Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_709.5272550619440.0
YMR016C (SOK2)7852515788e-64
Scas_106.14232285532e-63
YKL043W (PHD1)3661125246e-60
ABR055C6781085386e-59
Kwal_26.81765921115283e-58
KLLA0F04840g6361085295e-58
CAGL0L01771g4351065166e-58
Scas_625.85211215219e-58
CAGL0M07634g2571083805e-41
KLLA0E05357g754771185e-06
YDL056W (MBP1)833771178e-06
Sklu_2055.3743771132e-05
Kwal_26.9359742771113e-05
YER111C (SWI4)1093801105e-05
AFR600C815771097e-05
Sklu_1824.2179821002e-04
Scas_510.210431111052e-04
CAGL0A04565g1041781043e-04
AGL297C970821034e-04
KLLA0E20867g93378990.001
Kwal_27.10756922111960.002
Scas_683.3782077950.003
CAGL0D01012g80277940.004
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_709.52
         (725 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_709.52                                                           753   0.0  
YMR016C (SOK2) [3980] chr13 complement(303235..305592) Transcrip...   227   8e-64
Scas_106.1                                                            217   2e-63
YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription facto...   206   6e-60
ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W (P...   211   6e-59
Kwal_26.8176                                                          207   3e-58
KLLA0F04840g 474544..476454 some similarities with sp|P53438 Sac...   208   5e-58
CAGL0L01771g 196974..198281 some similarities with sp|P36093 Sac...   203   6e-58
Scas_625.8                                                            205   9e-58
CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces c...   150   5e-41
KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA Kluyv...    50   5e-06
YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor ...    50   8e-06
Sklu_2055.3 YDL056W, Contig c2055 5141-7372                            48   2e-05
Kwal_26.9359                                                           47   3e-05
YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcript...    47   5e-05
AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH] (1517341..1...    47   7e-05
Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement         43   2e-04
Scas_510.2                                                             45   2e-04
CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces c...    45   3e-04
AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH] (147990..15...    44   4e-04
KLLA0E20867g complement(1852522..1855323) weakly similar to sp|P...    43   0.001
Kwal_27.10756                                                          42   0.002
Scas_683.37                                                            41   0.003
CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces c...    41   0.004

>Scas_709.52
          Length = 725

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/506 (75%), Positives = 383/506 (75%)

Query: 220 ISPYQMQAQINSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPNPSTYQYPGFQ 279
           ISPYQMQAQINSY                                  YPNPSTYQYPGFQ
Sbjct: 220 ISPYQMQAQINSYQPAQPAPPPPRAAIVVAVAAQNNKESKDNNKNSNYPNPSTYQYPGFQ 279

Query: 280 KGQTQQQPSHQYTHSFSAISTSPELMAANEVVATVSTVDHPYMNPTSTFDNNSMVGXXXX 339
           KGQTQQQPSHQYTHSFSAISTSPELMAANEVVATVSTVDHPYMNPTSTFDNNSMVG    
Sbjct: 280 KGQTQQQPSHQYTHSFSAISTSPELMAANEVVATVSTVDHPYMNPTSTFDNNSMVGRNNK 339

Query: 340 XXXXXXXLTADDVSLSDGKQEDEPEEEIYTXXXXXXXTEGIFVKPRVTTTMWEDERTICY 399
                  LTADDVSLSDGKQEDEPEEEIYT       TEGIFVKPRVTTTMWEDERTICY
Sbjct: 340 NKKHRRKLTADDVSLSDGKQEDEPEEEIYTNNNNNNNTEGIFVKPRVTTTMWEDERTICY 399

Query: 400 QVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHVVKIGSMHLKGVWVP 459
           QVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHVVKIGSMHLKGVWVP
Sbjct: 400 QVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHVVKIGSMHLKGVWVP 459

Query: 460 FERARLMAGREHILDLLYPLFVRDIESVLKQTRPVVFHEDHVSINNVHHHQVQDENEQPQ 519
           FERARLMAGREHILDLLYPLFVRDIESVLKQTRPVVFHEDHVSINNVHHHQVQDENEQPQ
Sbjct: 460 FERARLMAGREHILDLLYPLFVRDIESVLKQTRPVVFHEDHVSINNVHHHQVQDENEQPQ 519

Query: 520 IAXXXXXXXXXXXXXXXXDLTYSQYENNNEKTLYLXXXXXXXXXXXXXXAVQTQLTNGNL 579
           IA                DLTYSQYENNNEKTLYL              AVQTQLTNGNL
Sbjct: 520 IANIPTTTTASTTNNNNNDLTYSQYENNNEKTLYLPPPTTVVPPPPTPPAVQTQLTNGNL 579

Query: 580 SMYYPSTSQNTMYATQPQRYTATTNTSNNIHTGIAPQQQMPNTMYHSSLIQPLNEXXXXX 639
           SMYYPSTSQNTMYATQPQRYTATTNTSNNIHTGIAPQQQMPNTMYHSSLIQPLNE     
Sbjct: 580 SMYYPSTSQNTMYATQPQRYTATTNTSNNIHTGIAPQQQMPNTMYHSSLIQPLNENNGST 639

Query: 640 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLPANTSEPSKEEPATKDSLEKTM 699
                                               PLPANTSEPSKEEPATKDSLEKTM
Sbjct: 640 NNTTPSTTNTTTTTSSTVSITNNNNNNTNETTSHTSPLPANTSEPSKEEPATKDSLEKTM 699

Query: 700 EPQQQDETINTSTNADLKEEDKNDSV 725
           EPQQQDETINTSTNADLKEEDKNDSV
Sbjct: 700 EPQQQDETINTSTNADLKEEDKNDSV 725

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/17 (100%), Positives = 17/17 (100%)

Query: 122 NRSHSGSDAGRPTSTIS 138
           NRSHSGSDAGRPTSTIS
Sbjct: 122 NRSHSGSDAGRPTSTIS 138

>YMR016C (SOK2) [3980] chr13 complement(303235..305592)
           Transcription factor with dual roles as both activator
           and repressor, negatively regulates meiosis, involved in
           regulation of cAMP-dependent kinase-stimulated growth,
           pseudohyphal differentiation, and sporulation [2358 bp,
           785 aa]
          Length = 785

 Score =  227 bits (578), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 126/251 (50%), Positives = 148/251 (58%), Gaps = 27/251 (10%)

Query: 267 YPNPSTYQYPGFQK------GQTQQQPSHQYTHSFSAISTSPELMAANEVVATVSTVDHP 320
           YP PSTYQYPGF K        +   P    T +    S +  L      V  +      
Sbjct: 275 YPQPSTYQYPGFHKTSSIPNSHSPIPPRSLTTPTQGPTSQNGPLSYNLPQVGLLPPQQQQ 334

Query: 321 YMNPTSTFDNNSMVGXXXXXXXXXXXLTADDVSLSDGKQEDE---------------PEE 365
            ++P   +D NS+             LTA+   +SD +Q D                P  
Sbjct: 335 QVSPL--YDGNSITPPVKPSTDQETYLTANRHGVSD-QQYDSMAKTMNSFQTTTIRHPMP 391

Query: 366 EIYTXXXXXXXTEGI---FVKPRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKL 422
            I T       T G     ++PRVTTTMWEDE+T+CYQVEANG+SVVRRADNDM+NGTKL
Sbjct: 392 LIATTNATGSNTSGTSASIIRPRVTTTMWEDEKTLCYQVEANGISVVRRADNDMVNGTKL 451

Query: 423 LNVTKMTRGRRDGILKSEKIRHVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVR 482
           LNVTKMTRGRRDGILK+EKIRHVVKIGSMHLKGVW+PFERA  +A RE I D LYPLF+R
Sbjct: 452 LNVTKMTRGRRDGILKAEKIRHVVKIGSMHLKGVWIPFERALAIAQREKIADYLYPLFIR 511

Query: 483 DIESVLKQTRP 493
           DI+SVLKQ  P
Sbjct: 512 DIQSVLKQNNP 522

>Scas_106.1
          Length = 423

 Score =  217 bits (553), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 121/228 (53%), Positives = 142/228 (62%), Gaps = 35/228 (15%)

Query: 270 PSTYQYPGFQKGQTQQQPSHQYTHSFSA----ISTSPELMAANEVVATVSTVDHPYMNPT 325
           PS YQYPGFQ+ Q  QQ   Q T+ +SA     +TS  L    +V A +   DH   +  
Sbjct: 67  PSNYQYPGFQQLQQPQQLVPQSTYPYSASNPAAATSSSLTNNVDVAAVM---DHSASSAD 123

Query: 326 STFDNNSMVGXXXXXXXXXXXLTADDVSLSDGKQEDEPEEEIYTXXXXXXXTEGIFVKPR 385
                NS+             ++A D S                             +PR
Sbjct: 124 RRRKANSINAKSLKSTAGAAQISAVDPSH----------------------------RPR 155

Query: 386 VTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHV 445
           VTTTMWEDE+T+CYQVEA GVSVVRRADNDMINGTKLLNVTKMTRGRRDGILK+EKIRHV
Sbjct: 156 VTTTMWEDEKTLCYQVEACGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKAEKIRHV 215

Query: 446 VKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQTRP 493
           VKIGSMHLKGVW+PF+RA  MA RE I+DLL+PLFVRDI+SV++Q  P
Sbjct: 216 VKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGAP 263

>YKL043W (PHD1) [3215] chr11 (356393..357493) Transcription factor
           involved in regulation of filamentous growth [1101 bp,
           366 aa]
          Length = 366

 Score =  206 bits (524), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 102/112 (91%)

Query: 382 VKPRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEK 441
           +KPRV TTMWEDE TICYQVEANG+SVVRRADN+MINGTKLLNVTKMTRGRRDGIL+SEK
Sbjct: 183 LKPRVITTMWEDENTICYQVEANGISVVRRADNNMINGTKLLNVTKMTRGRRDGILRSEK 242

Query: 442 IRHVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQTRP 493
           +R VVKIGSMHLKGVW+PFERA ++A RE ILD LYPLFV+DIES++   +P
Sbjct: 243 VREVVKIGSMHLKGVWIPFERAYILAQREQILDHLYPLFVKDIESIVDARKP 294

>ABR055C [646] [Homologous to ScYMR016C (SOK2) - SH; ScYKL043W
           (PHD1) - SH] (495331..497367) [2037 bp, 678 aa]
          Length = 678

 Score =  211 bits (538), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 102/108 (94%)

Query: 384 PRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIR 443
           PRVTTTMWEDE T+CYQVEANGVSVVRRADNDMINGTKLLNV KMTRGRRDGILK+EK+R
Sbjct: 329 PRVTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKVR 388

Query: 444 HVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQT 491
           HVVKIGSMHLKGVW+PFERA  +A RE I+D+L+PLFVRDI+SV++QT
Sbjct: 389 HVVKIGSMHLKGVWIPFERALALAQREKIVDMLFPLFVRDIQSVIQQT 436

>Kwal_26.8176
          Length = 592

 Score =  207 bits (528), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 91/111 (81%), Positives = 100/111 (90%)

Query: 386 VTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHV 445
           VTTTMWEDE T+CYQVEANGVSVVRRADNDMINGTKLLNV KMTRGRRDGILK+EKIRHV
Sbjct: 217 VTTTMWEDEHTLCYQVEANGVSVVRRADNDMINGTKLLNVAKMTRGRRDGILKAEKIRHV 276

Query: 446 VKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQTRPVVF 496
           VKIGSMHLKGVW+PF+RA  MA RE I+DLL+PLFVRDI+SV++Q    V 
Sbjct: 277 VKIGSMHLKGVWIPFDRALAMAQREKIVDLLFPLFVRDIQSVIQQGASTVL 327

>KLLA0F04840g 474544..476454 some similarities with sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2 regulatory protein
           in the PKA signal transduction pathway, hypothetical
           start
          Length = 636

 Score =  208 bits (529), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 102/108 (94%)

Query: 383 KPRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKI 442
           + +VTTTMWEDE T+CYQVEANGVSVVRRADNDMINGTKLLNVT+MTRGRRDGILK+EKI
Sbjct: 362 RSKVTTTMWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTRMTRGRRDGILKAEKI 421

Query: 443 RHVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQ 490
           RHVVKIGSMHLKGVW+PFERA +MA RE I+DLLY LFVRDI+S+++Q
Sbjct: 422 RHVVKIGSMHLKGVWIPFERALVMAQREKIVDLLYALFVRDIQSIIQQ 469

>CAGL0L01771g 196974..198281 some similarities with sp|P36093
           Saccharomyces cerevisiae YKL043w PHD1 or sp|P53438
           Saccharomyces cerevisiae YMR016c SOK2, hypothetical
           start
          Length = 435

 Score =  203 bits (516), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 89/106 (83%), Positives = 97/106 (91%)

Query: 384 PRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIR 443
           PR+ TT+WEDE T+CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRG+RDGIL+SEK R
Sbjct: 201 PRIITTIWEDENTLCYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYR 260

Query: 444 HVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLK 489
            VVKIGSMHLKGVW+PFERA  +A RE I+DLLYPLFVRDI SVLK
Sbjct: 261 KVVKIGSMHLKGVWIPFERALFIAKREKIVDLLYPLFVRDITSVLK 306

>Scas_625.8
          Length = 521

 Score =  205 bits (521), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 104/121 (85%)

Query: 384 PRVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIR 443
           PRV TTMWEDERT+CYQVE NGV+VVRRADNDMINGTKLLNVTKMTRGRRDGIL++EK+R
Sbjct: 208 PRVITTMWEDERTLCYQVECNGVAVVRRADNDMINGTKLLNVTKMTRGRRDGILRAEKVR 267

Query: 444 HVVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQTRPVVFHEDHVSI 503
            V+KIGSMHLKGVW+PF+RA +MA RE I+DLLYPLFV+DI S+L Q   +   E  V +
Sbjct: 268 SVIKIGSMHLKGVWIPFDRALMMAKREKIVDLLYPLFVKDINSILSQLPQLSQRESMVLM 327

Query: 504 N 504
           N
Sbjct: 328 N 328

>CAGL0M07634g 763929..764702 similar to sp|P53438 Saccharomyces
           cerevisiae YMR016c SOK2 or sp|P36093 Saccharomyces
           cerevisiae YKL043w PHD1, hypothetical start
          Length = 257

 Score =  150 bits (380), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 70/108 (64%), Positives = 82/108 (75%)

Query: 385 RVTTTMWEDERTICYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRH 444
           RV TT WEDE TIC+ V  NGV+VVRRADNDM+NGTKLLNVT MTRGRRDGILK+E +R 
Sbjct: 121 RVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTGMTRGRRDGILKNEPVRD 180

Query: 445 VVKIGSMHLKGVWVPFERARLMAGREHILDLLYPLFVRDIESVLKQTR 492
           VVK G M LKGVW+P +RAR +A +E I   LYPLF+ D+   +   R
Sbjct: 181 VVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDLHQAITLLR 228

>KLLA0E05357g 485919..488183 gi|729994|sp|P39679|MBP1_KLULA
           Kluyveromyces lactis Transcription factor MBP1 (MBF
           subunit P120), start by similarity
          Length = 754

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 407 SVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHV---VKIGSMHLKGVWVPFERA 463
           S+++R  ++ +N T +L   K  + +R  IL+ E I      V+ G    +G W+P E A
Sbjct: 25  SIMKRKADNWVNATHILKAAKFPKAKRTRILEKEVITDTHEKVQGGFGKYQGTWIPLELA 84

Query: 464 RLMAGREHILDLLYPLF 480
             +A +  +LD L PLF
Sbjct: 85  SKLAEKFEVLDELKPLF 101

>YDL056W (MBP1) [809] chr4 (352877..355378) Transcription factor
           that collaborates with Swi6p to form the MBF
           (Mbp1p-Swi6p) factor for regulation at Mlu1 cell cycle
           box (MCB) elements, has two ankyrin repeats [2502 bp,
           833 aa]
          Length = 833

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 40/77 (51%), Gaps = 3/77 (3%)

Query: 407 SVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHV---VKIGSMHLKGVWVPFERA 463
           S+++R  +D +N T +L      + +R  IL+ E ++     V+ G    +G WVP   A
Sbjct: 24  SIMKRKKDDWVNATHILKAANFAKAKRTRILEKEVLKETHEKVQGGFGKYQGTWVPLNIA 83

Query: 464 RLMAGREHILDLLYPLF 480
           + +A +  + D L PLF
Sbjct: 84  KQLAEKFSVYDQLKPLF 100

>Sklu_2055.3 YDL056W, Contig c2055 5141-7372
          Length = 743

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 3/77 (3%)

Query: 407 SVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHV---VKIGSMHLKGVWVPFERA 463
           S+++R  +D +N T +L   K  + +R  IL+ E I+ +   V+ G    +G WVP + A
Sbjct: 27  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDIHEKVQGGFGKYQGTWVPLDIA 86

Query: 464 RLMAGREHILDLLYPLF 480
           R +A +  +++ L PLF
Sbjct: 87  RKLASKFDVMEELKPLF 103

>Kwal_26.9359
          Length = 742

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 407 SVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHV---VKIGSMHLKGVWVPFERA 463
           S+++R ++D +N T +L   K  + +R  IL+ E I+     V+ G    +G WVP + A
Sbjct: 25  SIMKRKEDDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 84

Query: 464 RLMAGREHILDLLYPLF 480
           R +A +  +L  L PLF
Sbjct: 85  RNLAAKFEVLSELKPLF 101

>YER111C (SWI4) [1542] chr5 complement(382591..385872) Transcription
           factor that is a component of the SBF (Swi4p-Swi6p)
           complex that regulates expression at promoters
           containing the cell cycle box (CCB) element, contains
           two ankyrin repeats [3282 bp, 1093 aa]
          Length = 1093

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 398 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEK--IRH-VVKIGSMHLK 454
           CY        V+RR  +D IN T++  + + ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 50  CYIRGFETKIVMRRTKDDWINITQVFKIAQFSKTKRTKILEKESNDMQHEKVQGGYGRFQ 109

Query: 455 GVWVPFERARLMAGREHILD 474
           G W+P + A+ +  +  I+D
Sbjct: 110 GTWIPLDSAKFLVNKYEIID 129

>AFR600C [3792] [Homologous to ScYDL056W (MBP1) - SH]
           (1517341..1519788) [2448 bp, 815 aa]
          Length = 815

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 407 SVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHV---VKIGSMHLKGVWVPFERA 463
           S+++R  +D +N T +L   K  + +R  IL+ E I+     V+ G    +G WVP + A
Sbjct: 31  SIMKRKADDWVNATHILKAAKFAKAKRTRILEKEVIKDTHEKVQGGFGKYQGTWVPLDIA 90

Query: 464 RLMAGREHILDLLYPLF 480
           R +A +  +L+ L PLF
Sbjct: 91  RRLAQKFEVLEELRPLF 107

>Sklu_1824.2 YER111C, Contig c1824 4652-5187 reverse complement
          Length = 179

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 398 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEK--IRH-VVKIGSMHLK 454
           CY        V+RR  ++ +N T++  +   ++ +R  IL+ E   ++H  ++ G    +
Sbjct: 28  CYCRGKESKIVMRRCQDNWVNITQVFKIASFSKTQRTKILEKESNDMKHEKIQGGYGRFQ 87

Query: 455 GVWVPFERARLMAGREHILDLL 476
           G W+P E AR +  +  + D++
Sbjct: 88  GTWIPLENARYLVSKYKVDDII 109

>Scas_510.2
          Length = 1043

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 15/111 (13%)

Query: 398 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEK---IRHVVKIGSMHLK 454
           CY        V+RR  +D IN T++  +   ++  R  +L+ E    +   V+ G    +
Sbjct: 64  CYIKGFESRIVMRRTKDDWINVTQVFKIADFSKAHRTKVLEKESSDMMHEKVQGGYGRFQ 123

Query: 455 GVWVPFERARLMAGREHI------------LDLLYPLFVRDIESVLKQTRP 493
           G W+P E A ++  +  I            LD   P   R   SVL++T P
Sbjct: 124 GTWIPLESALMLVQKYKINDPVVTTILHFKLDPANPPSKRSKNSVLRRTSP 174

>CAGL0A04565g 445883..449008 similar to sp|P25302 Saccharomyces
           cerevisiae YER111c SWI4, start by similarity
          Length = 1041

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 398 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEK--IRH-VVKIGSMHLK 454
           CY        V+RR  +D +N T++  + + ++ +R  IL+ E   ++H  V+ G    +
Sbjct: 52  CYIRGQESNIVMRRTMDDWVNVTQVFKIAQFSKTQRTKILEKESTNMKHEKVQGGYGRFQ 111

Query: 455 GVWVPFERARLMAGREHI 472
           G WVP E A+ M  + +I
Sbjct: 112 GTWVPLEAAKFMTTKYNI 129

>AGL297C [4015] [Homologous to ScYER111C (SWI4) - SH]
           (147990..150902) [2913 bp, 970 aa]
          Length = 970

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 3/82 (3%)

Query: 398 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEK--IRH-VVKIGSMHLK 454
           CY        V+RR  +D +N T++  V   ++ +R  IL+ E   I H  ++ G    +
Sbjct: 33  CYCRGKESSIVMRRLHDDWVNITQVFKVATFSKTQRTKILEKESADISHEKIQGGYGRFQ 92

Query: 455 GVWVPFERARLMAGREHILDLL 476
           G W+P + A+ +  +  I D++
Sbjct: 93  GTWIPLDSAKGLVAKYEITDIV 114

>KLLA0E20867g complement(1852522..1855323) weakly similar to
           sp|P25302 Saccharomyces cerevisiae YER111c SWI4
           transcription factor, start by similarity
          Length = 933

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 398 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSE--KIRH-VVKIGSMHLK 454
           CY  +     ++RR +++ +N T++      T+ +R  IL+ E  +I+H  ++ G    +
Sbjct: 109 CYTKDKPPCLIMRRCNDNWLNITQVFKAGSFTKAQRTKILEKEANEIKHEKIQGGYGRFQ 168

Query: 455 GVWVPFERARLMAGREHI 472
           G W+P+E  + +  + +I
Sbjct: 169 GTWIPWESTKYLVEKYNI 186

>Kwal_27.10756
          Length = 922

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 49/111 (44%), Gaps = 15/111 (13%)

Query: 398 CYQVEANGVSVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEK--IRH-VVKIGSMHLK 454
           CY        V+RR  +D +N T++  +   ++ +R  IL+ E   ++H  ++ G    +
Sbjct: 46  CYCRGQESRIVMRRCMDDWVNITQVFKIASFSKTQRTKILEKESNMVKHEKIQGGYGRFQ 105

Query: 455 GVWVPFERARLMAGREHILDLLY------------PLFVRDIESVLKQTRP 493
           G W+P E A  +  +  + D++             P   R   SV+K+  P
Sbjct: 106 GTWIPLENAHYLVQKYSVSDVVVSTILHFQLDPRNPPLRRSKNSVIKKQSP 156

>Scas_683.37
          Length = 820

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 3/77 (3%)

Query: 407 SVVRRADNDMINGTKLLNVTKMTRGRRDGILKSE---KIRHVVKIGSMHLKGVWVPFERA 463
           SV++R  +D +N T +L      + +R  IL  E   +    V+ G    +G WVP E A
Sbjct: 24  SVMKRKKDDWVNATHILKAANFAKAKRTRILDKEVMGRKHEKVQGGFGKYQGTWVPLEIA 83

Query: 464 RLMAGREHILDLLYPLF 480
             +A +  + + L  LF
Sbjct: 84  TELAMKFDVYEELRALF 100

>CAGL0D01012g 118878..121286 similar to sp|P39678 Saccharomyces
           cerevisiae YDL056w MBP1 transcription factor, start by
           similarity
          Length = 802

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 407 SVVRRADNDMINGTKLLNVTKMTRGRRDGILKSEKIRHV---VKIGSMHLKGVWVPFERA 463
           S+++R ++  +N T +L      + +R  IL+ E ++ +   V+ G    +G WVP   A
Sbjct: 24  SIMKRKNDGWVNATHILKAANFAKAKRTRILEKEVLKEMHEKVQGGFGKYQGTWVPLNIA 83

Query: 464 RLMAGREHILDLLYPLF 480
             +A +  +   L PLF
Sbjct: 84  INLAEKFDVYQDLKPLF 100

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.125    0.354 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,197,616
Number of extensions: 502256
Number of successful extensions: 1797
Number of sequences better than 10.0: 30
Number of HSP's gapped: 1828
Number of HSP's successfully gapped: 33
Length of query: 725
Length of database: 16,596,109
Length adjustment: 109
Effective length of query: 616
Effective length of database: 12,822,747
Effective search space: 7898812152
Effective search space used: 7898812152
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)