Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_709.5055255228430.0
YMR020W (FMS1)50850715540.0
Sklu_2411.949748313420.0
Kwal_26.821450248512491e-168
CAGL0M07612g58156910921e-143
ABR057W5204919941e-129
KLLA0E07744g5334959411e-121
Scas_560.11*753106674.9
KLLA0E08921g342124649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_709.50
         (552 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_709.50                                                          1099   0.0  
YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in...   603   0.0  
Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement      521   0.0  
Kwal_26.8214                                                          485   e-168
CAGL0M07612g complement(760610..762355) similar to sp|P50264 Sac...   425   e-143
ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH] complement(5...   387   e-129
KLLA0E07744g complement(696382..697983) similar to sp|P50264 Sac...   367   e-121
Scas_560.11*                                                           30   4.9  
KLLA0E08921g 793287..794315 similar to sp|P53112 Saccharomyces c...    29   9.6  

>Scas_709.50
          Length = 552

 Score = 1099 bits (2843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/552 (95%), Positives = 529/552 (95%)

Query: 1   MSSCIFLRTMRAFFRKSCNLEHQGSYIASLNIVSNTLHIGPAIQIMTKPKEQQVXXXXXX 60
           MSSCIFLRTMRAFFRKSCNLEHQGSYIASLNIVSNTLHIGPAIQIMTKPKEQQV      
Sbjct: 1   MSSCIFLRTMRAFFRKSCNLEHQGSYIASLNIVSNTLHIGPAIQIMTKPKEQQVIIIGAG 60

Query: 61  XXXXXXXSTLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTLMNPLFLE 120
                  STLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTLMNPLFLE
Sbjct: 61  IAGLKAASTLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTLMNPLFLE 120

Query: 121 EAEAMKKDSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVK 180
           EAEAMKKDSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVK
Sbjct: 121 EAEAMKKDSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVK 180

Query: 181 DCSFYHIILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNAL 240
           DCSFYHIILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNAL
Sbjct: 181 DCSFYHIILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNAL 240

Query: 241 VTNFDSVVNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGEEYICQYTIVTIPXXXX 300
           VTNFDSVVNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGEEYICQYTIVTIP    
Sbjct: 241 VTNFDSVVNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGEEYICQYTIVTIPQSVL 300

Query: 301 XXXXXXPDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTWSNESSRIFTL 360
                 PDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTWSNESSRIFTL
Sbjct: 301 QLSLQLPDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTWSNESSRIFTL 360

Query: 361 AHSQENFVEDVRKAETWEGLIDNLKTPSSQLFENCWDFPLLFINLAKSIGRPTLIMLMQS 420
           AHSQENFVEDVRKAETWEGLIDNLKTPSSQLFENCWDFPLLFINLAKSIGRPTLIMLMQS
Sbjct: 361 AHSQENFVEDVRKAETWEGLIDNLKTPSSQLFENCWDFPLLFINLAKSIGRPTLIMLMQS 420

Query: 421 PLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSANPTEAETNSPILKNLLVT 480
           PLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSANPTEAETNSPILKNLLVT
Sbjct: 421 PLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSANPTEAETNSPILKNLLVT 480

Query: 481 NWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWESGRR 540
           NWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWESGRR
Sbjct: 481 NWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWESGRR 540

Query: 541 EGEYILEHLKDH 552
           EGEYILEHLKDH
Sbjct: 541 EGEYILEHLKDH 552

>YMR020W (FMS1) [3984] chr13 (315376..316902) Protein involved in
           the biosynthesis of pantothenic acid, has similarity to
           Candida albicans corticosteroid-binding protein CBP1
           [1527 bp, 508 aa]
          Length = 508

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/507 (55%), Positives = 362/507 (71%), Gaps = 5/507 (0%)

Query: 47  TKPKEQQVXXXXXXXXXXXXXSTLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGA 106
             P +++V             STL+ NGI++CLV+EARDR+GGRL TV GY+G KYD+GA
Sbjct: 4   VSPAKKKVIIIGAGIAGLKAASTLHQNGIQDCLVLEARDRVGGRLQTVTGYQGRKYDIGA 63

Query: 107 GWHHDTLMNPLFLEEAEAMKKDSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEID 166
            WHHDTL NPLFLEEA+    D + RFVF+D  FIYID++RGR+DHD ++ LE VD E+ 
Sbjct: 64  SWHHDTLTNPLFLEEAQLSLNDGRTRFVFDDDNFIYIDEERGRVDHDKELLLEIVDNEMS 123

Query: 167 KFTGLEFYQSLDVKDCSFYHIILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLS 226
           KF  LEF+Q L V DCSF+ +++KYLLQRR FLT+DQI++  Q+ RYLELWHG  W  LS
Sbjct: 124 KFAELEFHQHLGVSDCSFFQLVMKYLLQRRQFLTNDQIRYLPQLCRYLELWHGLDWKLLS 183

Query: 227 AKDTYFDHQGRNALVTNFDSVVNRIGDTFPKDWIRLNTEVKAIERD-GKNVLIKLSSGEE 285
           AKDTYF HQGRNA   N+DSVV RI  +FP++W++L+ EVK+I R+  KNV +    G  
Sbjct: 184 AKDTYFGHQGRNAFALNYDSVVQRIAQSFPQNWLKLSCEVKSITREPSKNVTVNCEDGTV 243

Query: 286 YICQYTIVTIPXXXXXXXXXXPDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEF 345
           Y   Y I+T+P            E N +GRI+F+PPL P IQ+AF KIHFG LGKV+FEF
Sbjct: 244 YNADYVIITVPQSVLNLSVQP--EKNLRGRIEFQPPLKPVIQDAFDKIHFGALGKVIFEF 301

Query: 346 DKCTWSNESSRIFTLAHSQENFVEDVRKAETWEGLIDNLKTPSSQLFEN--CWDFPLLFI 403
           ++C WSNESS+I TLA+S   FVE VR AE  + L   L+   SQ   +  CW  PL F+
Sbjct: 302 EECCWSNESSKIVTLANSTNEFVEIVRNAENLDELDSMLEREDSQKHTSVTCWSQPLFFV 361

Query: 404 NLAKSIGRPTLIMLMQSPLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSAN 463
           NL+KS G  + +MLMQ+PL+N+IESI  DK++++ FFQPVL+K+M  L S  VI+G+   
Sbjct: 362 NLSKSTGVASFMMLMQAPLTNHIESIREDKERLFSFFQPVLNKIMKCLDSEDVIDGMRPI 421

Query: 464 PTEAETNSPILKNLLVTNWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHT 523
              A  N P+L+N++V+NW  DPYSRGAYSACF GDD ++M++AMSNGQDSRIRFAGEHT
Sbjct: 422 ENIANANKPVLRNIIVSNWTRDPYSRGAYSACFPGDDPVDMVVAMSNGQDSRIRFAGEHT 481

Query: 524 IMDGAGAVHGSWESGRREGEYILEHLK 550
           IMDGAG  +G+WESGRRE   I + LK
Sbjct: 482 IMDGAGCAYGAWESGRREATRISDLLK 508

>Sklu_2411.9 YMR020W, Contig c2411 17037-18530 reverse complement
          Length = 497

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/483 (51%), Positives = 331/483 (68%), Gaps = 7/483 (1%)

Query: 68  STLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTLMNPLFLEEAEAMKK 127
           S LYA    +C+V+E+RDRIGGRL TV+GY G KYDLGA WHHDTLMN LFLEE + + +
Sbjct: 21  SDLYAKNCHSCVVLESRDRIGGRLHTVEGYDGRKYDLGASWHHDTLMNGLFLEELQ-LPE 79

Query: 128 DSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVKDCSFYHI 187
             +  FVF+D   I   +   R+DHDP + LE +  E+D+F  L+F++SLDVKD S++ I
Sbjct: 80  QERTPFVFDDDDLILFTENGKRLDHDPKLILEVLKEELDRFIELQFFESLDVKDISYFQI 139

Query: 188 ILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNALVTNFDSV 247
           ILKYL QRRDFL+D+Q+K   Q+ARYLELWHG  W  LS K  + DHQGRNA+V ++ S+
Sbjct: 140 ILKYLYQRRDFLSDEQLKHLPQLARYLELWHGIDWKTLSGKYAHIDHQGRNAMVLHYSSI 199

Query: 248 VNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGEEYICQYTIVTIPXXXXXXXXXXP 307
           V R+  +FPK+W++L+TEV  + R+GK V +K +  E Y+C Y +VT+P           
Sbjct: 200 VKRVASSFPKEWLKLSTEVCEVRREGKKVCVK-TFEETYVCDYVVVTVPQSILELSLHK- 257

Query: 308 DESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTWSNESSRIFTLAHSQENF 367
            E+ T GRI+F PPLN  I E+F K+H+G LGKVVFEFDKC WS E ++I ++  + E F
Sbjct: 258 -EART-GRIEFCPPLNKDIVESFGKVHYGTLGKVVFEFDKCCWSTERAKILSMGKTPEGF 315

Query: 368 VEDVRKAETWEGLIDNL-KTPSSQLFENCWDFPLLFINLAKSIGRPTLIMLMQSPLSNYI 426
              VR A  +  L+  L K  S +L  + WDFPL F+NLAK+ G P+ +MLMQ PL+ Y+
Sbjct: 316 ARKVRNATDFCALVKELDKDTSYELGNDPWDFPLYFVNLAKTTGVPSFVMLMQEPLTGYV 375

Query: 427 ESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSANPTEAETNSPILKNLLVTNWNNDP 486
           ES+  DK+ VYE+F+P+L+ +   L S+  I        +A  N PILKN+  TNW  +P
Sbjct: 376 ESL-EDKRHVYEYFKPILESLFKVLGSDAPICDFEKGIDDARENVPILKNVFTTNWTREP 434

Query: 487 YSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWESGRREGEYIL 546
           YS GAYSACF  DD ++ I+A+  GQDS IRFAGEHT+MDGAG V+G+WESG+RE  YI 
Sbjct: 435 YSLGAYSACFPNDDPMDFILALEKGQDSHIRFAGEHTVMDGAGCVYGAWESGKREASYIS 494

Query: 547 EHL 549
           + L
Sbjct: 495 KRL 497

>Kwal_26.8214
          Length = 502

 Score =  485 bits (1249), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/485 (47%), Positives = 319/485 (65%), Gaps = 8/485 (1%)

Query: 68  STLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTLMNPLFLEEAEAMKK 127
           S L+  G  +C+VIEARDRIGGRL TV GYKG KYD+GA WHHDTL+N LFLEE   + +
Sbjct: 20  SVLHEKGCDSCIVIEARDRIGGRLHTVSGYKGRKYDVGASWHHDTLVNGLFLEEM-GLPR 78

Query: 128 DSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVKDCSFYHI 187
           + +  FVF+D   +  D  RGR+D+D  M LE +  E+ K+T L++++ L+V+D +++  
Sbjct: 79  EERTPFVFDDDSMLVFDKARGRVDYDSQMELEILVEELSKYTQLQYFEDLEVEDVNYFQT 138

Query: 188 ILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNALVTNFDSV 247
           I+KYL +RR+ LTDDQI++  Q+AR++ELWHG  W   S+K     HQGRNA V NF ++
Sbjct: 139 IMKYLYERRELLTDDQIQYLPQLARFMELWHGIDWKSQSSKGLEIAHQGRNAFVLNFGNI 198

Query: 248 VNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGEEYICQYTIVTIPXXXXXXXXXXP 307
             R+  T P++W  L TEV+ ++++G+ VL+  S GE   C Y IVTIP          P
Sbjct: 199 AQRVASTIPQEWFELETEVREVKKEGEKVLVSTSKGETISCDYVIVTIP-QSILAHSLQP 257

Query: 308 DESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTWSNESSRIFTLAHSQENF 367
           +    KGRI+F PPL+ +I+ + +  HFGGLGKVVFEF+ C WS E SR   L     + 
Sbjct: 258 EPR--KGRIEFIPPLSSEIKTSLEHAHFGGLGKVVFEFESCCWSKERSRALALGKPIVDL 315

Query: 368 VEDVRKAETWEGLIDNLKTPSSQLFEN--CWDFPLLFINLAKSIGRPTLIMLMQSPLSNY 425
              +R+A     L++ L   S   ++N   WDFPLLF+NLAK    P+ IMLM +PL+ Y
Sbjct: 316 TSKIREAVDLSQLVEKLDLDSKYTYKNGESWDFPLLFVNLAKHTDIPSFIMLMPNPLTEY 375

Query: 426 IESIGNDKQKVYEFFQPVLDKVMTTLQS-NKVINGLSANPTEAETNSPILKNLLVTNWNN 484
           IESI  DK+K+YEFF+P+LD+++ T      +I          +   P+LKN+L T+W  
Sbjct: 376 IESI-KDKEKLYEFFKPILDQLLVTFGCFEPIIKDFDDEIVSEDEKKPVLKNILTTSWTG 434

Query: 485 DPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWESGRREGEY 544
           D Y+ GAYSAC+ GDD + +++A+SN Q SRIRFAGEHTIMDGAG V+G+WESG+RE  +
Sbjct: 435 DDYALGAYSACYPGDDPMNVVLALSNNQTSRIRFAGEHTIMDGAGCVYGAWESGKREALF 494

Query: 545 ILEHL 549
           I + L
Sbjct: 495 IEDKL 499

>CAGL0M07612g complement(760610..762355) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2, hypothetical
           start
          Length = 581

 Score =  425 bits (1092), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 227/569 (39%), Positives = 322/569 (56%), Gaps = 109/569 (19%)

Query: 76  KNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTLMNPLFLEEAEAMKKDSKKR--- 132
           K+CLVIE+RDRIGGRL TV GY G +YDLGA WHHDTL N LF EE +    D       
Sbjct: 28  KSCLVIESRDRIGGRLCTVTGYNGARYDLGASWHHDTLTNRLFAEEVQLAAVDGADSTPQ 87

Query: 133 --------------------------------FVFEDSQFIYIDDQRGRIDHDPDMSLEF 160
                                           FVF+D   + +D  RG +    D+++  
Sbjct: 88  MFSGGATHCSASSASSASSASTGGNSAGVYAPFVFDDDDPLIVDKIRGSLG---DVTIRL 144

Query: 161 VDAEIDKFTGLEFYQSLDVK-----------------DCSFYHIILKYLLQRRDFLTDDQ 203
           +  EI+KF  L F+     +                 D   + ++L YL QR  FLTDDQ
Sbjct: 145 IADEIEKFIELYFHSEYTAELSDDNDSQHSHEGFPRADMPLFDMLLMYLQQRAPFLTDDQ 204

Query: 204 IKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNALVTNFDSVVNRIGDTFPKDW--IR 261
           + +  Q ARY+ELWHG SW +LS++D++F HQGRNA V N+D++ NRI      +   ++
Sbjct: 205 MWYGIQYARYMELWHGVSWYQLSSRDSFFGHQGRNAFVMNYDTIYNRIHGQIRTELGTVQ 264

Query: 262 LNTEVKAIERDGKNVLIKLSS-----------------GEEYI--CQYTIVTIPXXXXXX 302
           LN+ V  IE  G +  +  ++                 G+++   C Y IVTIP      
Sbjct: 265 LNSTVTKIENAGAHTTVSYTTSSASGAEDTQHGQHGAAGQQHTVQCSYVIVTIPQSLL-- 322

Query: 303 XXXXPDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTWSNESSRIFTLAH 362
                    ++G ++FKPPL PQI  A +K+HFG LGKVVFEF++C W   +++I  +AH
Sbjct: 323 ---------SEGAVEFKPPLVPQISAALQKMHFGSLGKVVFEFEECCWDLHTAKIVAVAH 373

Query: 363 ----SQENFVEDVRK--------AETWEGLIDNLKT--PSSQLFENCWDFPLLFINLAKS 408
               ++  F   +RK        A+  + L+ ++K       +  +CW+ PLLF+N+AK+
Sbjct: 374 AAADTRAEFTALLRKESREKNYTAQRLQALVQDVKQLLGDDAVRHDCWNQPLLFVNMAKT 433

Query: 409 IGRPTLIMLMQSPLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQS-NKVINGL------S 461
            G P+L+MLM  PL++YIES+ +D  +VYEFF+PVL ++M+   +   +INGL      +
Sbjct: 434 TGVPSLMMLMAPPLTHYIESL-HDSHQVYEFFKPVLSQIMSVCNAPGHIINGLDIAGGVA 492

Query: 462 ANPTEAETNSPILKNLLVTNWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGE 521
            +        PIL+N++VT+W NDPYS+GAYSAC+AGDDAL+M +AMSNGQ SR+RFAGE
Sbjct: 493 GDDANVSDKGPILRNVIVTDWTNDPYSKGAYSACYAGDDALDMFLAMSNGQSSRVRFAGE 552

Query: 522 HTIMDGAGAVHGSWESGRREGEYILEHLK 550
           HTI+DGAG  +G+WESG RE  YIL+ +K
Sbjct: 553 HTILDGAGCAYGAWESGEREANYILKQMK 581

>ABR057W [648] [Homologous to ScYMR020W (FMS1) - SH]
           complement(500154..501716) [1563 bp, 520 aa]
          Length = 520

 Score =  387 bits (994), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 193/491 (39%), Positives = 293/491 (59%), Gaps = 17/491 (3%)

Query: 68  STLYANGIKNCLVIEARDRIGGRLLTVKG--YKGDKYDLGAGWHHDTLMNPLFLEEAEAM 125
           + L++ GI+ C+V+EAR R GGRLL V+   + G +YDLGA WHHDTL N LF EE   +
Sbjct: 26  AELHSAGIEKCVVLEARARTGGRLLQVESSVFPGRRYDLGASWHHDTLSNELFAEELR-L 84

Query: 126 KKDSKKRFVFEDSQFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVKDCSFY 185
            +  +  +VF+D   + +     R+D D  + LE +  E++ +   ++++SL+ +D  F+
Sbjct: 85  PEAERAGYVFDDVPTMVVSPAGRRLDGDFGLMLEALQREVEHYIEEQYFESLEARDMPFF 144

Query: 186 HIILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNALVTNFD 245
            +++ YL +RR  LTDDQI+      R+ E WH   W  LSAK +  ++ GRNA V N+D
Sbjct: 145 ELVMAYLYERRGVLTDDQIQQLPGTVRFREFWHAIDWKLLSAKLSEVENNGRNAFVLNYD 204

Query: 246 SVVNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGEEYICQYTIVTIPXXXXXXXXX 305
            ++ R+    P++WIRL T V  IER    V I  + G  Y+ +  IVT+P         
Sbjct: 205 KLLRRVESGVPREWIRLGTRVTKIERVRDTVHITTADGACYVSKCAIVTVPQSVLELSLK 264

Query: 306 XPDESNTKGRIDFKPPLNPQIQEAFKKIHFGGLGKVVFEFDKCTWSNESSRIFTLAHSQE 365
                   GRI+F+PPLN  I  AF++ H+  LGK+ FEFDKCTW  +  R+   A   +
Sbjct: 265 ---PERVPGRIEFRPPLNDNITSAFERAHYASLGKIFFEFDKCTWDTQRPRVAIAAKVPD 321

Query: 366 NFVEDVRKAETWEGLIDNLKTPSSQ----LFENCWDFPLLFINLAKSIGRPTLIMLMQSP 421
           +F   VRKA+  + L   L++ S+Q    L ++C+DFP  F N+    G PTLI   Q+P
Sbjct: 322 DFSAQVRKAQDLQEL---LRSASAQTEVKLGQDCFDFPQEFQNMVALAGIPTLIAFTQTP 378

Query: 422 LSNYIESIGNDKQKVYEFFQPVLDKVMTTLQSNK--VINGLSANPTEAETNSPILKNLLV 479
           L+ ++E +   KQ++ ++F+P +   +  L S +  + +  +  P +     PILKN++ 
Sbjct: 379 LTEHVERLS--KQEIVDYFKPAIVVALRALGSKEECLFDLGNTQPQDDSHPGPILKNVIF 436

Query: 480 TNWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWESGR 539
             W+ D YSRG+Y+     DD L + +A++NGQDSRIRFAGEHT+M+G G  +G+WESGR
Sbjct: 437 NPWSQDTYSRGSYTGSHVDDDQLPLTVALNNGQDSRIRFAGEHTVMEGNGCTYGAWESGR 496

Query: 540 REGEYILEHLK 550
           RE EY+LE+L+
Sbjct: 497 REAEYVLEYLR 507

>KLLA0E07744g complement(696382..697983) similar to sp|P50264
           Saccharomyces cerevisiae YMR020w FMS1 suppressor of
           fenpropimorph resistance mutation FEN2 singleton, start
           by similarity
          Length = 533

 Score =  367 bits (941), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/495 (41%), Positives = 305/495 (61%), Gaps = 32/495 (6%)

Query: 68  STLYANGIKNCLVIEARDRIGGRLLTVKGYKGDKYDLGAGWHHDTLMNPLFLEEAEAMKK 127
           S L  +GI++ + IE+RDR+GGRL T +G  G KYD+G  WHHDTL N LF+EE  ++ +
Sbjct: 52  SDLVKSGIESVICIESRDRVGGRLNTRQGRNG-KYDIGGSWHHDTLSNGLFMEEM-SLPE 109

Query: 128 DSKKRFVFEDS-QFIYIDDQRGRIDHDPDMSLEFVDAEIDKFTGLEFYQSLDVKDCSFYH 186
             +  FVF+D  +   +D + G ++ D    LE +  E +K+  + +Y SLDV+D S++ 
Sbjct: 110 SERAGFVFDDEDRACLVDKKLGVLEVD---QLECLAYEFEKWVEMRYYDSLDVEDVSYFQ 166

Query: 187 IILKYLLQRRDFLTDDQIKFSAQIARYLELWHGASWDKLSAKDTYFDHQGRNALVTNFDS 246
           + +++   R++FLTD+Q+    Q+ RY+ELWHG  W  LS K +  +H GRNALV ++D 
Sbjct: 167 LCIEFCFSRKEFLTDEQLYHLPQLLRYMELWHGVDWYALSGKWSGIEHNGRNALVLHYDK 226

Query: 247 VVNRIGDTFPKDWIRLNTEVKAIERDGKNVLIKLSSGE--------EYICQYTIVTIPXX 298
           ++ RI +   KD I L+  V        N++ KLS+G+        +Y+C Y IVT+P  
Sbjct: 227 ILARISNPV-KDKIHLSESV--------NLIKKLSNGKYQVNTDKGKYLCDYCIVTVPQS 277

Query: 299 XXXXXXXXPDESNT---KGRIDFKPPLNPQIQEAF-KKIHFGGLGKVVFEFDKCTWSNES 354
                    +   +   K RI F+PPLN  I EA   K  FG LGKV+FEFD   WS  S
Sbjct: 278 VLAISCEQEENEFSHMRKARIGFEPPLNGDIFEAITTKASFGSLGKVIFEFDSIKWSKTS 337

Query: 355 SRIFTLAHSQENFVEDVRKAETWEGLIDNLKTPSSQLFENCWDFPLLFINLAKSIGRPTL 414
            RI T+     +FVE +R A+  + L+ +++    +  E+ W  P  F+NLAK     + 
Sbjct: 338 GRILTVHEQPTDFVESIRSAKDLKTLLKDIEQKLPRSHEDSWKNPTCFLNLAKHTDTASF 397

Query: 415 IMLMQSPLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSANPTEAETNSPIL 474
           + L+Q P++ YIE+     ++V EFF+PVL+K++ +L S+  I+ L  N    E+ +PIL
Sbjct: 398 VALIQQPVTEYIET--LTTEEVEEFFRPVLNKLLNSLGSSDYISDL--NDEVKESKTPIL 453

Query: 475 KNLLVTNWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGS 534
           KN+L +NW++DP+S GAYSAC  GDD ++++IA++ GQ   +RFAGEHTIMDGAG  +G+
Sbjct: 454 KNILTSNWSSDPFSLGAYSACQPGDDPMDLVIALNVGQ-GNLRFAGEHTIMDGAGCAYGA 512

Query: 535 WESGRREGEYILEHL 549
           WESG+RE  YI+E L
Sbjct: 513 WESGKREANYIIEKL 527

>Scas_560.11*
          Length = 753

 Score = 30.4 bits (67), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 4/106 (3%)

Query: 360 LAHSQENFVEDVRKAETWEGLIDNLKTPSSQLFENCWDFPLLFINLAKSIGRPTLIMLMQ 419
           L   Q N+V  +RK +  E LI  +K    +  E+ W + L        I  PTL  L+ 
Sbjct: 47  LTDFQRNYVSQLRKFDDVERLIHYMKNILEKHSESTWKYILHIDQDGNDIQDPTLSQLLH 106

Query: 420 SPLSNYIESIGNDKQKVYEFFQPV--LDKVMTTLQSNKVINGLSAN 463
           S  ++  +SI N    +  F   V  LD  +  L+    +NGL  N
Sbjct: 107 SLGTHSQDSINNLVDDINGFENRVRQLDDSLDNLKMK--LNGLVEN 150

>KLLA0E08921g 793287..794315 similar to sp|P53112 Saccharomyces
           cerevisiae YGL153w PEX14 peroxisomal protein involved in
           protein import - peroxin singleton, start by similarity
          Length = 342

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 51/124 (41%), Gaps = 15/124 (12%)

Query: 418 MQSPLSNYIESIGNDKQKVYEFFQPVLDKVMTTLQSNKVINGLSANPTEAETNSPILKNL 477
           MQ+ + ++ +  GN+K+         L+KV   LQS K +   S NP  A  N     N 
Sbjct: 206 MQNSIDSFTKKAGNEKE---------LEKVQEELQSLKSLIKSSFNPASAMNNGNTGGNS 256

Query: 478 LVTNWNNDPYSRGAYSACFAGDDALEMIIAMSNGQDSRIRFAGEHTIMDGAGAVHGSWES 537
           L++     P S G      +   A +++  M   + S    AG  T      AV  +W+ 
Sbjct: 257 LIS-----PNSTGMIPGADSIPSAADILANMDLQKKSASPPAGSLTNGTDTKAVP-AWKK 310

Query: 538 GRRE 541
            R E
Sbjct: 311 AREE 314

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.137    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 18,083,996
Number of extensions: 787498
Number of successful extensions: 1979
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1982
Number of HSP's successfully gapped: 12
Length of query: 552
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 445
Effective length of database: 12,891,983
Effective search space: 5736932435
Effective search space used: 5736932435
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)