Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_709.5352352328060.0
YMR015C (ERG5)53852424380.0
Sklu_2168.454050123710.0
CAGL0M07656g53550423280.0
KLLA0D11242g53450122470.0
ABR053C51548020360.0
Kwal_26.817233633615360.0
KLLA0E03553g5273682387e-21
Kwal_47.183235362262111e-17
CAGL0E04334g5332312012e-16
Sklu_2436.115321932004e-16
ADR162W5291941985e-16
YHR007C (ERG11)5301921861e-14
Scas_699.205381971729e-13
CAGL0F02607g4981511103e-05
Kwal_47.18804508203960.001
KLLA0C06743g513166880.011
KLLA0F19184g51250720.93
Kwal_14.179636363673.2
AFR661W117925683.5
Sklu_1987.252367664.7
Scas_584.536746655.6
AFR020W65667657.2
CAGL0C05445g111252658.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_709.53
         (523 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_709.53                                                          1085   0.0  
YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrom...   943   0.0  
Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement        917   0.0  
CAGL0M07656g 765772..767379 highly similar to sp|P54781 Saccharo...   901   0.0  
KLLA0D11242g complement(959973..961577) highly similar to sp|P54...   870   0.0  
ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH] (492258..493...   788   0.0  
Kwal_26.8172                                                          596   0.0  
KLLA0E03553g 329904..331487 highly similar to sp|P10614 Saccharo...    96   7e-21
Kwal_47.18323                                                          86   1e-17
CAGL0E04334g complement(415351..416952) highly similar to sp|P10...    82   2e-16
Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement      82   4e-16
ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH] complement...    81   5e-16
YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrom...    76   1e-14
Scas_699.20                                                            71   9e-13
CAGL0F02607g complement(253736..255232) similar to sp|P21595 Sac...    47   3e-05
Kwal_47.18804                                                          42   0.001
KLLA0C06743g complement(590585..592126) similar to sp|P21595 Sac...    39   0.011
KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102 Saccha...    32   0.93 
Kwal_14.1796                                                           30   3.2  
AFR661W [3854] [Homologous to ScYGL140C - NSH] complement(164245...    31   3.5  
Sklu_1987.2 YBL015W, Contig c1987 2738-4309                            30   4.7  
Scas_584.5                                                             30   5.6  
AFR020W [3212] [Homologous to ScYBL015W (ACH1) - SH] complement(...    30   7.2  
CAGL0C05445g 517886..521224 similar to tr|Q07660 Saccharomyces c...    30   8.3  

>Scas_709.53
          Length = 523

 Score = 1085 bits (2806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/523 (100%), Positives = 523/523 (100%)

Query: 1   METIMDNSTMEFVQQQTPSTLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPR 60
           METIMDNSTMEFVQQQTPSTLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPR
Sbjct: 1   METIMDNSTMEFVQQQTPSTLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPR 60

Query: 61  FKIWPIIGPFLESLDPKFEEYKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFVK 120
           FKIWPIIGPFLESLDPKFEEYKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFVK
Sbjct: 61  FKIWPIIGPFLESLDPKFEEYKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFVK 120

Query: 121 PCVVDVAIKILRPTNWVFLDGKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFIE 180
           PCVVDVAIKILRPTNWVFLDGKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFIE
Sbjct: 121 PCVVDVAIKILRPTNWVFLDGKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFIE 180

Query: 181 ISKENNYEPQVFFHEMREILCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPII 240
           ISKENNYEPQVFFHEMREILCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPII
Sbjct: 181 ISKENNYEPQVFFHEMREILCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPII 240

Query: 241 IPFTKTWYGKRTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSR 300
           IPFTKTWYGKRTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSR
Sbjct: 241 IPFTKTWYGKRTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSR 300

Query: 301 ILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMS 360
           ILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMS
Sbjct: 301 ILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMS 360

Query: 361 TELNIELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPS 420
           TELNIELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPS
Sbjct: 361 TELNIELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPS 420

Query: 421 LHDPEVYENPDEFIPERWEEGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFAL 480
           LHDPEVYENPDEFIPERWEEGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFAL
Sbjct: 421 LHDPEVYENPDEFIPERWEEGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFAL 480

Query: 481 YTDFEHKITPLSEKIKVFATIFPKDDLLMTFKKRDPITGKVFE 523
           YTDFEHKITPLSEKIKVFATIFPKDDLLMTFKKRDPITGKVFE
Sbjct: 481 YTDFEHKITPLSEKIKVFATIFPKDDLLMTFKKRDPITGKVFE 523

>YMR015C (ERG5) [3979] chr13 complement(300868..302484) Cytochrome
           P450, delta 22(23) sterol desaturase, catalyzes an
           intermediate pathway step in the biosynthesis of
           ergosterol [1617 bp, 538 aa]
          Length = 538

 Score =  943 bits (2438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/524 (83%), Positives = 482/524 (91%), Gaps = 7/524 (1%)

Query: 7   NSTMEFVQQQTPS-------TLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGP 59
           NST+  + +  PS       +++ T++ +SY KIF T ICI+LVWDQ++YQIKKGSIAGP
Sbjct: 15  NSTLHQLAKDQPSVGVTTAFSILDTLKSMSYLKIFATLICILLVWDQVAYQIKKGSIAGP 74

Query: 60  RFKIWPIIGPFLESLDPKFEEYKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFV 119
           +FK WPIIGPFLESLDPKFEEYKAKW SG LSCVSIFHKFV+I+STRD++RKI QSSKFV
Sbjct: 75  KFKFWPIIGPFLESLDPKFEEYKAKWASGPLSCVSIFHKFVVIASTRDLARKILQSSKFV 134

Query: 120 KPCVVDVAIKILRPTNWVFLDGKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFI 179
           KPCVVDVA+KILRP NWVFLDGKAH DYRKSLNGLFTK ALAQYLPS EQ+MDKY+ KF+
Sbjct: 135 KPCVVDVAVKILRPCNWVFLDGKAHTDYRKSLNGLFTKQALAQYLPSLEQIMDKYMDKFV 194

Query: 180 EISKENNYEPQVFFHEMREILCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPI 239
            +SKENNYEPQVFFHEMREILCALSL +FCG YITEDQ+RKIADDYYLVTAALELVNFPI
Sbjct: 195 RLSKENNYEPQVFFHEMREILCALSLNSFCGNYITEDQVRKIADDYYLVTAALELVNFPI 254

Query: 240 IIPFTKTWYGKRTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDS 299
           IIP+TKTWYGK+TAD AMKIFE CAQM+KD+IA GGKP+CVMDAWCKLMHDAK  ND+DS
Sbjct: 255 IIPYTKTWYGKKTADMAMKIFENCAQMAKDHIAAGGKPVCVMDAWCKLMHDAKNSNDDDS 314

Query: 300 RILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDM 359
           RI HREF+NKEISEA+FTFLFASQDASSSLACWLFQIVADRPD+L KIR+EQ+ VRNNDM
Sbjct: 315 RIYHREFTNKEISEAVFTFLFASQDASSSLACWLFQIVADRPDVLAKIREEQLAVRNNDM 374

Query: 360 STELNIELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYP 419
           STELN++LI+KMKYTNMVIKETLRYRPPVLMVPYVVK+ FPV+PNYTAPKG+MLIPTLYP
Sbjct: 375 STELNLDLIEKMKYTNMVIKETLRYRPPVLMVPYVVKKNFPVSPNYTAPKGAMLIPTLYP 434

Query: 420 SLHDPEVYENPDEFIPERWEEGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFA 479
           +LHDPEVYENPDEFIPERW EGS ASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFA
Sbjct: 435 ALHDPEVYENPDEFIPERWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFA 494

Query: 480 LYTDFEHKITPLSEKIKVFATIFPKDDLLMTFKKRDPITGKVFE 523
           LYTDF H +TPLSEKIKVFATIFPKDDLL+TFKKRDPITG+VFE
Sbjct: 495 LYTDFHHTVTPLSEKIKVFATIFPKDDLLLTFKKRDPITGEVFE 538

>Sklu_2168.4 YMR015C, Contig c2168 6356-7978 reverse complement
          Length = 540

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/501 (82%), Positives = 474/501 (94%)

Query: 20  TLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPRFKIWPIIGPFLESLDPKFE 79
            +I ++Q +SYWK+FVT IC+ LVWDQ+SYQIKKGSIAGP++K+WP+IGPFLESLDPKFE
Sbjct: 37  NVIDSVQSISYWKLFVTIICVGLVWDQVSYQIKKGSIAGPKWKVWPVIGPFLESLDPKFE 96

Query: 80  EYKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFVKPCVVDVAIKILRPTNWVFL 139
           EYKAKWDSG LSCVSIFHKFV+I+STRD++RKI QS KFVKPCVVDVAIKILRP+NWVFL
Sbjct: 97  EYKAKWDSGPLSCVSIFHKFVVIASTRDLARKILQSPKFVKPCVVDVAIKILRPSNWVFL 156

Query: 140 DGKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFIEISKENNYEPQVFFHEMREI 199
           DGK H+DYRKSLNGLFTK+ALAQYLPSQE VM+KYL+KF+E+SKEN YEPQVFFHEMREI
Sbjct: 157 DGKQHVDYRKSLNGLFTKSALAQYLPSQENVMNKYLEKFVELSKENKYEPQVFFHEMREI 216

Query: 200 LCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPIIIPFTKTWYGKRTADAAMKI 259
           +CALSL+AFCG+YITEDQIRK+ADDYYLVTAALELVNFPII+PFTKTWYGK+TAD  MKI
Sbjct: 217 MCALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPIILPFTKTWYGKKTADMTMKI 276

Query: 260 FEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSRILHREFSNKEISEAIFTFL 319
           FEQCAQM+KD+IA GG   CVMDAWCKLMHDAK +ND DSR+LHREFSNKEISEAIFTFL
Sbjct: 277 FEQCAQMAKDHIASGGPTTCVMDAWCKLMHDAKNQNDADSRLLHREFSNKEISEAIFTFL 336

Query: 320 FASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIK 379
           FASQDASSSLACWLFQIVADRPD+LEKIR+EQ++VR ND +  L+++LI++MKYTNMV+K
Sbjct: 337 FASQDASSSLACWLFQIVADRPDVLEKIREEQLKVRENDPTKALSLDLIEEMKYTNMVVK 396

Query: 380 ETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPSLHDPEVYENPDEFIPERWE 439
           E+LRYRPPVLMVPYVVK+KFP+ PNY+APKGSMLIPTLYP+LHDPEVYENPDEFIPERW 
Sbjct: 397 ESLRYRPPVLMVPYVVKQKFPIAPNYSAPKGSMLIPTLYPALHDPEVYENPDEFIPERWV 456

Query: 440 EGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFEHKITPLSEKIKVFA 499
           EGSPA++AK+NWLVFG GPHVCLGQTYVM+TF AL+GKFA+YTDFEHK+TPLSEKIKVFA
Sbjct: 457 EGSPANQAKRNWLVFGSGPHVCLGQTYVMMTFTALIGKFAMYTDFEHKVTPLSEKIKVFA 516

Query: 500 TIFPKDDLLMTFKKRDPITGK 520
           TIFPKDDLL++FKKRDP+TG+
Sbjct: 517 TIFPKDDLLLSFKKRDPLTGE 537

>CAGL0M07656g 765772..767379 highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c C-22 sterol desaturase,
           start by similarity
          Length = 535

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/504 (81%), Positives = 471/504 (93%)

Query: 20  TLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPRFKIWPIIGPFLESLDPKFE 79
           +L+  +Q +SY ++FVT IC VLVWDQ+SYQ+KKG+IAGPRFK++PIIGPFLESLDPKFE
Sbjct: 32  SLLDKLQGMSYLQMFVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFE 91

Query: 80  EYKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFVKPCVVDVAIKILRPTNWVFL 139
           EYKAKWDSG LSCVSIFHKFVII+STRD++RK+ Q+ K+VKPCVVDVA+KILRP+NWVFL
Sbjct: 92  EYKAKWDSGPLSCVSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFL 151

Query: 140 DGKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFIEISKENNYEPQVFFHEMREI 199
           DGKAH DYRKSLNGLFTKTALAQYLP  E++MDKY++KF+E+SKENNYEPQ+FFHEMREI
Sbjct: 152 DGKAHTDYRKSLNGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREI 211

Query: 200 LCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPIIIPFTKTWYGKRTADAAMKI 259
           LCALSLR+FCG+YI+EDQIRKIADDYYLVTAALELVNFPII+PFTKTWYGKRTAD AMKI
Sbjct: 212 LCALSLRSFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKI 271

Query: 260 FEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSRILHREFSNKEISEAIFTFL 319
           FE CAQ +KD+IA GGKPICVMD WCKLMHDAK + D+DSR+LHREF+N+EISEA+FTFL
Sbjct: 272 FESCAQRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFL 331

Query: 320 FASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIK 379
           FASQDASSSLACWLFQIVADRPD+L KIR+EQ+ VR  D++  L+I+L+DKM+YT+MV+K
Sbjct: 332 FASQDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVK 391

Query: 380 ETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPSLHDPEVYENPDEFIPERWE 439
           ETLRYRPPVLMVPYVVK KFPV P+Y APKGSMLI TLYP+LHDPEVYENPD+FIPERW 
Sbjct: 392 ETLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERWV 451

Query: 440 EGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFEHKITPLSEKIKVFA 499
           EGSPA+EAKKNWLVFGCGPHVCLGQTYVMIT  AL+GKFAL+TDF+HK+TPLSEKIKVFA
Sbjct: 452 EGSPANEAKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFA 511

Query: 500 TIFPKDDLLMTFKKRDPITGKVFE 523
           TIFPKDDLL++FKKRDP+TG++ E
Sbjct: 512 TIFPKDDLLLSFKKRDPVTGEIKE 535

>KLLA0D11242g complement(959973..961577) highly similar to sp|P54781
           Saccharomyces cerevisiae YMR015c ERG5 C-22 sterol
           desaturase, start by similarity
          Length = 534

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/501 (77%), Positives = 465/501 (92%)

Query: 21  LISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPRFKIWPIIGPFLESLDPKFEE 80
           L+ T+QQ+SY+K+F T + IV+VWDQ+SYQI+KG+IAGP++K+WP+IGPFLES DPKFEE
Sbjct: 32  LVETVQQMSYFKLFCTLVAIVIVWDQVSYQIQKGNIAGPKWKVWPVIGPFLESFDPKFEE 91

Query: 81  YKAKWDSGALSCVSIFHKFVIISSTRDISRKIFQSSKFVKPCVVDVAIKILRPTNWVFLD 140
           Y AKW+SG LSCVSIFHKFV+I+STRD++RKIFQS ++VKPCVVDVA+KILRP+NWVFLD
Sbjct: 92  YLAKWNSGPLSCVSIFHKFVVIASTRDLARKIFQSPQYVKPCVVDVAVKILRPSNWVFLD 151

Query: 141 GKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQKFIEISKENNYEPQVFFHEMREIL 200
           GK H+DYRKSLNGLFTK ALA+Y+PSQE +MDKY++KFIE+SKEN YE +VFFH+MREI+
Sbjct: 152 GKEHVDYRKSLNGLFTKQALAKYMPSQELLMDKYIEKFIELSKENKYEARVFFHDMREIM 211

Query: 201 CALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPIIIPFTKTWYGKRTADAAMKIF 260
           CALSL+AFCG+YITEDQIRK+ADDYYLVTAALELVNFPIIIP+TKTWYGK+TAD  MKIF
Sbjct: 212 CALSLKAFCGDYITEDQIRKVADDYYLVTAALELVNFPIIIPYTKTWYGKKTADMTMKIF 271

Query: 261 EQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSRILHREFSNKEISEAIFTFLF 320
           EQCAQM+KD+IA GG+  CV+DAWC LMH+AK K+D DS++ HREF+N+E+SEAIFTFLF
Sbjct: 272 EQCAQMAKDHIAAGGESTCVLDAWCSLMHEAKNKDDADSKLYHREFTNREMSEAIFTFLF 331

Query: 321 ASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIKE 380
           ASQDASSSLACW+FQI+ADRPD++  IR+EQ+ VRNND + +L+++LID+MKYTNMV+KE
Sbjct: 332 ASQDASSSLACWIFQIIADRPDVMANIREEQLRVRNNDPNVKLSMDLIDEMKYTNMVVKE 391

Query: 381 TLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPSLHDPEVYENPDEFIPERWEE 440
           TLRYRPPV+MVPY VK+ FPV P Y+APKGSMLIPTLYP+LHDPEVYE+PDEFIPERW E
Sbjct: 392 TLRYRPPVIMVPYYVKKSFPVVPTYSAPKGSMLIPTLYPALHDPEVYEDPDEFIPERWVE 451

Query: 441 GSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALLGKFALYTDFEHKITPLSEKIKVFAT 500
           GS A++AKKNWLVFGCGPHVCLGQTYVM TF  L+GKFA+++D+EHK+TPLSEKIKVFAT
Sbjct: 452 GSAANQAKKNWLVFGCGPHVCLGQTYVMQTFTGLIGKFAMFSDWEHKVTPLSEKIKVFAT 511

Query: 501 IFPKDDLLMTFKKRDPITGKV 521
           IFPKDDLL++FKKRDP+TG+V
Sbjct: 512 IFPKDDLLLSFKKRDPLTGEV 532

>ABR053C [644] [Homologous to ScYMR015C (ERG5) - SH]
           (492258..493805) [1548 bp, 515 aa]
          Length = 515

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/480 (74%), Positives = 429/480 (89%), Gaps = 1/480 (0%)

Query: 45  DQISYQIKKGSIAGPRFKIWPIIGPFLESLDPKFEEYKAKWDSGALSCVSIFHKFVIISS 104
           DQ +Y+  KG IAGP +K+WP+IGPFLESLDPKFE Y+AKW SG LSCVSIFHKFV+I+S
Sbjct: 36  DQAAYRRNKGRIAGPAWKMWPLIGPFLESLDPKFEVYQAKWASGPLSCVSIFHKFVVIAS 95

Query: 105 TRDISRKIFQSSKFVKPCVVDVAIKILRPTNWVFLDGKAHIDYRKSLNGLFTKTALAQYL 164
           TRD++RKI QS K+VKPC+VDVA KILRPTNWVFLDG+AH+DYR+SLNGLFT+ ALA+YL
Sbjct: 96  TRDLTRKILQSPKYVKPCLVDVAKKILRPTNWVFLDGQAHLDYRRSLNGLFTRDALARYL 155

Query: 165 PSQEQVMDKYLQKFIEISKENNYEPQVFFHEMREILCALSLRAFCGEYITEDQIRKIADD 224
           PSQE V+D+Y+ KF+  S+E +YE +VFFHEMRE+LCALSL+AFCG YIT+DQ+RKIADD
Sbjct: 156 PSQEAVIDRYMAKFVAFSRETDYEHRVFFHEMREMLCALSLKAFCGSYITDDQVRKIADD 215

Query: 225 YYLVTAALELVNFPIIIPFTKTWYGKRTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAW 284
           YYLVTAALELVNFP+I+PFTKTWYGKRTAD AMKIFE+CAQ +K +IA GG+P CV+DAW
Sbjct: 216 YYLVTAALELVNFPLILPFTKTWYGKRTADMAMKIFERCAQEAKQHIAAGGEPTCVVDAW 275

Query: 285 CKLMHDAKTKNDEDSRILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDIL 344
           CKLM DAK K+D DSR+LHR+F+N+E+SEA+FTFLFASQDASSSLACWLFQIVADRPD+L
Sbjct: 276 CKLMLDAKAKDDADSRLLHRKFTNREMSEALFTFLFASQDASSSLACWLFQIVADRPDVL 335

Query: 345 EKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPN 404
            KIR+EQ+ VR ND S  L++ELID+MKYT+M +KE LRYRPPVLMVPY V E F V+ +
Sbjct: 336 AKIREEQLAVRRNDPSVPLSLELIDQMKYTHMAVKECLRYRPPVLMVPYQVHEAFAVSAD 395

Query: 405 YTAPKGSMLIPTLYPSLHDPEVYENPDEFIPERWE-EGSPASEAKKNWLVFGCGPHVCLG 463
           YTAPKGSML+ T+YP+LHDP VYENPD++IPERW+ E SPA++AKKNWLVFG GPHVCLG
Sbjct: 396 YTAPKGSMLVATMYPALHDPAVYENPDDYIPERWDGEQSPANQAKKNWLVFGSGPHVCLG 455

Query: 464 QTYVMITFAALLGKFALYTDFEHKITPLSEKIKVFATIFPKDDLLMTFKKRDPITGKVFE 523
           Q YV +TF AL+GKFAL+T+F+HK+T LSEKIKVFATIFP+DDLLM+FKKRDP+TG+  E
Sbjct: 456 QKYVFMTFTALIGKFALFTEFDHKVTSLSEKIKVFATIFPQDDLLMSFKKRDPLTGQTTE 515

>Kwal_26.8172
          Length = 336

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/336 (79%), Positives = 314/336 (93%)

Query: 175 LQKFIEISKENNYEPQVFFHEMREILCALSLRAFCGEYITEDQIRKIADDYYLVTAALEL 234
           ++KF+  S E N+EPQV+FHE+REI+CALSL+AFCG+YITE QIRK+ADDYYLVTAALEL
Sbjct: 1   MEKFVTYSAEKNFEPQVYFHELREIMCALSLKAFCGDYITESQIRKVADDYYLVTAALEL 60

Query: 235 VNFPIIIPFTKTWYGKRTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTK 294
           VNFPII+PFTKTWYG+RTAD  MKIFE+CAQM+KD+IA GGKP CVMDAWC+LMH+AK K
Sbjct: 61  VNFPIILPFTKTWYGQRTADMTMKIFEKCAQMAKDHIAAGGKPKCVMDAWCELMHNAKNK 120

Query: 295 NDEDSRILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEV 354
           NDEDSR+ HREF+N+EISEA+FTFLFASQDASSSLACWLFQIVADRPD+++KIR+EQ+ V
Sbjct: 121 NDEDSRLFHREFTNREISEAVFTFLFASQDASSSLACWLFQIVADRPDVMQKIREEQLRV 180

Query: 355 RNNDMSTELNIELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLI 414
           RNND S  L+++LID+MKYT MV+KETLRYRPPV+MVPYVVK KFP+ PNYTAPKG+MLI
Sbjct: 181 RNNDPSKPLSLDLIDEMKYTYMVVKETLRYRPPVIMVPYVVKNKFPIAPNYTAPKGAMLI 240

Query: 415 PTLYPSLHDPEVYENPDEFIPERWEEGSPASEAKKNWLVFGCGPHVCLGQTYVMITFAAL 474
           PTLYP+LHDPEVY++P+EFIPERW EGSPA+EAKKNWLVFG G HVCLGQTYVM+TF AL
Sbjct: 241 PTLYPALHDPEVYDDPEEFIPERWVEGSPANEAKKNWLVFGSGSHVCLGQTYVMMTFTAL 300

Query: 475 LGKFALYTDFEHKITPLSEKIKVFATIFPKDDLLMT 510
           +GKFA+YT++EHK+TPLSEKIKVFATIFPKDDLL+T
Sbjct: 301 IGKFAMYTNWEHKVTPLSEKIKVFATIFPKDDLLLT 336

>KLLA0E03553g 329904..331487 highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11 cytochrome P450
           lanosterol 14a-demethylase, start by similarity
          Length = 527

 Score = 96.3 bits (238), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 94/368 (25%), Positives = 163/368 (44%), Gaps = 40/368 (10%)

Query: 135 NWVFLDGKAH--IDYRKSLNGLFTKTALAQYLPSQEQVMDKYL--QKFIEISKENNYEPQ 190
           N V  D   H  +D +K + G  T  A  +Y+P   + + KY    K   I ++++ +  
Sbjct: 137 NGVIYDCPNHRLMDQKKFVKGALTTDAFRKYVPLIAEEVQKYFLTSKNFSIGEKDHGKIN 196

Query: 191 VFFHEMREILCALSLRAFCGEYITEDQIRKIADDYYLVTAALELVNFPIIIPFTKTWYGK 250
           V   +  E+    + R+  G  + E    K+  D+  + + L+    P+   F+      
Sbjct: 197 VMVTQ-PEMTIFTASRSLLGSEMRE----KLNTDFAYLYSDLDKGFTPLNFVFSHLPLDN 251

Query: 251 -RTADAAMKIFEQCAQMSKDYIAKGGKPICVMDAWCKLMHDAKTKNDEDSRILHREFSNK 309
            R  D A ++      +S  Y++   K     D   + + D+  KN      +  + +++
Sbjct: 252 YRKRDNAQRV------ISSTYLSLIKKRRDTNDIQDRDLIDSLMKNSTYKDGV--KMTDQ 303

Query: 310 EISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELNIELID 369
           EI+  +   L   Q  S++ + W+   +A+RPDI EK+ +EQM+V +N  + EL  +L+ 
Sbjct: 304 EIANLLIGVLMGGQHTSAATSAWVILHLAERPDIQEKLYEEQMKVLDNG-TKELTFDLLQ 362

Query: 370 KMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPN--YTAPKG-SMLIPTLYPSLHDPEV 426
           +M   N  IKETLR   P+  +   V    PV PN  Y  PKG  +L+   Y  L D + 
Sbjct: 363 EMPLLNQTIKETLRLHHPLHSLFRKVMNDMPV-PNSSYVVPKGHHVLVSPGYCHLQD-KY 420

Query: 427 YENPDEFIPERWEEGSPASEAKKN----------------WLVFGCGPHVCLGQTYVMIT 470
           + N  EF P RW+  + +S A                   +L FG G H C+G+ +  + 
Sbjct: 421 FPNASEFNPNRWDNDAASSYASNEKVDYGFGSISKGVSSPYLPFGGGRHRCIGEHFAYMQ 480

Query: 471 FAALLGKF 478
              +L  +
Sbjct: 481 LGTILSNY 488

>Kwal_47.18323
          Length = 536

 Score = 85.9 bits (211), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 97/226 (42%), Gaps = 32/226 (14%)

Query: 280 VMDAWCKLMHDAKTKNDEDSRIL------------HREFSNKEISEAIFTFLFASQDASS 327
           +   + KL+   +  ND   R L              + +++EI+  +   L   Q  S+
Sbjct: 266 ISSTYMKLIKQRRENNDIQDRDLIDTLMKNSTYKDGTKMTDQEIANLLIGVLMGGQHTSA 325

Query: 328 SLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIKETLRYRPP 387
           + + W+   +A+RPD+ E++  EQMEV +N    EL  EL+ +M   N  IKETLR   P
Sbjct: 326 ATSAWMLLHLAERPDLQEELYAEQMEVLDNG-KKELTYELLQQMPLLNQTIKETLRMHHP 384

Query: 388 VLMVPYVVKEKFPV-TPNYTAPKGS-MLIPTLYPSLHDPEVYENPDEFIPERWEE----- 440
           +  +   V+   PV    Y  P+G  +L+   Y  L D E +   + F P RW       
Sbjct: 385 LHSIFRRVERDLPVPKTQYVVPRGHFVLVSPGYCHLQD-EYFPKANTFDPHRWNNDYKSS 443

Query: 441 -----------GSPASEAKKNWLVFGCGPHVCLGQTYVMITFAALL 475
                      G+ +      +L FG G H C+G+ +       L+
Sbjct: 444 YATGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLM 489

>CAGL0E04334g complement(415351..416952) highly similar to sp|P10614
           Saccharomyces cerevisiae YHR007c ERG11, start by
           similarity
          Length = 533

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 103/231 (44%), Gaps = 33/231 (14%)

Query: 279 CVMDAWCKLMHDAKTKNDEDSRILHREF------------SNKEISEAIFTFLFASQDAS 326
            +   +  L+ + + KND  +R L  E             +++EI+  +   L   Q  S
Sbjct: 261 AISGTYMSLIKERREKNDIQNRDLIDELMKNSTYKDGTKMTDQEIANLLIGVLMGGQHTS 320

Query: 327 SSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIKETLRYRP 386
           ++ + W    +A+RPD+ E++ +EQM V NND + EL  + +  M   N +IKETLR   
Sbjct: 321 AATSAWCLLHLAERPDVQEELYQEQMRVLNND-TKELTYDDLQNMPLLNQMIKETLRLHH 379

Query: 387 PVL-MVPYVVKEKFPVTPNYTAPKG-SMLIPTLYPSLHDPEVYENPDEFIPERWEEGSPA 444
           P+  +   V+++      +Y  P+   +L+   Y  L + E +  P+EF   RW+  + +
Sbjct: 380 PLHSLFRKVMRDVAIPNTSYVVPRDYHVLVSPGYTHLQE-EFFPKPNEFNIHRWDGDAAS 438

Query: 445 SEAKKN-----------------WLVFGCGPHVCLGQTYVMITFAALLGKF 478
           S A                    +L FG G H C+G+ +       L+  F
Sbjct: 439 SSAAGGDEVDYGFGAISKGVSSPYLPFGGGRHRCIGELFAYCQLGVLMSIF 489

>Sklu_2436.11 YHR007C, Contig c2436 26015-27613 reverse complement
          Length = 532

 Score = 81.6 bits (200), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/193 (27%), Positives = 89/193 (46%), Gaps = 22/193 (11%)

Query: 305 EFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELN 364
           + +++EI+  +   L   Q  S++ + WL   +A++P++ E++  EQM V +N    EL 
Sbjct: 299 KMTDQEIANLLIGVLMGGQHTSAATSAWLLLHLAEKPELQEELYAEQMRVLDNG-KKELT 357

Query: 365 IELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPN--YTAPKG-SMLIPTLYPSL 421
            +L+ +M   N  IKETLR   P+  +   V    PV PN  Y  PKG  +L+   Y  L
Sbjct: 358 YDLLQEMPLLNQTIKETLRMHHPLHSIFRKVMRDLPV-PNTSYVVPKGHHVLVSPGYAHL 416

Query: 422 HDPEVYENPDEFIPERWEE----------------GSPASEAKKNWLVFGCGPHVCLGQT 465
            D E + +   F P RW+                 GS +      +L FG G H C+G+ 
Sbjct: 417 RD-EYFPHAATFDPHRWDNDAASSYSSSEQVDYGFGSVSKGVSSPYLPFGGGRHRCVGEH 475

Query: 466 YVMITFAALLGKF 478
           +       ++  +
Sbjct: 476 FAYCQLGTIMSVY 488

>ADR162W [1904] [Homologous to ScYHR007C (ERG11) - SH]
           complement(987458..989047) [1590 bp, 529 aa]
          Length = 529

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 87/194 (44%), Gaps = 30/194 (15%)

Query: 305 EFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELN 364
           + ++++I+  +   L   Q  S++ + W+   +A+RPDI E++ +EQM V +   + EL 
Sbjct: 296 KMTDQQIANLLIGVLMGGQHTSAATSAWVLLHLAERPDIQEELYEEQMRVLDGG-AKELT 354

Query: 365 IELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPSLHDP 424
            EL+ +M   N VIKETLR   P+  +   V    PV      P  S +IP  +  L  P
Sbjct: 355 YELLQEMPLLNQVIKETLRMHHPLHSLFRKVTRDMPV------PNTSYVIPKDHYVLASP 408

Query: 425 -------EVYENPDEFIPERWEE----------------GSPASEAKKNWLVFGCGPHVC 461
                  E + N  EF P RW+                 G+ +      +L FG G H C
Sbjct: 409 GFCHLSEEYFPNAKEFNPHRWDNDAASSVSTGEKVDYGFGAISKGVSSPYLPFGGGRHRC 468

Query: 462 LGQTYVMITFAALL 475
           +G+ +  +    + 
Sbjct: 469 IGEGFAYMQLGTIF 482

>YHR007C (ERG11) [2293] chr8 complement(120085..121677) Cytochrome
           P450 (lanosterol 14alpha-demethylase), essential for
           biosynthesis of ergosterol [1593 bp, 530 aa]
          Length = 530

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/192 (26%), Positives = 89/192 (46%), Gaps = 20/192 (10%)

Query: 305 EFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELN 364
           + +++EI+  +   L   Q  S++ + W+   +A+RPD+ +++ +EQM V +     EL 
Sbjct: 298 KMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGG-KKELT 356

Query: 365 IELIDKMKYTNMVIKETLRYRPPVL-MVPYVVKEKFPVTPNYTAPKG-SMLIPTLYPSLH 422
            +L+ +M   N  IKETLR   P+  +   V+K+      +Y  P G  +L+   Y  L 
Sbjct: 357 YDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLR 416

Query: 423 DPEVYENPDEFIPERWEEGSPASEA----------------KKNWLVFGCGPHVCLGQTY 466
           D E + N  +F   RW + S +S +                   +L FG G H C+G+ +
Sbjct: 417 D-EYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHF 475

Query: 467 VMITFAALLGKF 478
                  L+  F
Sbjct: 476 AYCQLGVLMSIF 487

>Scas_699.20
          Length = 538

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/197 (24%), Positives = 86/197 (43%), Gaps = 30/197 (15%)

Query: 305 EFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELN 364
           + ++ EI+  +   L   Q  S++ + W    +A+RPD+ E++ +EQM V +N    E+ 
Sbjct: 305 KMTDPEIANLLIGVLMGGQHTSAATSAWCLLHLAERPDVQEELYQEQMRVLDNG-KKEIT 363

Query: 365 IELIDKMKYTNMVIKETLRYRPPVLMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPSLHDP 424
            +L+++M   N +IKETLR   P+    + +  K  V  +   P  S +IP  Y  L  P
Sbjct: 364 YDLLEQMPLLNQMIKETLRLHHPL----HSLFRK--VIRDMQVPNTSYVIPKDYFVLVSP 417

Query: 425 EVYENPDEFIPE-------RWEE----------------GSPASEAKKNWLVFGCGPHVC 461
                 + + P+       RW+                 G+        +L FG G H C
Sbjct: 418 GYTHLQEHYFPQAHSFNIHRWDNDAESSYVVGEEVDYGFGAITKGVTSPYLPFGGGRHRC 477

Query: 462 LGQTYVMITFAALLGKF 478
           +G+ Y       ++ +F
Sbjct: 478 IGEHYAYCQLGVIMAEF 494

>CAGL0F02607g complement(253736..255232) similar to sp|P21595
           Saccharomyces cerevisiae YDR402c DIT2 cytochrome P450,
           hypothetical start
          Length = 498

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 70/151 (46%), Gaps = 13/151 (8%)

Query: 375 NMVIKETLRYRPPV-LMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPSLHDPEVY-ENPDE 432
           N  + E LRY PP+ +++     ++  + P    PK + +    Y + HD   +    D 
Sbjct: 339 NSFLYECLRYYPPLSVIINRKTTKRCMLGPGIVVPKDTYVGYHNYSTCHDSNFWGHTSDI 398

Query: 433 FIPERW----EEGSPASEAKKNWLV---FGCGPHVCLGQTYVMITFAALLGKFALYTDFE 485
           F P RW    E  + A +  KN  +   F  G   CLG+  V ++   ++ +F   + FE
Sbjct: 399 FDPTRWGKDIETINKAWKTTKNNCILNTFHGGKRACLGEKLVFVSTRIIIAEFL--SSFE 456

Query: 486 HKITPL-SEKIKVFATIFPKDDLLMTFKKRD 515
            K++PL  E++     + PK DL +  + RD
Sbjct: 457 WKLSPLWVEQMTHAGPLCPK-DLALDIRVRD 486

>Kwal_47.18804
          Length = 508

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 78/203 (38%), Gaps = 28/203 (13%)

Query: 305 EFSNKEISEAIFTFLFASQDASSSLACWLFQIVADRPDILEKIRKEQMEVRNNDMSTELN 364
           E S K++ + I   + A  +    L    F +         K RK Q  VR         
Sbjct: 298 EISKKQLIDNIVIIMVAGHENPQLLLTTCFYMFG-------KNRKWQDLVREEVQGC--G 348

Query: 365 IELIDKMKYTNMVIKETLRYRPPV-LMVPYVVKEKFPVTPNYTAPKGSMLIPTLYPSLHD 423
           IE ++ +   N  I E +R  PP+  ++     +K  +  +   P+   L   +Y +   
Sbjct: 349 IENLNDLPLLNSFIFECIRMYPPLSQIINRCTTKKCVLGTDIVLPENVYLGYNVYSTGRY 408

Query: 424 PEVY-ENPDEFIPERWEEGSPASEAKKNW---------LVFGCGPHVCLGQTY----VMI 469
              + +N D FIPERW  G+   E  K W           F  G   CLG+      V I
Sbjct: 409 KSAWGDNADCFIPERW--GNNIEEITKEWRHRKNTCAMAAFHGGRRACLGEKLALMEVRI 466

Query: 470 TFAALLGKF--ALYTDFEHKITP 490
             AA+L  F   L   +  K+TP
Sbjct: 467 AMAAVLKNFEWTLAASWVDKVTP 489

>KLLA0C06743g complement(590585..592126) similar to sp|P21595
           Saccharomyces cerevisiae YDR402c DIT2 cytochrome P450 56
           singleton, start by similarity
          Length = 513

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 68/166 (40%), Gaps = 17/166 (10%)

Query: 351 QMEVRNNDMSTELNIELIDKMKYTNMVIKETLRYRPPV-LMVPYVVKEKFPVTPNYTAPK 409
           Q  +R   +S + N ++++  K T   I E LR  PP+  ++      K  + P     K
Sbjct: 321 QYAIREELLSVDRNEDILNSFKLT-AFIYEALRMFPPLGQIINRRTTRKCQLGPGIIIDK 379

Query: 410 GSMLIPTLYPSLHDPEVY-ENPDEFIPERWEEGSPASEAKKNW---------LVFGCGPH 459
                  +Y +     V+ E   +FIPERW E S  +E   NW           F  G  
Sbjct: 380 DVYCGYNVYGTGTATSVWGETAKQFIPERWGENS--NELANNWKKHKYDASMSAFHGGRR 437

Query: 460 VCLGQTYVMITFAALLGKFALYTDFEHKITP-LSEKIKVFATIFPK 504
            CLG+   ++    +L  + +  +F  ++ P   EK+     I PK
Sbjct: 438 SCLGEKLALMEMKYVL--YYVLMNFHIELHPQWKEKMTPAGPICPK 481

>KLLA0F19184g 1778227..1779765 weakly similar to sp|P39102
           Saccharomyces cerevisiae YLR090w XDJ1, start by
           similarity
          Length = 512

 Score = 32.3 bits (72), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 343 ILEKIRKEQMEVRNNDMSTELNIELIDKMKYTNMVIKETLRYRPPVLMVP 392
           I E   K  +E ++ND+ T LNI L+D +   + ++ ET   R   + VP
Sbjct: 338 IDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVP 387

>Kwal_14.1796
          Length = 363

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 5   MDNSTMEFVQQQTPSTLISTIQQLSYWKIFVTFICIVLVWDQISYQIKKGSIAGPRFKIW 64
           +  +T++FV  + P  L+     L +W + +T I    +W+Q+S  +    +AG  F  W
Sbjct: 303 LAGATLKFVVWRNPVILLVLFTFLWWWSLLITTIAFHTLWEQLSGLLCAYVVAG--FVYW 360

Query: 65  PII 67
            ++
Sbjct: 361 KLV 363

>AFR661W [3854] [Homologous to ScYGL140C - NSH]
           complement(1642457..1645996) [3540 bp, 1179 aa]
          Length = 1179

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 226 YLVTAALELVNFPIIIPFTKTWYGK 250
           + VT AL L +FP+ IP T+ WY K
Sbjct: 626 FQVTIALTLASFPMYIPATREWYMK 650

>Sklu_1987.2 YBL015W, Contig c1987 2738-4309
          Length = 523

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/67 (20%), Positives = 36/67 (53%)

Query: 281 MDAWCKLMHDAKTKNDEDSRILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADR 340
           ++ W +++ D+     E+  + +   ++  ++EA F   F + D+ S   C   Q+V++ 
Sbjct: 297 LNVWTEVLQDSFLDLFENGSLDYATATSIRLTEAGFERFFENWDSFSKKLCLRSQVVSNN 356

Query: 341 PDILEKI 347
           P+I+ ++
Sbjct: 357 PEIIRRL 363

>Scas_584.5
          Length = 367

 Score = 29.6 bits (65), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 154 LFTKTALAQYLPSQEQVMDKYLQKFIEISKENNYEPQVFFHEMREI 199
           LF K   AQ   + + V +K+++K + +SK+ NY P +F  E+ ++
Sbjct: 302 LFLKDESAQIQKNLQNVTEKFVKKVVALSKDPNY-PSLFSQELSKL 346

>AFR020W [3212] [Homologous to ScYBL015W (ACH1) - SH]
           complement(472535..474505) [1971 bp, 656 aa]
          Length = 656

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/67 (22%), Positives = 35/67 (52%)

Query: 281 MDAWCKLMHDAKTKNDEDSRILHREFSNKEISEAIFTFLFASQDASSSLACWLFQIVADR 340
           +  W +++ D+     E+  +     ++  ++EA F   FA+ D  SS  C   Q+V++ 
Sbjct: 430 LTVWTEVLQDSFLDLFENGSLEFATATSIRLTEAGFEKFFANWDEYSSKLCLRSQVVSNS 489

Query: 341 PDILEKI 347
           P+++ ++
Sbjct: 490 PEMIRRL 496

>CAGL0C05445g 517886..521224 similar to tr|Q07660 Saccharomyces
           cerevisiae YDL231c BRE4, hypothetical start
          Length = 1112

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 5/52 (9%)

Query: 126 VAIKILRPTNWVFLDGKAHIDYRKSLNGLFTKTALAQYLPSQEQVMDKYLQK 177
           + I +  P NWV    KA ++ R S++ L     LA    S + V D+YL +
Sbjct: 837 IGISLSIPINWVVWSFKARVELRISMSSL-----LAHLSQSYQTVSDRYLYR 883

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.137    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,424,837
Number of extensions: 764264
Number of successful extensions: 2080
Number of sequences better than 10.0: 31
Number of HSP's gapped: 2094
Number of HSP's successfully gapped: 31
Length of query: 523
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 417
Effective length of database: 12,926,601
Effective search space: 5390392617
Effective search space used: 5390392617
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 64 (29.3 bits)