F++++GHL YLQ VTLEGET H+TAT SGFY+NKS++ KFDP+ +       ++ 
Sbjct: 196  NPVPAFFRTKGHLLYLQAVTLEGETLHITATVSGFYVNKSSAIKFDPTLK------TDAA 249

Query: 291  IFYSLYDLLASHSKKFVSHVETFEKKLAGMESVSYVKPVSTFLHKPWLVTP-PTNPPDFF 349
            +  +LY+LL  HSKKF SH+   E  L   ESV+YVKP+S FLHK W  +  P+N  DF 
Sbjct: 250  VCLTLYELLTKHSKKFASHLSQLEAALKAHESVNYVKPISVFLHKTWFPSSLPSNSIDFT 309

Query: 350  RLQLDSQNVSVETNFNDQFQAIRDLPTNSLMERIEFERLQTKIIHEFSVEAIKGAMSIFN 409
              QL++ N   E NFND+FQA+++  +  ++ R+E E+L  ++IH+F+V A KG+M IF 
Sbjct: 310  EYQLEALNFQTERNFNDEFQAVKETSSEDIVARLEKEKLLNRVIHDFNVAASKGSMEIFY 369

Query: 410  DNLPPLNPESPTNEQIFLSGHIFYSFVTSI----KDNGINEDAARAISNHDLKTIXXXXX 465
             N+  +NP++P  E IFL  +IFYSFV+ +    +D G  + AA A SN DL  I     
Sbjct: 370  GNMVAMNPDAPRQEHIFLKNNIFYSFVSDLDGHYQDKG-GDAAAHAASNQDLHIIKTLLQ 428

Query: 466  XXXXXXXXXXTTIVDFAGRRLLAQTPVPGLLDSMGTQVEKDPETGEETLKDLNNDVMVKY 525
                        ++          +PVPG+LD+ G +  K+ E GEE      ND+ V Y
Sbjct: 429  SNMRSVRHLLPAVLSSVVLESWHHSPVPGILDTAGMKFIKN-EKGEEEAIQAKNDITVCY 487

Query: 526  GLDEEEGKILFDADFDAALGKEFAKIFHLKKHQVSNGKDGENVDIWFSSKSRGIVGFDKR 585
            G DE   K++ DA+F ++L  +FAK+FHLKKH+V    DG  V++  +S S+G+VGFDKR
Sbjct: 488  GFDEASNKVIADAEFGSSL-DDFAKVFHLKKHEV----DG--VELKVASTSKGVVGFDKR 540

Query: 586  KYILDLANTYPLDINFVKENYDNVADTK-RYPHRQTLMRPELVEKWWNAQVEKNKDLTMD 644
             YILDLA+  PLD+ F  EN+D V D K RYPHRQTL+R ELVEKWW ++V+      M+
Sbjct: 541  NYILDLADNNPLDVGFALENFDAVTDEKARYPHRQTLLRRELVEKWWFSKVDGTGS-EME 599

Query: 645  AAYDGNMFSYNPDAFVVDGVEDPTVEEISTYLTKEVLPGVVADYIQNNVNIPYNGEHLVD 704
            AAY+   FSYNPDA+ ++G+ED TV E+S YL KEV+P +V +  + ++  P+NGEHLVD
Sbjct: 600  AAYEEGKFSYNPDAYKIEGIEDETVVELSDYLRKEVVPTLVKEVAEGSITAPFNGEHLVD 659

Query: 705  TLHKNGINLRYLGKFIELVQTELSKQVAQHTEKLKTVAEGNIEYENWEKEYLVKIEKLIA 764
             +HKNGIN+RYLG+ IEL + EL  Q A     L+ V   N E+  WE  YL  IE LI 
Sbjct: 660  IMHKNGINIRYLGRVIELAEQELEAQRALREAHLQQVEADNKEFTEWEANYLKHIESLIK 719

Query: 765  ERQAKINKLIQEGKEVPKELTEDLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIIT 824
            ERQ  I KL+ EGKEVP EL E+LKL+D EIRKP +++ + V  D+L+ L+ +A++EII+
Sbjct: 720  ERQVTIQKLLAEGKEVPAELKEELKLDDKEIRKPHEKEGVAVNNDQLSVLLTLAQIEIIS 779

Query: 825  RSLKHVLRSYSKDLPVLMVPSLIAFVLNLLFGEKYNDSPVAEEIDNFHPIKSFSFHKLTR 884
            RS+KHV R +  +LP +++P+ IAF LNLLFG  YN +P+AE   +   I  F+F KLTR
Sbjct: 780  RSIKHVFRKHCHELPAVIIPTFIAFALNLLFGYCYNKAPIAEFPTDGSDI-DFAFTKLTR 838

Query: 885  TTLLEAISKESYLRFRYELPTDWISKYSESPFIAIRSLSYKIGIQLVNKQYFFTTESFET 944
              LL  IS+++ LRFRY LP  W S+Y  +PF  +R +  K GIQL+NK+YFFT E ++ 
Sbjct: 839  EQLLSEISEQAVLRFRYTLPDGWESRYEHTPFALLRPICNKFGIQLLNKEYFFTREQYQN 898

Query: 945  FKQSQDKKIRNKLVAPLNTFSVKDLTIIPRVKTSEFSSLVGQDFWTQGTLTIQEAPKD-- 1002
            ++Q+QD +IR+KLV P++TFS+ DL++   +  +  ++ V  D W QG   I +  K   
Sbjct: 899  WRQAQDNQIRSKLVEPVSTFSINDLSVRTIINVATLTTGVSDDCWAQGAYMINDEDKQAT 958

Query: 1003 ALTLFAQAITVMEEVSSILHPSVAEKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGV 1062
            AL LF+QAI   EE S  +HP+VAE YL++ST++++L   SEAVA CRKAC IYERVCG 
Sbjct: 959  ALGLFSQAIAFREETSGYVHPTVAESYLALSTIHSKLEKKSEAVALCRKACAIYERVCGF 1018

Query: 1063 DSFEMLRALTNLAMLETSNKSPYNAAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLS 1122
            DSFEM+R+L NLAMLE +N SPYNAA+  K ++  L    +  ++HP+  + YS +  + 
Sbjct: 1019 DSFEMIRSLNNLAMLEMANDSPYNAALCLKTIMSILSV--VIPVNHPATINSYSMLHSMC 1076

Query: 1123 LGVENIKLSMAVLKHLCDLIVSFEGKESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEP 1182
              ++N    + VL  L D+IV  +G +SL YA  ESRL NLY +V +++ +L  I     
Sbjct: 1077 SSLQNSSAMIKVLNKLGDIIVEIDGHKSLPYAVNESRLANLYASVGEYKRSLACIESCYE 1136

Query: 1183 IFSKELGTNHVTTAQSRQWINGLTNVVNDMQKQLNQTQAAVNAKSNAPAKKHKNKKDEPN 1242
            +FSKELG NH TT +   WI G+ N++ +   Q     A+  A +    +K   +K + +
Sbjct: 1137 LFSKELGVNHKTTVECNSWITGVENLI-ESTSQSKALAASKAAAAAKQGEKKPAQKQQQS 1195

Query: 1243 AELADKSVDELLNFIEG 1259
            AEL DKS+DEL+NFI G
Sbjct: 1196 AELRDKSIDELMNFING 1212

>KLLA0F25322g complement(2356566..2360375) similar to sp|Q03690
            Saccharomyces cerevisiae YMR012w CLU1 translation
            initiation factor eIF3 (p135 subunit) singleton,
            hypothetical start
          Length = 1269

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1277 (39%), Positives = 744/1277 (58%), Gaps = 109/1277 (8%)

Query: 45   ELLFQFNKDAKVETIINVLAFTEQTKYLTNIQLRWNDKILNEEDTIFDVINGKVSDMVHL 104
            ++ +Q  K++ V  +   L+F E TK+ T+  L  N +++++ED + D+     S    L
Sbjct: 23   DIKYQLGKESNVSHLRTFLSFEESTKFYTSYDLIENSRVVDDEDVLGDLAGNGSS----L 78

Query: 105  SIEVKP--YTARDSLKHLLTVRDFIGFASETSDGLSEFAVSTGSKFTELPLGEIRVPTXX 162
            + + KP  Y    +++H++ +R+ +GF+SE  DG+SEFA+S+GS+F ++ L     P   
Sbjct: 79   TFQFKPKAYNLVTAVQHIVGLRETLGFSSELEDGISEFAISSGSQFQDMSLE----PNSE 134

Query: 163  XXXXXXXXXXXXXXXXNVFKVSDEEKDNFAKVVHEIFESSKKTTINQVLTADSNVVTPCV 222
                                +SD+EK  F +  +E+ ES+        L   + +VTP +
Sbjct: 135  KSNGSETT------------ISDQEKVKFLQTCNELLESTNTDFNIASLKTGNLLVTPVL 182

Query: 223  RSLTLSAYNPVPVFYKSQGHLFYLQVVTLEGETFHVTATQSGFYINKSTSTKFDPSERLS 282
            +SL  SAYNPVP FYK++GHL YLQ  TLE ETFH+T + SGFY+NKS+S KFDPS +  
Sbjct: 183  KSLHFSAYNPVPAFYKNKGHLLYLQASTLENETFHITTSISGFYVNKSSSVKFDPSPK-- 240

Query: 283  EEHNNESKIFYSLYDLLASHSKKFVSHVETFEKKLAGMESVSYVKPVSTFLHKPWLVTP- 341
                +E +  ++L DLL   SKKF  HV +   KL+  +S  YVKP S FL KPWLV+  
Sbjct: 241  ----DEFEPKFNLIDLLTQVSKKFHQHVTSLRNKLSSTDSAQYVKPASCFLSKPWLVSQL 296

Query: 342  PTNPPDFFRLQLDSQNVSVETNFNDQFQAIRDLPTNSLMERIEFERLQTKIIHEFSVEAI 401
            P+N  DF R QL+  N   E NF D+FQAI+DL  NS  +R++ E++   +IHEF+ EA+
Sbjct: 297  PSNNGDFMRTQLEHFNNDDERNFCDEFQAIKDLEINSSYDRLKNEKITAGLIHEFNSEAV 356

Query: 402  KGAMSIFNDNLPPLNPESPTNEQIFLSGHIFYSFVTSIKDN----GINEDAARAISNHDL 457
            KGAM+IFN+ L P++P +     ++    + +SFV  +       G NE AA A++N DL
Sbjct: 357  KGAMAIFNNELTPIDPGTTGENAVYFHKSLIFSFVADVSGTYSSIGGNE-AAYAVANQDL 415

Query: 458  KTIXXXXXXXXXXXXXXXTTIVDFAGRRLLAQTPVPGLLDSMGTQV---EKDPETGE--E 512
            + I               T I+D+AG RLL Q+PVPGLL  +G  +   E+D E  E  E
Sbjct: 416  QIINSLNRLGLKGIRHCLTAIIDYAGHRLLVQSPVPGLLTPVGVNIIVDEEDKEVAEPME 475

Query: 513  TLKDLNNDVMVKYGLDEEEGKILFDADFDAALGKEFAKIFHLKKHQVSNGKDGENVDIWF 572
            TL      + V YG D+    + FD  F   +  EF+K F+LK+H+V      E VD+  
Sbjct: 476  TL------ISVNYGYDDFVATLKFDEKFHEKVC-EFSKNFYLKEHKV------EEVDLRI 522

Query: 573  SSKSRGIVGFDKRKYILDLANTYPLDINFVKENYDNVADTKRYPHRQTLMRPELVEKWWN 632
            SSKS+GI G D+R YILDLANT P+DI FVK +YD+V + K YPHRQ L+R ELVE+W  
Sbjct: 523  SSKSKGIFGVDQRAYILDLANTNPVDIEFVKAHYDDVKENK-YPHRQVLLRRELVERWRA 581

Query: 633  AQVEKNKDLTMDAAYDGNMFSYNPDAFVVDGVEDPTVEEISTYLTKEVLPGVVADYIQNN 692
             ++  +     +A+ D + F YNPDA+V+DGVED  V ++S +L   VL   + D ++ N
Sbjct: 582  EKIAASGKTLQEASEDVS-FIYNPDAYVIDGVEDENVADMSKFLNDTVLTLFLEDILKGN 640

Query: 693  VNIPYNGEHLVDTLHKNGINLRYLGKFIELVQTELSKQVAQHTEKLKTVAEGNIEYENWE 752
             NIPY+G+HL D  H NG+N+RYLGK IE V+ +   Q  +  + L  + + N EY++WE
Sbjct: 641  SNIPYDGQHLTDLFHTNGVNMRYLGKAIEFVKAKYEDQKQERAKYLSKIEQENKEYQDWE 700

Query: 753  KEYLVKIEKLIAERQAKINKLIQEGKEVPKELTEDLKLNDDEIRKPTDEQPIVVAKDELT 812
              YLVK+EKLI ERQ +INK +Q+GKEVP +L E ++L+  ++++P   +   V  D+  
Sbjct: 701  TGYLVKVEKLIKERQEEINKYVQQGKEVPSKLKEQIQLDKADLKEPVRNEGCTVEVDQFE 760

Query: 813  TLINIAELEIITRSLKHVLRSYSKDL--PVLMVPSLIAFVLNLLFGEKYNDSPVAEEIDN 870
             LI + ELE+I RS+KH+ R  SK L  P L VP L+AF LNLLFG+ YN+S   E +D 
Sbjct: 761  GLIAVCELEMIARSIKHIFRQQSKKLSSPTL-VPHLVAFFLNLLFGKSYNESVTVENLDA 819

Query: 871  FHPIKSFSFHKLTRTTLLEAISKESYLRFRYELPTDW--ISKYSESPFIAIRSLSYKIGI 928
               I    F + TR  L+E +  ++ LRFRY+L ++W  I++   S +  IR+++ K GI
Sbjct: 820  LFDINELEFAQYTREQLIEEVRVQAKLRFRYDLTSEWFDINEKRFSKYALIRAIAQKFGI 879

Query: 929  QLVNKQYFFTTESFETFKQSQDKKIRNKLVAPLNTFSVKDLTIIPRVKTSEFSSLVGQDF 988
            QL+NK+YFFT E +E +KQ+QDKK+R+K+V P  TFS+ D ++ P +K +EF SL+ ++ 
Sbjct: 880  QLINKEYFFTKEQYEKWKQAQDKKLRSKIVDPKQTFSINDFSLRPVIKGAEFQSLIAEEL 939

Query: 989  WTQGTLTI------------------------------------QEAPK-------DALT 1005
            W QG   +                                    +E  K       +ALT
Sbjct: 940  WIQGASLVNAVSVEEEEAEKKKEESKKAAADGEDAGSSGATSKEEEQAKERAKKMNEALT 999

Query: 1006 LFAQAITVMEEVSSILHPSVAEKYLSVSTVYNQLGLTSEAVAFCRKACKIYERVCGVDSF 1065
            L  Q+I   E++  ++HPS+   YL +S +Y++LG  S+AV FC KA  + ER  GVDSF
Sbjct: 1000 LLGQSIAFREDIFGLVHPSLVSSYLLLSNMYSRLGQYSQAVTFCNKAALLSERCYGVDSF 1059

Query: 1066 EMLRALTNLAMLETSNKSPYNAAVVYKRLIETLQSFNLSTLHHPSMTSIYSNIEQLSLGV 1125
            E +R L+NLA LE    S YN+A+V K++ E L+   L+   H    ++++ + Q++   
Sbjct: 1060 ETVRILSNLAYLEYGQGSIYNSALVLKKVHELLKL--LAPFVHSGRVNVFNLLFQIAAST 1117

Query: 1126 ENIKLSMAVLKHLCDLIVSFEG-KESLAYAFTESRLGNLYVTVKDFRSALQHIAVTEPIF 1184
            E+ K+ + +L  L +L++   G +E+L Y   ESR+ NLY ++ D   AL HI   + IF
Sbjct: 1118 EDKKVQIKILNKLSELLLKITGSEETLPYGQNESRIANLYTSLDDMSHALSHIEKAKSIF 1177

Query: 1185 SKELGTNHVTTAQSRQWINGLTNVVNDMQ--KQLNQTQAAVNAKSNAPAKKHKNKKDEPN 1242
            SKELG N  TT  S+QW   +  ++   Q  K+L   Q A    + +  K  K+    P 
Sbjct: 1178 SKELGLNDQTTLTSKQWSETIKGIITKQQQEKKLASAQQATKPANISQKKGKKSSSSSP- 1236

Query: 1243 AELADKSVDELLNFIEG 1259
              L +KSVDELL FIEG
Sbjct: 1237 -ALTNKSVDELLQFIEG 1252

>Kwal_47.18763
          Length = 966

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 78/161 (48%), Gaps = 23/161 (14%)

Query: 712 NLRYLGKFIELVQTELSKQVAQHTEKL------KTVAEGNIEYENWEKEYLVKIEKLIAE 765
           +L  LG      +T L + +  H++KL        +A   I+Y  W +     I ++IA 
Sbjct: 74  DLTQLGDQKNAFKTSLLELIVHHSQKLIVTQLSVALARLAIQYLEWRQ----PISEIIAA 129

Query: 766 RQAKINKLIQEGKEVPKELTEDLK---LNDDEIRKPTDEQPIVVAKDELTTLINIAE--- 819
                +KL++  K +P+E T D+K   L++DE R  T E    +A+D L  L+N+ +   
Sbjct: 130 LNPYPSKLLEFLKILPEE-TLDIKSTPLSEDEFRSRTHELIEQIAEDVLKFLVNVVDSLG 188

Query: 820 ---LEIITRSLKHVLRSYSKDLP---VLMVPSLIAFVLNLL 854
                I    L + + S++ +LP   VL + SL++ V  +L
Sbjct: 189 SNSSNITVAQLLNCVNSWAYELPIEQVLAMNSLLSSVFQVL 229

>YOL093W (TRM10) [4727] chr15 (142814..143695) Member of the protein
           of unknown function (DUF425) family, has moderate
           similarity to uncharacterized C. albicans Orf6.5919p
           [882 bp, 293 aa]
          Length = 293

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 7/82 (8%)

Query: 754 EYLVKIEKLIAERQAKINKLIQEGKEVPKELTEDLKLNDDEIRKPTDEQPIVVAKDELTT 813
           E  VK ++L  ER AKI + I  G+EVP+EL  + ++N ++    TD    ++       
Sbjct: 50  ERRVKKKRLRHERSAKIQEYIDRGEEVPQELIREPRINVNQ----TDSGIEIILDCSFDE 105

Query: 814 LINIAELEIITRSLKHVLRSYS 835
           L+N  + EI++ S   V R+YS
Sbjct: 106 LMN--DKEIVSLS-NQVTRAYS 124

>Sklu_1773.3 YNR057C, Contig c1773 4329-5030
          Length = 233

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 35/57 (61%)

Query: 787 DLKLNDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRSLKHVLRSYSKDLPVLMV 843
           D+KL D +I + +DE+P++V       +    +LEI T  +KH+++S  + + +++V
Sbjct: 99  DIKLQDFQIPQNSDERPLIVEGAGGIYVPITKKLEITTDLIKHLIQSTKRPVKIVVV 155

>AAR115C [302] [Homologous to ScYOR160W (MTR10) - SH]
           (549051..551945) [2895 bp, 964 aa]
          Length = 964

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 78/169 (46%), Gaps = 27/169 (15%)

Query: 716 LGKFIELVQTELSKQVAQHTEKL------KTVAEGNIEYENWEKEYLVKIEKLIAERQAK 769
           LG F E     L + + QH  +L       T+A  +I+Y  W       I ++I+     
Sbjct: 81  LGPFKE----SLLQLLVQHQHRLIVTQLSVTIARLSIQYLAWRN----PIGEIISVLNPY 132

Query: 770 INKLIQEGKEVPKELTEDLK---LNDDEIRKPTDEQPIVVAKDELTTLINIAELEIITRS 826
            +KL+   K +P+E T D+K   L++DE +  T E    +A+D L+ LI   +    T S
Sbjct: 133 PDKLLGFLKILPEE-TLDMKSTPLSEDEFKSRTHELINQIAEDVLSFLIKCIDAAQDTGS 191

Query: 827 LK-----HVLRSYSKDLPV---LMVPSLIAFVLNLLFGEKYNDSPVAEE 867
           ++       L ++  + P+   L V  LI  V  +L  E ++D P A E
Sbjct: 192 VQVEQILSCLSTWIYEFPIEQLLTVTPLINLVFRVLM-ESHDDYPDAFE 239

>CAGL0L07040g 786070..786816 similar to tr|Q07508 Saccharomyces
           cerevisiae YDL087c EXM2, start by similarity
          Length = 248

 Score = 31.6 bits (70), Expect = 3.3,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 55/113 (48%), Gaps = 10/113 (8%)

Query: 730 QVAQHTEKLKTVAEGNIE---YENWEKEYLVKIEKLIAERQAKINKLIQEGKEVPKE--- 783
           Q+     KLK   E  IE   Y  +E+EY + + K ++E   +I+  I++ +  P+E   
Sbjct: 71  QIHLAKHKLKYERETEIEGKRYPEFEREYFMILSKFVSECDNQISVAIRKLEHTPEEKKL 130

Query: 784 ---LTEDLKLNDDEIRKPTDEQPIVVAKDELT-TLINIAELEIITRSLKHVLR 832
              +T +L   D +I   T+E  I+   +E T  L+   +L+ + +  K V +
Sbjct: 131 IQQVTAELDNIDTKIALMTEEIEILAHNNETTKALLQSVKLQKLKQERKIVAK 183

>Scas_694.7
          Length = 286

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 67/155 (43%), Gaps = 27/155 (17%)

Query: 753 KEYLVKIEKLIAERQAK-----INKLIQEGKEVPKELTEDLKLNDDEIRKPTDEQPIVVA 807
           +EYL +  + + E Q       I + + +GK +PKEL ED +L  D     +  +  +  
Sbjct: 10  REYLYRKAQELQESQLHQKRQIIKQALAQGKPLPKELAEDEELQKDFRYDQSRNEDEIQI 69

Query: 808 KDELTTLINIAELEII---TRSLKHVLRSYSKDLPVL------------MVPSLIAFVL- 851
            DE  T   + E  II   +R     L  ++K++ +L            ++P+L++  + 
Sbjct: 70  DDEYATTSGLVEPRIIVTTSRDPSTRLSQFAKEIKLLFPQAVRLNRGNYVMPNLVSACIK 129

Query: 852 ----NLLFGEKYNDSPVAEEIDNF--HPIKSFSFH 880
               +L+   ++   P +  I +F   P   FS H
Sbjct: 130 SGTSDLVVLHEHRGVPTSLTISHFPHGPTAYFSLH 164

>YGL067W (NPY1) [1912] chr7 (376102..377256) Peroxisomal NADH
           pyrophosphatase I, member of the Nudix family of
           hydrolases [1155 bp, 384 aa]
          Length = 384

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 51/115 (44%), Gaps = 13/115 (11%)

Query: 870 NFHPIKSFSFHKLTRTTLLEAISKESYLRFRYELPTDWISKYSESPFIAIRSLSYKIGIQ 929
           +F PI  FS+ K+TR  + +  ++++ L  + ++  DW++KY   P         + G +
Sbjct: 137 DFEPI--FSYPKVTRDHIFKQTNEDASLYSQGKMYLDWLAKYKFCPGCGSPLFPVEAGTK 194

Query: 930 LVNKQYFFTTESFETFKQSQDKKIRNKLVAPLNTFSVKDLTIIPRVKTSEFSSLV 984
           L       + E+   +   +D +I N        F   D T+I  +  S++S   
Sbjct: 195 LQ-----CSNENRNVYCNVRDARINNV------CFPRTDPTVIIALTNSDYSKCC 238

>Scas_631.4
          Length = 1398

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 48/106 (45%), Gaps = 12/106 (11%)

Query: 1100 SFNLSTLHHPSMTSIYSNIEQLSLGVENIKLSMAVLKHLCDLIVSFEGKESLAYAFTESR 1159
            +F   TL   + + I+     +S G+ENIKL+  +L  L  ++ +        YA   S 
Sbjct: 544  TFRALTLWRQAKSYIFKEAANVSQGLENIKLAFKILVQLIKVLDT--------YAPAYST 595

Query: 1160 LGNLYVT-VKDFRSALQ-HIAVTEPIFSKELGTNHVTT--AQSRQW 1201
            LG+LY T  KD   A + +    E      +  N++T   A+S  W
Sbjct: 596  LGDLYTTYYKDSGRAFKCYYKAFELDAGDHIAANYMTEVYAKSNNW 641

>CAGL0E00473g 44001..47078 similar to sp|P25336 Saccharomyces
           cerevisiae YCR092c DNA mismatch repair protein,
           hypothetical start
          Length = 1025

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 12/109 (11%)

Query: 633 AQVEKNKDLTMDAAYDGNMFSYNPDAFVVDGVEDPTVEEI-----STYLTKEVLPGVVAD 687
           A+V++  DLT+D+  D       P    +DG E PTV ++     S  L K+ +     D
Sbjct: 31  AEVDEVLDLTLDSENDEEQQQETPVLEPIDGEEHPTVSKVPDLNDSRLLQKQKILNASKD 90

Query: 688 YIQNNVNIPYNGEHLVDTLHKNGINLRYLGKFIELVQTELSKQVAQHTE 736
            I N+V++    E L D ++K     R LG+ I+    + S ++A+ +E
Sbjct: 91  -ITNSVDVSAFNEKLKDIMNK-----RKLGR-IKGSLIDESDEIAEQSE 132

>Kwal_26.9422
          Length = 365

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 31/115 (26%)

Query: 1157 ESRLGNLY---VTVKDFRSALQHIAVTEPIFSK---ELGTNHVTTAQ----SRQWIN--- 1203
            ESR+ NLY   + +K +RSAL H+       +    E+G N VT+ +    S  W++   
Sbjct: 262  ESRIHNLYESYMVLKRYRSALPHLTARMKTLNSLQFEVG-NTVTSVKTVESSLNWMDEQA 320

Query: 1204 -GLTNVVNDMQKQLNQTQAAVNAKSNAPAKKHKNKKDEPNAELADKSVDELLNFI 1257
                 ++  M+++LN+T+A                KDE N +   +S++EL N I
Sbjct: 321  TKWQQMLQIMEERLNETEA----------------KDEKNKQEITRSLEELENKI 359

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 40,192,600
Number of extensions: 1801234
Number of successful extensions: 7143
Number of sequences better than 10.0: 74
Number of HSP's gapped: 7420
Number of HSP's successfully gapped: 78
Length of query: 1281
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1168
Effective length of database: 12,684,275
Effective search space: 14815233200
Effective search space used: 14815233200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)