Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_709.5447047019510.0
Sklu_2168.34794907617e-96
Kwal_26.81704935026819e-84
KLLA0D11220g4775116138e-74
YMR014W (BUD22)5195225409e-63
ABR052W5092254453e-49
CAGL0M07678g4731272429e-22
KLLA0E16797g671117730.80
ADR012C1319139683.0
Scas_711.22*101849655.9
KLLA0B04840g771121656.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_709.54
         (470 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_709.54                                                           756   0.0  
Sklu_2168.3 YMR014W, Contig c2168 4667-6106                           297   7e-96
Kwal_26.8170                                                          266   9e-84
KLLA0D11220g 958249..959682 weakly similar to sp|Q04347 Saccharo...   240   8e-74
YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possi...   212   9e-63
ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH] complement(...   176   3e-49
CAGL0M07678g complement(767857..769278) similar to sp|Q04347 Sac...    98   9e-22
KLLA0E16797g 1487301..1489316 some similarities with sp|P39875 S...    33   0.80 
ADR012C [1753] [Homologous to ScYER008C (SEC3) - SH] (725113..72...    31   3.0  
Scas_711.22*                                                           30   5.9  
KLLA0B04840g 439864..442179 weakly similar to ca|CA4996|IPF2029 ...    30   6.2  

>Scas_709.54
          Length = 470

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/470 (82%), Positives = 388/470 (82%)

Query: 1   MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED 60
           MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED
Sbjct: 1   MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED 60

Query: 61  VERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDKTTLEAIKNQYGIPQF 120
           VERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDKTTLEAIKNQYGIPQF
Sbjct: 61  VERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDKTTLEAIKNQYGIPQF 120

Query: 121 AKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPSRIWNEVIMKI 180
           AKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPSRIWNEVIMKI
Sbjct: 121 AKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPSRIWNEVIMKI 180

Query: 181 KKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQREKNGLNKASSSNNEVEMQE 240
           KKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQREKNGLNKASSSNNEVEMQE
Sbjct: 181 KKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQREKNGLNKASSSNNEVEMQE 240

Query: 241 DDASEDDELTERPALRRETRXXXXXXXXXXXLNQYEGMXXXXXXXXXXXXXXXXKTINYN 300
           DDASEDDELTERPALRRETR           LNQYEGM                KTINYN
Sbjct: 241 DDASEDDELTERPALRRETRDEDQEIDEDEILNQYEGMLAASDDEEGEEASGLDKTINYN 300

Query: 301 EVTXXXXXXXXXXXXXXXXRKKPKLPELMXXXXXXXXXXXXXKEDKIAREQMSNKPXXXX 360
           EVT                RKKPKLPELM             KEDKIAREQMSNKP    
Sbjct: 301 EVTDEEPSDDEDSESEEPSRKKPKLPELMGGYYSGGESSDDEKEDKIAREQMSNKPQRKN 360

Query: 361 XXXXXXXXXIWEKKYGSQAKHVQREVEKEFEERKQRQIAYXXXXXXXXXXXXXFQKMVRE 420
                    IWEKKYGSQAKHVQREVEKEFEERKQRQIAY             FQKMVRE
Sbjct: 361 RRGQRARRKIWEKKYGSQAKHVQREVEKEFEERKQRQIAYEERAAKRAAKEEAFQKMVRE 420

Query: 421 HELERESKQGQSKWPKVKEPQAEHPSWVAKRVAEEKEKNAKFSGKKVVFD 470
           HELERESKQGQSKWPKVKEPQAEHPSWVAKRVAEEKEKNAKFSGKKVVFD
Sbjct: 421 HELERESKQGQSKWPKVKEPQAEHPSWVAKRVAEEKEKNAKFSGKKVVFD 470

>Sklu_2168.3 YMR014W, Contig c2168 4667-6106
          Length = 479

 Score =  297 bits (761), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 184/490 (37%), Positives = 263/490 (53%), Gaps = 31/490 (6%)

Query: 1   MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED 60
           MPK+NL+FKLDNLEYQ HYLNNTLD F+PRL+ T K ++AKG+KT KK+ KLL++  ++ 
Sbjct: 1   MPKENLIFKLDNLEYQYHYLNNTLDDFKPRLSSTNKLFHAKGKKTSKKISKLLSDATLDS 60

Query: 61  VERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDKT--------TLEAIK 112
           V +QL++++    +KK++H +  L   L K L+ +   L K  ++          LE IK
Sbjct: 61  VSQQLDDLRQSFLEKKVYHLQKRLESYLEKALQQQYDALPKKAEQKENDKKNLKALEDIK 120

Query: 113 NQYGIPQFAKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPSRI 172
           + +   +F++L+  SK ++L   KI P     E+ PQWF   +   +Y+DK +E NPS +
Sbjct: 121 SDFTFTKFSQLIAKSKIVRLVISKITPTKTLKENPPQWFESSDILHVYRDKEDECNPSNV 180

Query: 173 WNEVIMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQREKNGLNKASSS 232
           WN+V+MKI+  + L+S++MN KK K++I SF+ GMDVFLGIN+ KKLQ +K   NK SS+
Sbjct: 181 WNKVVMKIEGCEKLLSVMMNSKKYKELIDSFDRGMDVFLGINREKKLQNKKVEANKKSSN 240

Query: 233 NNEVEMQEDDASEDDELTERPALRRETRXXXXXXXXXXXLNQYEGMXXXXXXXXXXXXXX 292
                  +DD+ ED   T+     RE             + QY+GM              
Sbjct: 241 -----ALDDDSGED--FTDDGVSDREDDAEFSTADEEALVQQYKGMLAGSDEEDDADEQQ 293

Query: 293 X---XKTINYNEVTXXXXXXXXX---------XXXXXXXRKKPKLPELMXXXXXXXXXXX 340
                  ++YNEVT                         + K +LPELM           
Sbjct: 294 GYHLDPNVDYNEVTDEEPTDNESELEEEEKLEEPPKKKQKNKAQLPELM-AGYFSGGSDD 352

Query: 341 XXKEDKIAREQMSNKPXXXXXXXXXXXXXIWEKKYGSQAKHVQREVEKEFEERKQRQIAY 400
             ++D+IA+EQ+SN+P             IWEKKYG  AKHVQR+ EK+ EER++RQ+ Y
Sbjct: 353 EIEDDRIAKEQLSNEPKRKNRRGQRARQKIWEKKYGKNAKHVQRQHEKDKEEREKRQVEY 412

Query: 401 XXXXXXXXXXXXXFQKMVREHELERESKQGQSKWPKVKEPQAEHPSWVAKRVAEEKEKNA 460
                          +  RE     E ++ Q +  K  +P   HPSW AK+ AEE+ KN 
Sbjct: 413 EERVAKRAANSVRLAEEAREKAQRLEERKRQQE-EKRNDPI--HPSWQAKKQAEERLKNV 469

Query: 461 KFSGKKVVFD 470
           KF GKKV FD
Sbjct: 470 KFQGKKVTFD 479

>Kwal_26.8170
          Length = 493

 Score =  266 bits (681), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 174/502 (34%), Positives = 252/502 (50%), Gaps = 42/502 (8%)

Query: 1   MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED 60
           MPK+NL+FKLDNLEYQ H+LNN+LD F+PRL+ T K +NAKG+K  K+++KLL E  + +
Sbjct: 1   MPKENLIFKLDNLEYQYHHLNNSLDGFQPRLSGTAKTFNAKGKKASKRIQKLLYESNLTE 60

Query: 61  VERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDK------TTLEAIKNQ 114
           V R L+ ++ EI +KK +H EN L   L K L+ + S L+KN ++       TL  ++  
Sbjct: 61  VSRALDSLRREIVEKKAYHLENKLASLLEKNLQQQYSSLLKNSNEKNKDRLKTLATLEKS 120

Query: 115 YGIPQFAKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPSRIWN 174
           Y IP F+KL+   ++ KL   K++      ED PQW   + Y  I+ DKNN  NP ++WN
Sbjct: 121 YTIPGFSKLIAKYRTCKLLVPKLLFTKALREDPPQWLKDNEYVTIFNDKNNTHNPGKVWN 180

Query: 175 EVIMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQREKNGLNKASSSNN 234
           EVI+  +  + L+SL MNDKK+K+++  F++ MD+F+  NK K+ +  +N  N+ S  + 
Sbjct: 181 EVIVATEGCERLLSLTMNDKKIKELLSGFDSAMDLFM--NKKKEREASQNNTNEQSKPSR 238

Query: 235 EVEMQEDDASED---DELTERPALRRETRXXXXXXXXXXXLNQYEGM-XXXXXXXXXXXX 290
            V   ++ +SED   D      +   E             L QYEGM             
Sbjct: 239 AVPETDERSSEDENGDNDFASSSSEGEDADGSALIDEDEILKQYEGMLVASDEEGEDLTM 298

Query: 291 XXXXKTINYNEVTXXXXXXX-----------------------XXXXXXXXXRKKPKLPE 327
                 INYNEVT                                       + K  LPE
Sbjct: 299 PSLNPDINYNEVTDEEPSESENDSDISLSDGEEDVPPLKKQKRSQEREDDQSKVKTNLPE 358

Query: 328 LMXXXXXXXXXXXXXKEDKIAREQMSNKPXXXXXXXXXXXXXIWEKKYGSQAKHVQREVE 387
           LM              ED++A +Q SN+P             IWEKKYG  AKHVQR+VE
Sbjct: 359 LMTGYYSGGSDDEIS-EDEVAAKQASNEPKRKNRRGQRARQKIWEKKYGHNAKHVQRQVE 417

Query: 388 KEFEERKQRQIAYXXXXXXXXXXXXXFQKMVREHELERESKQGQSKWPKVKEPQAEHPSW 447
            E  ER++++  Y              +   R+   + ++ +  +K   +      HPSW
Sbjct: 418 AEKSERERKKQEYEARVAKRAARAQDREATTRKRPSDPKTWEAPAKDAPI------HPSW 471

Query: 448 VAKRVAEEKEKNAKFSGKKVVF 469
            AK++AEEK+K AKF GKK+VF
Sbjct: 472 EAKKMAEEKQKGAKFQGKKIVF 493

>KLLA0D11220g 958249..959682 weakly similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w singleton, start by
           similarity
          Length = 477

 Score =  240 bits (613), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 177/511 (34%), Positives = 249/511 (48%), Gaps = 77/511 (15%)

Query: 1   MPKDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKIED 60
           M KDNL+FKLDNLEYQ HY+NN  + F+PR  QT +F+N+K RKT KKV KLL     + 
Sbjct: 1   MGKDNLIFKLDNLEYQIHYMNNEAEQFQPRFKQTLQFFNSKSRKTNKKVTKLLEAADKQK 60

Query: 61  VERQLNEIKLEIFDKKIHH----FENNLTKNLIKLLENENSKLIKNFDKTTLEAIKNQYG 116
           +  +++ ++L+I D+KIHH     + +  KN + L E E +K+                G
Sbjct: 61  INGEISSLRLKILDQKIHHVLQRLQTHWIKNPLILREPEVAKI----------------G 104

Query: 117 IPQFAKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPSRIWNEV 176
             QF K +  SK +KLT   ++  +K     P+WF +H +++I  DK NE NPSRI+N V
Sbjct: 105 AEQFIKYMSYSKLVKLTMS-LMGGNKTC---PEWFREHEFYQISNDKTNELNPSRIYNGV 160

Query: 177 IMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINKGKKLQREK------------- 223
             K  K ++LVS ++N+K VKD+IQ++ENG+ V L  N+  K+Q++              
Sbjct: 161 FSK-NKLNSLVSKLLNNKNVKDLIQTYENGIHVIL--NEKDKIQKDTTTASTKQSKTKSE 217

Query: 224 --------NGLNKASSSNNEVEMQEDDASEDDELTERPALRRETRXXXXXXXXXXXLNQY 275
                   +G++K      E E + D   E+ E  E P L  ET              QY
Sbjct: 218 DTSTDKNIDGVSKTEKGATESESESDLLEENSE-REAPELDSETEELLSK--------QY 268

Query: 276 EGMXXXXXXXXXXXXXXXXKTINYNEVTXXXXXXX----------XXXXXXXXXRKKPK- 324
           +G+                 TI+YN+VT                           KKPK 
Sbjct: 269 DGL-LVGSDEESEPEFQLDPTIDYNQVTDEEDKEEYSADEDDEENSDSDSGEPSNKKPKY 327

Query: 325 -LPELMXXXXXXXXXXXXXKEDKIAREQMSNKPXXXXXXXXXXXXXIWEKKYGSQAKHVQ 383
            LPELM              +DK+AR+Q++  P             IWEKKYGSQAKHVQ
Sbjct: 328 NLPELMNGYISGDEEEDL--DDKVARKQIAAVPVKKNRRGQRARQKIWEKKYGSQAKHVQ 385

Query: 384 REVEKEFEERKQRQIAYXXXXXXXXXXXXXFQKMVREHELERESKQGQSKWPKVKEP--- 440
           R++EKE +ER+ RQ  Y               +  R+   +  S+   S  P   +P   
Sbjct: 386 RQLEKEHKERETRQQEYEQRQAKREAKAAQLAEQQRKRVSQYNSQSSTSNIPPPPQPVIT 445

Query: 441 --QAEHPSWVAKRVAEEKEKNAKFSGKKVVF 469
             +  HPSW AKR+AEEK+KN KF GKK+ F
Sbjct: 446 ADKPIHPSWEAKRIAEEKQKNVKFQGKKITF 476

>YMR014W (BUD22) [3978] chr13 (298867..300426) Protein with possible
           role in bud site polarity, has possible coiled-coil
           domain [1560 bp, 519 aa]
          Length = 519

 Score =  212 bits (540), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 172/522 (32%), Positives = 251/522 (48%), Gaps = 55/522 (10%)

Query: 1   MPKDNL--LFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKI 58
           MP ++   ++KLD LEYQ HYL  +L  FEPR  +T K YN  G+K  KK+EKLLN +++
Sbjct: 1   MPSESSVSIYKLDQLEYQYHYLTKSLQKFEPRYPKTAKLYNCIGKKNKKKIEKLLNSLEL 60

Query: 59  EDVERQLNEIKLEIFDKKIHHFENNLTKNL---IKLLENENSKLIKNFDKTTLEAI---- 111
           + ++++L+E   ++ + KIH++E +L+K +   I+ +  +NS  +K+  K    +I    
Sbjct: 61  KTLDKELDESYSKLLNNKIHYYETHLSKCIKEQIQKISKKNSSKVKDAQKNKSPSIDIEK 120

Query: 112 --KNQYGIPQFAKLLCLSKSIKLTTGKIVPKSKKIE-DT--PQWFVKHNYWEIYQDKNNE 166
               Q  +   A  +   + IK+   +I  KSKKIE DT    W   ++Y     DK ++
Sbjct: 121 MLATQLSLDDLALFMTRFRLIKILHQRIKQKSKKIEGDTNNKTWLNNNDYSGYINDKTSK 180

Query: 167 FNPSRIWNEVIMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGIN----KGKKL-QR 221
           +NPS IWNEVI K+   + L +LI   K V+++ +SF+  + +  G +    K KK   R
Sbjct: 181 WNPSNIWNEVITKLPSCEKLNALIGQSKIVQNLTESFDLSICLIFGFDVSAMKAKKYGAR 240

Query: 222 EKNGLNKASSSNNEVEMQEDDASEDDELTERP-ALRRETRXXXXXXXXXXXL--NQYEGM 278
           EK     A+ +++ ++   DD +E + +  +  A+  +T+           L   +YEGM
Sbjct: 241 EKTA--NANQTHSNIDYDTDDGNEKNAIDSKSNAIGAQTQSNKETTSDNEDLLIKEYEGM 298

Query: 279 XXXXXXXXXXXXXXXXKTINYNEVTXXXXXXXXXXXXXXX-----------XRKKPK--- 324
                             INYNEVT                           RKKPK   
Sbjct: 299 -LGSSGDEGEGGGYLNPNINYNEVTDEEPSEASSDEDDSDERFSDSEENEPRRKKPKLHN 357

Query: 325 LPELMXXXXXXXXXXXXX----------------KEDKIAREQMSNKPXXXXXXXXXXXX 368
           LPELM                              ED+ AREQMSN+P            
Sbjct: 358 LPELMAGYYSGNDTEEESDEDNKNVKGKKKKRDTAEDRTAREQMSNEPKRKNRRGQRARR 417

Query: 369 XIWEKKYGSQAKHVQREVEKEFEERKQRQIAYXXXXXXXXXXXXXFQKMVREHELERESK 428
            IWEKKYGSQAKHVQRE+EKE E+RKQRQI Y              +        +R ++
Sbjct: 418 KIWEKKYGSQAKHVQRELEKEMEDRKQRQIEYEARVAKREAKAASLEASRSREREDRRTE 477

Query: 429 QGQSKWPKVKEPQAEHPSWVAKRVAEEKEKNAKFSGKKVVFD 470
               K  +      EHPSW+AKR+AEEK + AKF GKK+ FD
Sbjct: 478 TNNKKEKESASTGEEHPSWIAKRLAEEKLQKAKFEGKKIKFD 519

>ABR052W [643] [Homologous to ScYMR014W (BUD22) - SH]
           complement(490427..491956) [1530 bp, 509 aa]
          Length = 509

 Score =  176 bits (445), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 131/225 (58%), Gaps = 10/225 (4%)

Query: 1   MP--KDNLLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIKI 58
           MP  K NL++KLD+ EYQ H LNNT+  F PRL  T K+YN +G+K  ++VEKLL  +  
Sbjct: 1   MPLNKPNLVYKLDHAEYQYHLLNNTVAEFHPRLGATAKYYNPQGKKAAQRVEKLLAGLTA 60

Query: 59  EDVERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDK--------TTLEA 110
           + + +Q++ +K E+ D K+HH E+ L+  L+K LEN+ + L KN  K          LE 
Sbjct: 61  DGLLQQISSLKAELLDHKVHHVESKLSHLLVKQLENQATVLRKNPKKDEQRNSKLQVLEG 120

Query: 111 IKNQYGIPQFAKLLCLSKSIKLTTGKIVPKSKKIEDTPQWFVKHNYWEIYQDKNNEFNPS 170
           ++   G  QF +L+  SK +K+  GKI P      D P WF  H   + + +K +E NP 
Sbjct: 121 VQRGPGFEQFVRLIVRSKVVKIVLGKICPTKALKNDPPAWFQNHRILQQFGNKEDECNPG 180

Query: 171 RIWNEVIMKIKKSDALVSLIMNDKKVKDIIQSFENGMDVFLGINK 215
           R+W EV+  +   + LVS +++ K  +D++ + E  +D+ LG  K
Sbjct: 181 RVWKEVVQAVAGGEQLVSQLLSTKAARDLLAALEASVDLVLGTKK 225

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 72/162 (44%), Gaps = 20/162 (12%)

Query: 320 RKKPKLPELMXXXXXXXXXXXXXKEDKIAREQMSNKPXXXXXXXXXXXXXIWEKKYGSQA 379
           + K +LP LM             + D   + +    P             IWEKKYG  A
Sbjct: 357 KTKVQLPALMAGYYSGDDDSDAEEHDLAGKAEPLEPPKRKNRRGQRARQKIWEKKYGRNA 416

Query: 380 KHVQREVEKEFEERKQRQIAYXXXXXXXXXXXXXFQKMVREHELERESKQGQSKWPKVKE 439
           KH+Q++ EKE EER ++Q  Y              ++  +E EL R     +    +  E
Sbjct: 417 KHIQQQFEKEREERARKQREYEERAA---------KRPAKEAELARTRPAFKDSAIRAAE 467

Query: 440 PQAE-----------HPSWVAKRVAEEKEKNAKFSGKKVVFD 470
           P A            HPSW AK++++EK+K AKF GKK+VFD
Sbjct: 468 PGAAKSAAKPVAQELHPSWEAKKLSQEKQKAAKFQGKKIVFD 509

>CAGL0M07678g complement(767857..769278) similar to sp|Q04347
           Saccharomyces cerevisiae YMR014w, hypothetical start
          Length = 473

 Score = 97.8 bits (242), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 80/127 (62%), Gaps = 5/127 (3%)

Query: 345 DKIAREQMSNKPXXXXXXXXXXXXXIWEKKYGSQAKHVQREVEKEFEERKQRQIAYXXXX 404
           D IA+EQ+  KP             IWE+KYGS+AKHVQRE+EKE E++++RQ  Y    
Sbjct: 351 DDIAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQREIEKEMEKKRKRQAEYEERV 410

Query: 405 XXXXXXXXXFQK-MVREHELERESKQGQSKWPKVKEPQAEHPSWVAKRVAEEKEKNAKFS 463
                     ++   ++ E++RE ++ + K  K++    +HPSWVAK++AE+KEKNAKF+
Sbjct: 411 AKRAARAEQNEEYQAKKAEIKREKEEHRKKLEKIE----DHPSWVAKKMAEDKEKNAKFA 466

Query: 464 GKKVVFD 470
           GKK+ FD
Sbjct: 467 GKKITFD 473

>KLLA0E16797g 1487301..1489316 some similarities with sp|P39875
           Saccharomyces cerevisiae YOR033c DHS1 exonuclease which
           interacts with MSH2P, hypothetical start
          Length = 671

 Score = 32.7 bits (73), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 30/117 (25%)

Query: 119 QFAKLLCLSKS--------IKLTTG-KIVPKSKKIEDTPQWF-------VKHNYWEIYQD 162
           Q   L+CLS          + L T  K V K++ +E             V H +WE YQ 
Sbjct: 217 QLRSLVCLSGCDYTSGIPKVGLVTAMKYVVKNRTMEQMIMAIKREGKLSVPHTFWEEYQY 276

Query: 163 KNNEFNPSRIWNEVIMKIKKSDALVSLIMNDK--------------KVKDIIQSFEN 205
            N  F   R+W  +  ++   +A+ + ++N++              K+KD+I  FE+
Sbjct: 277 ANFAFQFQRVWCPLNERLVTLNAIPNELLNNEKLFNCIGHAIHKEWKIKDVIFDFED 333

>ADR012C [1753] [Homologous to ScYER008C (SEC3) - SH]
           (725113..729072) [3960 bp, 1319 aa]
          Length = 1319

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 62/139 (44%), Gaps = 19/139 (13%)

Query: 6   LLFKLDNLEYQQHYLNNTLDSFEPRLNQTRKFYNAKGRKTIKKVEKLLNEIK-------- 57
           LL K+   EYQ    N  L S  P+     K Y AK  +   +++  L+           
Sbjct: 640 LLLKVAEAEYQ---FNKQLMSL-PKKASDLKLYKAKTVQECDRMDPTLSLFTMELSSISK 695

Query: 58  -IEDVERQLNEIKLEIFDKKIHHFENNLTKNLIKLLENENSKLIKNFDKTTLEAIKNQYG 116
            IE VERQ N +++   +KK+      L+K+L  +L++ +       +   L  ++ ++G
Sbjct: 696 DIEYVERQSNGLQVNCVNKKL------LSKDLSGILDSVSLAESSLEELLNLSLVEKEFG 749

Query: 117 IPQFAKLLCLSKSIKLTTG 135
           +   + LL L K+I    G
Sbjct: 750 LRVESLLLGLHKAIGAIKG 768

>Scas_711.22*
          Length = 1018

 Score = 29.6 bits (65), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 152 VKHNYWEIYQDKNNEFNPSRIWNEVIMKIKKSDALVSLIMN-DKKVKDI 199
           + +++W+  QD +NE + S+I     +KI K D  V+ + + DKK+  +
Sbjct: 1   MSNSFWKFGQDYSNEASISKILRNAFLKITKDDEAVTTVNDIDKKIDSL 49

>KLLA0B04840g 439864..442179 weakly similar to ca|CA4996|IPF2029
           Candida albicans unknown function, hypothetical start
          Length = 771

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 51/121 (42%), Gaps = 22/121 (18%)

Query: 88  LIKLLE-NENSKLIK-NFDKTTLEAIKNQYGIPQFAKLLCLSKSIKLTTGKIVPKSKKIE 145
           LIKL   + NS  IK + D T L A K             +S+S  L   K+  K K + 
Sbjct: 604 LIKLWHPHSNSSEIKESADSTELSATKE------------ISRSSALALLKLATKDKDLT 651

Query: 146 DTPQWFVKHNYWEIYQDKNNEFNPSRIWNEVIMKIKKSDALV--------SLIMNDKKVK 197
              Q+F  H Y  +Y       NPS I      + K+S ALV        +  ++DK +K
Sbjct: 652 QIFQFFPTHIYVMLYYASLVVLNPSMIAERSEKECKQSYALVTKLKKMLQTATISDKTLK 711

Query: 198 D 198
           D
Sbjct: 712 D 712

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 13,933,466
Number of extensions: 610357
Number of successful extensions: 3316
Number of sequences better than 10.0: 137
Number of HSP's gapped: 3276
Number of HSP's successfully gapped: 148
Length of query: 470
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 365
Effective length of database: 12,961,219
Effective search space: 4730844935
Effective search space used: 4730844935
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)