Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_709.5551951925470.0
Sklu_2168.250051110271e-135
Kwal_26.81645004839821e-128
CAGL0M07700g4874348261e-105
ABR051C4845008191e-104
YMR013C (SEC59)5195238201e-103
KLLA0D11198g5155147774e-97
AFL103C61471721.1
YLR067C (PET309)96536692.6
KLLA0D14707g88042674.3
ACR024W87758674.4
CAGL0I02508g17527646.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_709.55
         (519 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_709.55                                                           985   0.0  
Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement        400   e-135
Kwal_26.8164                                                          382   e-128
CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces ...   322   e-105
ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH] (487498..48...   320   e-104
YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol...   320   e-103
KLLA0D11198g complement(954239..955786) some similarities with s...   303   4e-97
AFL103C [3092] [Homologous to ScYPL210C (SRP72) - SH] (245331..2...    32   1.1  
YLR067C (PET309) [3483] chr12 complement(267814..270711) Protein...    31   2.6  
KLLA0D14707g 1242483..1245125 weakly similar to sp|P53253 Saccha...    30   4.3  
ACR024W [1072] [Homologous to ScYPL268W (PLC1) - SH] complement(...    30   4.4  
CAGL0I02508g 222770..223297 similar to sp|P38865 Saccharomyces c...    29   6.0  

>Scas_709.55
          Length = 519

 Score =  985 bits (2547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/519 (94%), Positives = 493/519 (94%)

Query: 1   MGLTATEQRSTHAIRSSKDMSQIQEEEKKRKEVDTDPVLNDRWLEDIFSSVPEKLIQIFI 60
           MGLTATEQRSTHAIRSSKDMSQIQEEEKKRKEVDTDPVLNDRWLEDIFSSVPEKLIQIFI
Sbjct: 1   MGLTATEQRSTHAIRSSKDMSQIQEEEKKRKEVDTDPVLNDRWLEDIFSSVPEKLIQIFI 60

Query: 61  LASSVFLCYKQYGAVDDDDFSIFKNEARVAGMLLSFLLRKCNDRDANTLPQFEIVYLLFL 120
           LASSVFLCYKQYGAVDDDDFSIFKNEARVAGMLLSFLLRKCNDRDANTLPQFEIVYLLFL
Sbjct: 61  LASSVFLCYKQYGAVDDDDFSIFKNEARVAGMLLSFLLRKCNDRDANTLPQFEIVYLLFL 120

Query: 121 PFMTSFLFKKELTIFNSILALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYGMLLNF 180
           PFMTSFLFKKELTIFNSILALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYGMLLNF
Sbjct: 121 PFMTSFLFKKELTIFNSILALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYGMLLNF 180

Query: 181 SICQTLMKIGQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFVTVAIN 240
           SICQTLMKIGQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFVTVAIN
Sbjct: 181 SICQTLMKIGQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFVTVAIN 240

Query: 241 YIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVLGSSAR 300
           YIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVLGSSAR
Sbjct: 241 YIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVLGSSAR 300

Query: 301 KSXXXXXXXXXXXXXPNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKIALSGT 360
           KS             PNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKIALSGT
Sbjct: 301 KSILLVWLSFLLILIPNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKIALSGT 360

Query: 361 IVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGPXXXXXXXXXXXXXTPLLINDSP 420
           IVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGP             TPLLINDSP
Sbjct: 361 IVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGPIIISYIYLIIGISTPLLINDSP 420

Query: 421 VGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYMEYFADIT 480
           VGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYMEYFADIT
Sbjct: 421 VGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYMEYFADIT 480

Query: 481 FSNLLWVCTISGILEGNSELNDNILIPTYMMILEKLLSN 519
           FSNLLWVCTISGILEGNSELNDNILIPTYMMILEKLLSN
Sbjct: 481 FSNLLWVCTISGILEGNSELNDNILIPTYMMILEKLLSN 519

>Sklu_2168.2 YMR013C, Contig c2168 1038-2540 reverse complement
          Length = 500

 Score =  400 bits (1027), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 227/511 (44%), Positives = 321/511 (62%), Gaps = 27/511 (5%)

Query: 20  MSQIQEEEKKR-KEVDTDPVLNDRWLEDIFSSVPEKLIQIFILASSVFLCYKQYGAVDDD 78
           MS+  EEE+    E + D    D +         E++ Q+ IL  ++ LC  +Y   D++
Sbjct: 1   MSKQSEEERNAILEENKDYSFADGFF------ATERIAQLVILGVTIHLCVDKYMN-DEN 53

Query: 79  DFSIFKNE-----ARVAGMLLSFLLRKCND--------RDANTLPQFEIVYLLFLPFMTS 125
           D  +F++      A V G L+++  R  N+        R +  LP F ++YLL+LPFM S
Sbjct: 54  DSLLFQSALTSAVAFVVGSLVNYRTRMVNNGAWGDNVHRLSEFLPDFNVIYLLYLPFMLS 113

Query: 126 FLFKKELTIFNSILALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYGMLLNFSICQT 185
            LF + L + NS +A N+ DIP++ K+P+Q +F+  + E   +       + +N ++C  
Sbjct: 114 LLFARRLVLVNSAMAFNSTDIPVHLKLPLQLVFVLINEEYYTDRSTNMKAIAINVALCYV 173

Query: 186 LMKIGQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFVTVAINYIISS 245
           L KI  LKSLD +DCNLFSI+LTNVLY+ID   P++ FQIL+  L  F V V++NY +S 
Sbjct: 174 LEKISDLKSLDHVDCNLFSILLTNVLYLIDS--PTVHFQILQKVLYGFIVAVSVNYALSF 231

Query: 246 LLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVLGSSARKSXXX 305
            L     + +++SL LFS F ++FP+ + +++ ++   ++P  WL +Y+  S  R     
Sbjct: 232 PLRY--ASTYLRSLILFSSFSLIFPLTVTRILTIDR--KKPLTWLYEYIFSSDTRIKIIF 287

Query: 306 XXXXXXXXXXPNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKIALSGTIVLFL 365
                     PNV+IFKSNFSLNTSRKIWHFLIL L+  P Q+DP FVK++LSGT+VLFL
Sbjct: 288 IWLLCLLVLIPNVMIFKSNFSLNTSRKIWHFLILFLLIPPLQLDPEFVKVSLSGTVVLFL 347

Query: 366 SVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGPXXXXXXXXXXXXXTPLLINDSPVGLIS 425
            VEYLR+L+LEP G ++D KLRSF+DFRDD+GP              P+LIN S VG+IS
Sbjct: 348 VVEYLRYLKLEPVGKFLDEKLRSFSDFRDDRGPIIISYIYLIIGVSAPILINGSLVGVIS 407

Query: 426 LGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYMEYFADITFSNLL 485
           LGVGDSLASI+GGKWGR  WPGT KT+EGTL FI+ TS V+   ++    F+ I+  N++
Sbjct: 408 LGVGDSLASIVGGKWGRIKWPGTNKTVEGTLVFILATSAVSLFCQHRYNSFSPISNGNVV 467

Query: 486 WVCTISGILEGNSELNDNILIPTYMMILEKL 516
             C +SGILEGNS LNDNILIP +M+I  ++
Sbjct: 468 LTCIVSGILEGNSVLNDNILIPPFMLIFSEI 498

>Kwal_26.8164
          Length = 500

 Score =  382 bits (982), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/483 (44%), Positives = 301/483 (62%), Gaps = 28/483 (5%)

Query: 52  PEKLIQIFILASSVFLCYKQYGAVDDDDFSIFKNEARVAGMLL-----SFLLRKCNDRDA 106
           PEK+ Q+ +L  +V L   +   V + D ++F+     A  ++     S+  +  N+ + 
Sbjct: 28  PEKMAQLLLLGGTVHLAVLKL-MVTEKDSALFQAALAAAVAVVVGLGVSYRTKIANNGEW 86

Query: 107 NT--------LPQFEIVYLLFLPFMTSFLFKKELTIFNSILALNALDIPLYEKIPMQALF 158
            T        +P F ++YLL++P + S LF ++LT+ N  LA N  D PL  ++P+QA+F
Sbjct: 87  GTDLQRISGFVPDFNVLYLLYIPSLLSLLFARDLTVVNMALAFNCTDHPLILRLPLQAIF 146

Query: 159 I----GFSAESDAELWEYGYGMLLNFSICQTLMKIGQLKSLDVIDCNLFSIVLTNVLYMI 214
           +     F  +    L   G   L+ F I     +IGQLKS D ++ NLFSI LTNVLY++
Sbjct: 147 VLMNNDFGDKRSKNLKAIGINCLIEFLI----ERIGQLKSFDRVESNLFSICLTNVLYLL 202

Query: 215 DPELPSLSFQILRGSLIAFFVTVAINYIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMD 274
             E  SL FQ+LR  L+ F   VA N+ +  L+   + NP+++S  L + F +VFP+ + 
Sbjct: 203 --ESSSLHFQVLRHVLLGFLAAVAFNFPL--LIITSRFNPYLRSAILSTSFFVVFPLTIL 258

Query: 275 QLIQLESIDERPSMWLLQYVLGSSARKSXXXXXXXXXXXXXPNVLIFKSNFSLNTSRKIW 334
              ++E   + P++WL  Y+  +  R               PN++IFKSNFSLNTSRKIW
Sbjct: 259 YTFEVEG--QNPAIWLFDYITSNDIRVRIIAGWLSCLVILVPNIMIFKSNFSLNTSRKIW 316

Query: 335 HFLILLLITMPFQMDPLFVKIALSGTIVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRD 394
           HFLIL LI +PF+ DP FVKI+L+GTIVLFL+VEYLRFL+L P+G  +DSKLRSFADFRD
Sbjct: 317 HFLILALIAVPFRYDPDFVKISLAGTIVLFLAVEYLRFLKLAPYGELLDSKLRSFADFRD 376

Query: 395 DKGPXXXXXXXXXXXXXTPLLINDSPVGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEG 454
           ++GP             TP+LIN S VG+ISLGVGDSLASI+G +WGR+ WPGT KT+EG
Sbjct: 377 ERGPIIISYIYLIIGVATPILINGSLVGVISLGVGDSLASIVGYRWGRHQWPGTSKTLEG 436

Query: 455 TLSFIIGTSIVAYILKYYMEYFADITFSNLLWVCTISGILEGNSELNDNILIPTYMMILE 514
           T +FI+ TSI +   K ++  F +IT + ++  C +SGILEGNS LNDNILIP YM ++ 
Sbjct: 437 TFAFILSTSICSLCFKLFLGAFQEITSAQVILACILSGILEGNSVLNDNILIPAYMFVVT 496

Query: 515 KLL 517
           +LL
Sbjct: 497 ELL 499

>CAGL0M07700g <772282..773746 similar to sp|P20048 Saccharomyces
           cerevisiae YMR013c dolichol kinase, start by similarity
          Length = 487

 Score =  322 bits (826), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/434 (42%), Positives = 267/434 (61%), Gaps = 23/434 (5%)

Query: 93  LLSFLLRKCNDRDANTLPQFEIVYLLFLPFMTSFLF-KKELTIFNSILALNALDIPLYEK 151
           L+ F+LR+           F+  Y ++LPF+ SF F  + LT  N I++  A+    Y  
Sbjct: 69  LVCFVLRR---------KLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTP 119

Query: 152 IPMQAL-FIGFSAESDAELWEYGYG---MLLNFSICQTLMKIGQLKSLDVIDCNLFSIVL 207
           I +  L F     +     ++Y  G   ++ N+ +   L  IGQLK+LD IDCNLF I+L
Sbjct: 120 IHLVGLIFQAGLMKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILL 179

Query: 208 TNVLYMIDPELPSLSFQILRGSLIAFFVTVAINYIISSLLTKMKKNPHIKSLSLFSIFVI 267
           T+ L + +   P+    +L+G++ +  + + +N+ ++ L+  +       S+ L   F++
Sbjct: 180 TDCLMINNATAPN-YLLVLKGAMTSVMIIIVVNHFLTRLIPSLSN-----SIVLAGNFLV 233

Query: 268 VFPILMDQLIQL--ESIDERPSMWLLQYVLGSSARKSXXXXXXXXXXXXXPNVLIFKSNF 325
           +FPIL++ LI    E I   P++WL+ ++L S  R+              P V++FKS  
Sbjct: 234 LFPILVNHLIDFSNEKITS-PALWLIDFILESEIRQYIMLSWVIVLVVFIPLVILFKSKI 292

Query: 326 SLNTSRKIWHFLILLLITMPFQMDPLFVKIALSGTIVLFLSVEYLRFLQLEPFGAYIDSK 385
           SLNTSRKIWHF+I LLI  PF +DP FVKI+L G I  FLSVEYLR+L++EP+G ++D  
Sbjct: 293 SLNTSRKIWHFVIFLLIVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFF 352

Query: 386 LRSFADFRDDKGPXXXXXXXXXXXXXTPLLINDSPVGLISLGVGDSLASIIGGKWGRYHW 445
           LRSFAD+RD +GP              PLL+ +SPVGL+SLGVGDSLASI+G K GR HW
Sbjct: 353 LRSFADYRDQRGPLIVSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHW 412

Query: 446 PGTRKTIEGTLSFIIGTSIVAYILKYYMEYFADITFSNLLWVCTISGILEGNSELNDNIL 505
            GT KTIEGT++FI+GT+ +++IL+ Y  YF+ I    +L +CT  G+LEGNSELNDNIL
Sbjct: 413 KGTNKTIEGTVAFIVGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNIL 472

Query: 506 IPTYMMILEKLLSN 519
           IP +M+ +EKLL+ 
Sbjct: 473 IPLFMVSMEKLLAQ 486

>ABR051C [642] [Homologous to ScYMR013C (SEC59) - SH]
           (487498..488952) [1455 bp, 484 aa]
          Length = 484

 Score =  320 bits (819), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/500 (36%), Positives = 281/500 (56%), Gaps = 30/500 (6%)

Query: 21  SQIQEEEKKRKEVDTDPVLNDRWLEDIFSSVPEKLIQIFILASSVFLCYKQYGAVDDDDF 80
           +  ++  K  ++ DT  V            +  K +Q  +LA +V L  + +G       
Sbjct: 7   ANAEQAVKAEEQADTGAV-----------PLGGKAVQAVVLAVTVHLAAEVFG------- 48

Query: 81  SIFKNEARVAGML--LSFLLRKCNDRDANTLPQFEIVYLLFLPFMTSFLFKKELTIFNSI 138
              K+EA  A     LS          A  +P F  VY+++LP M S LF++EL   N  
Sbjct: 49  ---KDEAGRAAFYSALSVAAAYGAAAAAGRVPAFNAVYVVYLPVMVSLLFRRELVPVNCA 105

Query: 139 LALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYGMLLNFSICQTLMKIG--QLKSLD 196
           +AL  + +P+  ++ +Q L I +   +       G G +            G  +L+SLD
Sbjct: 106 MALGGMQMPVVLRV-LQQLTILYLQPAARGRGFPGRGGVGGAPGGVVGRWRGWSELRSLD 164

Query: 197 VIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFVTVAINYIISSLLTKMKKNPHI 256
           ++DC L SI+LTNVL++I  E  S+ FQILR  L  F V V  NY+   +    ++N ++
Sbjct: 165 MVDCGLLSILLTNVLFVIGGE-SSVQFQILRACLYGFLVAVGANYVF--VRAYGRRNQYV 221

Query: 257 KSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVLGSSARKSXXXXXXXXXXXXXP 316
           ++  L ++F +VFP ++   + L+  D    +WL++Y+  S+ R               P
Sbjct: 222 RTAVLLAVFALVFPSVILAFLDLDDTDN-ALVWLIKYIFSSALRMQIMAGWLVFLGVLIP 280

Query: 317 NVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKIALSGTIVLFLSVEYLRFLQLE 376
           +V + KS+ SLNTSRKIWHF +L L+     ++P F  +A++GT+V+FL VEY R++ L 
Sbjct: 281 SVFVMKSHLSLNTSRKIWHFALLPLLVCQMAVEPEFTTVAIAGTVVVFLIVEYFRYMNLY 340

Query: 377 PFGAYIDSKLRSFADFRDDKGPXXXXXXXXXXXXXTPLLINDSPVGLISLGVGDSLASII 436
           PFG YI+++LR+F DFRD++GP              PLLIN S VG+ISLGVGDSLASII
Sbjct: 341 PFGDYINAQLRTFTDFRDEQGPIIVSYLYLILGVSFPLLINRSLVGVISLGVGDSLASII 400

Query: 437 GGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYMEYFADITFSNLLWVCTISGILEG 496
           G ++G+YHWPGT KT+EGTL+FI+ ++ +  + +     F  +   N++  C +SGILEG
Sbjct: 401 GRRYGKYHWPGTNKTVEGTLAFIVASAALCLVCQQAFLAFEGVATRNIILACVVSGILEG 460

Query: 497 NSELNDNILIPTYMMILEKL 516
           NS+LNDNILIP++M+I  +L
Sbjct: 461 NSDLNDNILIPSFMLIFMEL 480

>YMR013C (SEC59) [3977] chr13 complement(295178..296737) Dolichol
           kinase, mutants accumulate incompletely glycosylated
           protein precursors in ER [1560 bp, 519 aa]
          Length = 519

 Score =  320 bits (820), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 214/523 (40%), Positives = 300/523 (57%), Gaps = 29/523 (5%)

Query: 10  STHAIRSSKDMSQIQEEEKKRKEVDT---DPVLNDRWLEDIFSSVPEKLIQIFILASSVF 66
           +T  +    + SQ+  EE  +  + T   D   N R  E  +S+     +Q  IL  + F
Sbjct: 11  TTIKLTQKTEGSQMPTEEICKINMRTRKFDVGGNSRDFECFYSN----FVQTVILLGTFF 66

Query: 67  LCYK--QYGAVDDDDFS---IFKNEARVAGMLLSFLLRKCNDRDANTLPQFEIVYLLFLP 121
            C +  Q  ++   D S   IF N   V  +++  +  K       +LP+F+ +Y L+LP
Sbjct: 67  YCVERLQPWSIVTADISYKQIFVNVFVVCLIMVGLIFTKYWQHGYKSLPKFDTIYSLYLP 126

Query: 122 FMTSFLFKKELTIFNSILALNALDIPLYEK----IPMQALFIGFSAESDAELWEYGYGML 177
           FM S LF    T+ N+IL L+ L+   +      I +Q   I F+ E+   L      ++
Sbjct: 127 FMVSLLFDTSSTVINTILILSVLNSYRWRTQLVVIILQLCLIFFNFEAGDRLKNI-ISIV 185

Query: 178 LNFSICQTLMKIGQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFVTV 237
           +N  +   L  IGQLKSLD ID NLFSI+LTN+LY+   E  ++ F+IL+G ++A    +
Sbjct: 186 INSLLSLILKYIGQLKSLDNIDSNLFSILLTNILYV--SEAGTVHFRILKGIILALTTII 243

Query: 238 AINYIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVLGS 297
           +INY+       +KK  H K   L   F I  P+  +  I LE   E P +WL++Y+L S
Sbjct: 244 SINYV-------LKKVMHFKPFMLSISFAIGLPLFANTFIHLED-GENPLLWLVKYILES 295

Query: 298 SARKSXXXXXXXXXXXXXPNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKIAL 357
           + R+              P++LI K + SLNTSRK+WHF+I LLI   FQMD  FVKIAL
Sbjct: 296 TIRQKILFAWSSILILSIPSILIEKDSLSLNTSRKLWHFIIFLLIIPSFQMDSNFVKIAL 355

Query: 358 SGTIVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGPXXXXXXXXXXXXXTPLLIN 417
           SGTI +FLS+EY+RF  L P G+ I+ +LR FAD RD  GP             TPLL+N
Sbjct: 356 SGTIPVFLSIEYIRFQNLPPLGSAIELQLRRFADDRDHSGPLIISYLYLLFGISTPLLMN 415

Query: 418 DSPVGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYY--MEY 475
           +SP+GLI LG+GDSLASIIG ++GR  W GT+KT+EGTL+FI+ + IV  +L  +     
Sbjct: 416 NSPMGLIGLGIGDSLASIIGKRYGRIRWKGTQKTLEGTLAFIVTSFIVCLVLLRFDKAAI 475

Query: 476 FADITFSNLLWVCTISGILEGNSELNDNILIPTYMMILEKLLS 518
           F  +T   LL +CT+SG+LEGNS LNDNILIP +MMI EKL++
Sbjct: 476 FNHLTTLQLLTLCTLSGVLEGNSVLNDNILIPAFMMICEKLIT 518

>KLLA0D11198g complement(954239..955786) some similarities with
           sp|P20048 Saccharomyces cerevisiae YMR013c SEC59
           dolichol kinase singleton, hypothetical start
          Length = 515

 Score =  303 bits (777), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 191/514 (37%), Positives = 290/514 (56%), Gaps = 18/514 (3%)

Query: 10  STHAIRSSKDMSQIQEEEKKRKEVDTDPVLN---DRWLEDIFSSVPE--KLIQIFILASS 64
           ST A  ++ D+       K+   V++    N   D  + ++   V E  ++IQ+ IL  S
Sbjct: 4   STLAKGATSDLGVGNVYSKENSNVNSGSKGNLSRDSIISEVLDKVFEADRVIQLTILGLS 63

Query: 65  VFLCYKQYGAVDDDDFSIFKNEARVAGMLLSFLLR-----KCNDRDANTLPQFEIVYLLF 119
             L Y +YG+  +  FS  +  + V  +L+++++         +   NTLP F  +YL +
Sbjct: 64  SHLVYAKYGS--EPWFS--QQFSMVTSVLMAYVVNLWMSATRTNLGVNTLPTFNTIYLFY 119

Query: 120 LPFMTSFLFKKELTIFNSILALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYGMLLN 179
           +  + S LF  +  + N++LA +  DI ++ KIP+Q +F+    +  A +      ++LN
Sbjct: 120 MQLLLSTLFVPQYLLLNTVLAFSISDISVFFKIPLQIIFLLMGDDGSANIANDVKALVLN 179

Query: 180 FSICQTLMKIGQLKSLDVIDCNLFSIVLTNVLYMIDPELPSLSFQILRGSLIAFFVTVAI 239
           +     L K  +LKSLD  +C++F+++ T++L +++ +  S+ FQ+ +    +F V V +
Sbjct: 180 YFFIFGLYKTSKLKSLDKTECHMFALLCTDILALVESD--SIYFQVFQVCFTSFIVLVTV 237

Query: 240 NYIISSLLTKMKKNPHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMWLLQYVLGSSA 299
              +S  L  +     I++L L  + V+ F   +   + + ++   P  WL+ Y+  S  
Sbjct: 238 TSAVSYGLESVGATRWIRTLLLLPMIVVGFSYYIQTNLIINNVP--PFTWLIDYIGSSMI 295

Query: 300 RKSXXXXXXXXXXXXXPNVLIFKSNFSLNTSRKIWHFLILLLITMPFQMDPLFVKIALSG 359
           R               P+V   KSN+SLNTSRK+WHF IL L+     MD  FVKIAL+G
Sbjct: 296 RLKIMGIWLGSALLLLPSVFALKSNWSLNTSRKVWHFAILPLLIPAIMMDSNFVKIALAG 355

Query: 360 TIVLFLSVEYLRFLQLEPFGAYIDSKLRSFADFRDDKGPXXXXXXXXXXXXXTPLLINDS 419
           T+ LFL VEY+RFL + P G Y+D  LRSFADFRD+KGP              P LIN S
Sbjct: 356 TVNLFLIVEYIRFLHIYPVGHYLDKHLRSFADFRDEKGPIIISYLYFIIGISLPFLINGS 415

Query: 420 PVGLISLGVGDSLASIIGGKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYMEYFADI 479
            +G+ISLGVGDSLASIIG K+GR  WP T KT EGT +FI  T I   I+K Y  +F ++
Sbjct: 416 IIGIISLGVGDSLASIIGKKFGRNRWPNTCKTFEGTFAFIAATGITTVIMKVYFNFFTEV 475

Query: 480 TFSNLLWVCTISGILEGNSELNDNILIPTYMMIL 513
           +F NL+ VC ++GILEGNS LNDN+LIPT+M+IL
Sbjct: 476 SFMNLVLVCFLAGILEGNSTLNDNLLIPTFMLIL 509

>AFL103C [3092] [Homologous to ScYPL210C (SRP72) - SH]
           (245331..247175) [1845 bp, 614 aa]
          Length = 614

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 126 FLFKKELTIFNSILALNALDIPLYEKIPMQALFIGFSAESDAELWEYGYGMLLNFS-ICQ 184
           F   K L   N   A + +++   E++P+  L     AE   +L E  Y MLLN S +C 
Sbjct: 138 FRTYKYLAAHNEEEADDGMELACNERVPLAFLPAEAVAEVSGKLVEDSYDMLLNESMVCS 197

Query: 185 TLMKIGQLKSL 195
           +  ++ Q +SL
Sbjct: 198 SKGQLEQAESL 208

>YLR067C (PET309) [3483] chr12 complement(267814..270711) Protein
           required for stability and translation of COX1 mRNA
           [2898 bp, 965 aa]
          Length = 965

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 254 PHIKSLSLFSIFVIVFPILMDQLIQLESIDERPSMW 289
           P+IK   L SIF  +FP  + QLI +  IDE P +W
Sbjct: 766 PNIK---LRSIFSGLFPYKVSQLIAMNKIDELPLLW 798

>KLLA0D14707g 1242483..1245125 weakly similar to sp|P53253
           Saccharomyces cerevisiae YGR089w singleton, hypothetical
           start
          Length = 880

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 438 GKWGRYHWPGTRKTIEGTLSFIIGTSIVAYILKYYME-YFAD 478
           G  G    P  RK+ +  L F+I  +I+A+ILKYY + YF +
Sbjct: 126 GVNGETTKPRLRKSKKKLLFFLIQEAILAFILKYYGDKYFTE 167

>ACR024W [1072] [Homologous to ScYPL268W (PLC1) - SH]
           complement(400381..403014) [2634 bp, 877 aa]
          Length = 877

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 27/58 (46%)

Query: 18  KDMSQIQEEEKKRKEVDTDPVLNDRWLEDIFSSVPEKLIQIFILASSVFLCYKQYGAV 75
           KD+   +  +  R++ D       RW+  I+   P KL  + ++A +   C K Y AV
Sbjct: 172 KDIRMAEMAKNYREQYDIMDAFASRWITIIYQVSPTKLKALHLIAPTQLECAKFYNAV 229

>CAGL0I02508g 222770..223297 similar to sp|P38865 Saccharomyces
           cerevisiae YHR175w CTR2 copper transport protein,
           hypothetical start
          Length = 175

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 432 LASIIGGKWGRYHWPGTRKTIE-GTLS 457
           LA ++G  WG YHW G R T E GTL+
Sbjct: 148 LAVVVGAIWGHYHW-GIRCTPEAGTLA 173

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.325    0.141    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,497,818
Number of extensions: 643060
Number of successful extensions: 2382
Number of sequences better than 10.0: 15
Number of HSP's gapped: 2399
Number of HSP's successfully gapped: 15
Length of query: 519
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 413
Effective length of database: 12,926,601
Effective search space: 5338686213
Effective search space used: 5338686213
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)