Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_707.471200120064760.0
YPR010C (RPA135)1203120260230.0
CAGL0J01848g1202120259220.0
KLLA0B06303g1203120958230.0
Kwal_14.14921197120058210.0
ABR029W1198120154100.0
Scas_70.125923510531e-134
Kwal_26.85531171106410281e-120
Scas_605.141150106210111e-118
ADL275C1141104810001e-116
YOR207C (RET1)114910459961e-115
CAGL0L02849g113310419891e-115
Kwal_47.18783122011689901e-114
KLLA0F01078g114210449791e-113
YOR151C (RPB2)122411569771e-112
AFR404C122211719661e-111
CAGL0L04246g122311639641e-111
Scas_714.41122411589641e-110
KLLA0B05577g12214997639e-84
YGL084C (GUP1)560141761.0
CAGL0J07942g1244106761.0
CAGL0E00847g1825181751.5
Sklu_2213.649550741.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_707.47
         (1200 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_707.47                                                          2499   0.0  
YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA pol...  2324   0.0  
CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharo...  2285   0.0  
KLLA0B06303g complement(555780..559391) highly similar to sp|P22...  2247   0.0  
Kwal_14.1492                                                         2246   0.0  
ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH] complement...  2088   0.0  
Scas_70.1                                                             410   e-134
Kwal_26.8553                                                          400   e-120
Scas_605.14                                                           394   e-118
ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..22...   389   e-116
YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polym...   388   e-115
CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharo...   385   e-115
Kwal_47.18783                                                         385   e-114
KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharom...   381   e-113
YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polym...   380   e-112
AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH] (1162949..1...   376   e-111
CAGL0L04246g complement(493026..496697) highly similar to sp|P08...   375   e-111
Scas_714.41                                                           375   e-110
KLLA0B05577g complement(501690..505355) highly similar to sp|P08...   298   9e-84
YGL084C (GUP1) [1898] chr7 complement(350617..352299) Protein in...    34   1.0  
CAGL0J07942g 772758..776492 similar to sp|P38717 Saccharomyces c...    34   1.0  
CAGL0E00847g <73766..79244 highly similar to sp|P11075 Saccharom...    33   1.5  
Sklu_2213.6 YGR155W, Contig c2213 9246-10733 reverse complement        33   1.6  

>Scas_707.47
          Length = 1200

 Score = 2499 bits (6476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1200/1200 (100%), Positives = 1200/1200 (100%)

Query: 1    MSKVIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGL 60
            MSKVIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGL
Sbjct: 1    MSKVIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGL 60

Query: 61   LNQGVKDIGEKVIFDGKTGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVF 120
            LNQGVKDIGEKVIFDGKTGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVF
Sbjct: 61   LNQGVKDIGEKVIFDGKTGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVF 120

Query: 121  PSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQ 180
            PSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQ
Sbjct: 121  PSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQ 180

Query: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD 240
            HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD
Sbjct: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD 240

Query: 241  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFL 300
            QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFL
Sbjct: 241  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFL 300

Query: 301  TDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHL 360
            TDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHL
Sbjct: 301  TDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHL 360

Query: 361  GKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEYLQ 420
            GKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEYLQ
Sbjct: 361  GKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEYLQ 420

Query: 421  NIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVS 480
            NIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVS
Sbjct: 421  NIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVS 480

Query: 481  GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL 540
            GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL
Sbjct: 481  GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL 540

Query: 541  NHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQGK 600
            NHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQGK
Sbjct: 541  NHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQGK 600

Query: 601  IIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDKED 660
            IIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDKED
Sbjct: 601  IIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDKED 660

Query: 661  IVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMG 720
            IVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMG
Sbjct: 661  IVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMG 720

Query: 721  KQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 780
            KQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD
Sbjct: 721  KQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 780

Query: 781  MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKLDD 840
            MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKLDD
Sbjct: 781  MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKLDD 840

Query: 841  DGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS 900
            DGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS
Sbjct: 841  DGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS 900

Query: 901  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGM 960
            IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGM
Sbjct: 901  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGM 960

Query: 961  FVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEEL 1020
            FVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEEL
Sbjct: 961  FVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEEL 1020

Query: 1021 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1080
            RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH
Sbjct: 1021 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1080

Query: 1081 GTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKSML 1140
            GTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKSML
Sbjct: 1081 GTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKSML 1140

Query: 1141 AKDEETSNVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYLDSELTAMGIRLRYNVEP 1200
            AKDEETSNVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYLDSELTAMGIRLRYNVEP
Sbjct: 1141 AKDEETSNVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYLDSELTAMGIRLRYNVEP 1200

>YPR010C (RPA135) [5446] chr16 complement(577580..581191) RNA
            polymerase I second largest subunit [3612 bp, 1203 aa]
          Length = 1203

 Score = 2324 bits (6023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1094/1202 (91%), Positives = 1155/1202 (96%), Gaps = 2/1202 (0%)

Query: 1    MSKVIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGL 60
            MSKVIKPP  ARTA FRTLERESRFINPPKDKSA+PLLQEAV+PH+GSFNALTEGPDGGL
Sbjct: 1    MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGL 60

Query: 61   LNQGVKDIGEKVIFDGK--TGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERK 118
            LN GVKDIGEKVIFDGK      +     YLGNKLS+SVEQVSIAKP SNDGVSSAVERK
Sbjct: 61   LNLGVKDIGEKVIFDGKPLNSEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERK 120

Query: 119  VFPSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYEL 178
            V+PSESRQRL SY+GKL+LKLKWSVN+GEE   EVRDCGGLPVMLQSNRCHLNK+SPYEL
Sbjct: 121  VYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGGLPVMLQSNRCHLNKMSPYEL 180

Query: 179  VQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVR 238
            VQHKEESDE+GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSF NRGA+Y+ +GIQ+RSVR
Sbjct: 181  VQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR 240

Query: 239  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDS 298
            PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALC TSDREIFDGIIG+D+ DS
Sbjct: 241  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDS 300

Query: 299  FLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLV 358
            FLTDRLELLLRGFKKRYP LQNRTQVLQ+LGDKFRVVFQASPD+SD EVGQEVLDRIVLV
Sbjct: 301  FLTDRLELLLRGFKKRYPHLQNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLV 360

Query: 359  HLGKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEY 418
            HLGK  ++DKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMI+KEKIDEY
Sbjct: 361  HLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMILKEKIDEY 420

Query: 419  LQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQ 478
            LQNII Q+R D NRG+AINFKD++YMSRVLMRVNENIGSK+QYFLSTGNLVSQSGLDLQQ
Sbjct: 421  LQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ 480

Query: 479  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 538
            VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG
Sbjct: 481  VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCG 540

Query: 539  LLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQ 598
            LLNHFAHKC+ISTQQSDVS+IP +LY LGV+PASHT AAGPS CCVQIDGKIIGWVSHEQ
Sbjct: 541  LLNHFAHKCRISTQQSDVSRIPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQ 600

Query: 599  GKIIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDK 658
            GKIIADTLR+WKVEGK PGLP+DLEIGYVPPSTRGQYPGLY+FGGHSRM+RPVRYLPLDK
Sbjct: 601  GKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGLYLFGGHSRMLRPVRYLPLDK 660

Query: 659  EDIVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 718
            EDIVGPFEQVYMN+AVTPQEI+NNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ
Sbjct: 661  EDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ 720

Query: 719  MGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTG 778
            MGKQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNG NAVVAVISYTG
Sbjct: 721  MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTG 780

Query: 779  YDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKL 838
            YDMDDAMIINKSADERGFGYGTMYK EKVDL+LNR+RGDPITQHFGFGNDEWPKEWL+KL
Sbjct: 781  YDMDDAMIINKSADERGFGYGTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKL 840

Query: 839  DDDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 898
            D+DGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT
Sbjct: 841  DEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQT 900

Query: 899  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTI 958
            VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPD+IINPHAFPSRMTI
Sbjct: 901  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI 960

Query: 959  GMFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGE 1018
            GMFVESLAGK+GALHG+AQD+TPWIFNEDDTPADYFG+QL KAGYNYHGNEPMYSGATGE
Sbjct: 961  GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGE 1020

Query: 1019 ELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1078
            ELRADIY+GVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI
Sbjct: 1021 ELRADIYVGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1080

Query: 1079 GHGTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKS 1138
            GHGTSFLLQDRLLN SDYTQ SVCRECGSILTTQQSVPRIGS+STVCCRRC++RF++AK 
Sbjct: 1081 GHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRIGSISTVCCRRCSMRFEDAKK 1140

Query: 1139 MLAKDEETSNVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYLDSELTAMGIRLRYNV 1198
            +L K E+   +FIDDS+IWEDGQGNKFVGGN+TTTVAIPFVLKYLDSEL+AMGIRLRYNV
Sbjct: 1141 LLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLDSELSAMGIRLRYNV 1200

Query: 1199 EP 1200
            EP
Sbjct: 1201 EP 1202

>CAGL0J01848g 177319..180927 highly similar to sp|P22138 Saccharomyces
            cerevisiae YPR010c RPA135, start by similarity
          Length = 1202

 Score = 2285 bits (5922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1072/1202 (89%), Positives = 1148/1202 (95%), Gaps = 3/1202 (0%)

Query: 1    MSKVIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGL 60
            MSKVIKPPSNARTAHFRTLERE+RF NPPKDKSAYPLLQEAV+PHVGSFNALTEGPDGGL
Sbjct: 1    MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPHVGSFNALTEGPDGGL 60

Query: 61   LNQGVKDIGEKVIFDGKTGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVF 120
            L + V+DIGEKVIFDGK+       D YLGNKLSISVEQVSIAKPT+NDGV  A ER V+
Sbjct: 61   LQRAVEDIGEKVIFDGKSDGSDEISD-YLGNKLSISVEQVSIAKPTANDGVMGAAERPVY 119

Query: 121  PSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQ 180
            PSE+RQRL SY+GK++LKLKWSVNDGE  F+EVRDCGGLP+MLQSNRCHLNK+SP+ELVQ
Sbjct: 120  PSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQSNRCHLNKMSPHELVQ 179

Query: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD 240
            HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSF NRGA+Y+Q+GIQ+RSVRPD
Sbjct: 180  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGIQIRSVRPD 239

Query: 241  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFL 300
            QTSQTNVLHYLNDGQVTFRFSWRKNEYL+PVVMI+KAL DTSDREIFDGIIGS+ ++SFL
Sbjct: 240  QTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTSDREIFDGIIGSNTNNSFL 299

Query: 301  TDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHL 360
            TDRLELLLRGFKKRYP L+NRTQVLQ+LGDKFR+VFQASPDKSDYEVGQEVL+RIVLVHL
Sbjct: 300  TDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPDKSDYEVGQEVLNRIVLVHL 359

Query: 361  GKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEYLQ 420
            G   N DKFRMLLFM+RKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMI+KEKIDEYLQ
Sbjct: 360  GSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMILKEKIDEYLQ 419

Query: 421  NIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVS 480
             I+ Q+RTD NRG+AINF ++KYMSRVLMRVN+NIGSK+QYFLSTGNLVSQSGLDLQQVS
Sbjct: 420  GIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKMQYFLSTGNLVSQSGLDLQQVS 479

Query: 481  GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL 540
            GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL
Sbjct: 480  GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL 539

Query: 541  NHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQGK 600
            NHFAHKC+IST QSDVS++P LLY LGV+PASHT AAGPS CCVQ+DGKIIGW SHEQG+
Sbjct: 540  NHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAAGPSLCCVQLDGKIIGWTSHEQGR 599

Query: 601  IIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDKED 660
            +IADTLRFWKVEG+ PGLP DLEIGYVPPS++GQYPGLYIFGGHSRMMRPVRYLPLDKED
Sbjct: 600  VIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDKED 659

Query: 661  IVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMG 720
            IVGPFEQVYMN+AVTPQEI+NN+HTHVEF+PTNILSILANLTPFSDFNQSPRNMYQCQMG
Sbjct: 660  IVGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMG 719

Query: 721  KQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 780
            KQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD
Sbjct: 720  KQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 779

Query: 781  MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKLDD 840
            MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDP+TQHFGFG DEWPKEWLDKLD+
Sbjct: 780  MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKLDE 839

Query: 841  DGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS 900
            DGLPYIGTYVEEGDPICAYFDDT+ KTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS
Sbjct: 840  DGLPYIGTYVEEGDPICAYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS 899

Query: 901  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGM 960
            IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPDVIINPHAFPSRMTIGM
Sbjct: 900  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGM 959

Query: 961  FVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEEL 1020
            FVESLAGK+GALHG+AQD+TPWIFNE DTPADYFG+QL+KAGYNYHGNEPMYSGATGEEL
Sbjct: 960  FVESLAGKAGALHGIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEEL 1019

Query: 1021 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1080
            R DIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH
Sbjct: 1020 RCDIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1079

Query: 1081 GTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKSML 1140
            GTSFLLQDRLLN SDYTQ ++CRECGSILTTQQ+VPRIG++S+VCCRRCAV+F++AK  L
Sbjct: 1080 GTSFLLQDRLLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTL 1139

Query: 1141 AKDEETS--NVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYLDSELTAMGIRLRYNV 1198
             + EE +   +FIDDS+IWEDGQG KFVGGNDTTTVAIPFVLKYLDSEL+AMGIRLRYNV
Sbjct: 1140 FEHEEKTEEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYLDSELSAMGIRLRYNV 1199

Query: 1199 EP 1200
            +P
Sbjct: 1200 DP 1201

>KLLA0B06303g complement(555780..559391) highly similar to sp|P22138
            Saccharomyces cerevisiae YPR010c RPA135 DNA-directed RNA
            polymerase I, 135 KD subunit, start by similarity
          Length = 1203

 Score = 2247 bits (5823), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1059/1209 (87%), Positives = 1137/1209 (94%), Gaps = 16/1209 (1%)

Query: 1    MSKVIKPPSNA-----RTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEG 55
            MS VI PP        RTA FRTLERESRFINPPKDKSAYP L +AV+PH+GSFNALTEG
Sbjct: 1    MSSVILPPQAPVERLNRTASFRTLERESRFINPPKDKSAYPFLADAVQPHIGSFNALTEG 60

Query: 56   PDGGLLNQGVKDIGEKVIFDGKTGAVQTGKDS---YLGNKLSISVEQVSIAKPTSNDGVS 112
            PDGGLLN G KDIG KVIFDGK      G D+   YLGNKLS+S+EQVSI+KPTSNDGVS
Sbjct: 61   PDGGLLNLGAKDIGSKVIFDGK------GSDTNPNYLGNKLSLSIEQVSISKPTSNDGVS 114

Query: 113  SAVERKVFPSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNK 172
            SAVERKVFPSESRQRL SY+GK++LKLKWSVNDGEETFTEVRDCGGLP+MLQSNRCHLNK
Sbjct: 115  SAVERKVFPSESRQRLTSYRGKILLKLKWSVNDGEETFTEVRDCGGLPIMLQSNRCHLNK 174

Query: 173  LSPYELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGI 232
            +SPYELV+H+EESDE GGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSF NRGA+Y+Q+GI
Sbjct: 175  MSPYELVEHREESDEFGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSQYGI 234

Query: 233  QLRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIG 292
            Q+RSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYL+PVVMIL+ALCDT+DREIFD ++G
Sbjct: 235  QIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMILRALCDTNDREIFDHVVG 294

Query: 293  SDLHDSFLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVL 352
             D  +SFLTDRLELLLRGFKKRYPTLQNR Q LQ+LGDKFRVVFQASPD +D +VGQE+L
Sbjct: 295  GDTSNSFLTDRLELLLRGFKKRYPTLQNRKQTLQYLGDKFRVVFQASPDMTDLQVGQELL 354

Query: 353  DRIVLVHLGKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIK 412
            +RIVLVHLG+ NN+DKF MLLFMIRKLYSLVAGECSPDNPDA QHQE+LLGGFLYGMI+K
Sbjct: 355  NRIVLVHLGE-NNKDKFNMLLFMIRKLYSLVAGECSPDNPDAAQHQEILLGGFLYGMIVK 413

Query: 413  EKIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQS 472
            EKI+EYLQNI  QI+TD NRGLAINFKD+KYM++VLMRVNENIGSKLQYFLSTGNLVSQS
Sbjct: 414  EKIEEYLQNIRLQIQTDINRGLAINFKDQKYMNKVLMRVNENIGSKLQYFLSTGNLVSQS 473

Query: 473  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTP 532
            GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGF CPVHTP
Sbjct: 474  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFFCPVHTP 533

Query: 533  DGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIG 592
            DGSPCGLLNH +HKCKIST+QSDVS+IP +LY LGV+PA+H IAAGPS CCVQ+DGKIIG
Sbjct: 534  DGSPCGLLNHLSHKCKISTEQSDVSKIPSILYSLGVTPAAHVIAAGPSMCCVQLDGKIIG 593

Query: 593  WVSHEQGKIIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVR 652
            W SHEQGK++ADTLRFWKVEGK PGLP+DLE+GYVPP+T GQYPGL++FGGHSRMMRPVR
Sbjct: 594  WCSHEQGKVVADTLRFWKVEGKTPGLPVDLEVGYVPPTTSGQYPGLFLFGGHSRMMRPVR 653

Query: 653  YLPLDKEDIVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPR 712
            YLPLDKEDIVGPFEQVYMN+AVTP+EIENNVH+HVEF+PTNILSILANLTPFSDFNQSPR
Sbjct: 654  YLPLDKEDIVGPFEQVYMNIAVTPEEIENNVHSHVEFSPTNILSILANLTPFSDFNQSPR 713

Query: 713  NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVA 772
            NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNGTNAVVA
Sbjct: 714  NMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGTNAVVA 773

Query: 773  VISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPK 832
            VISYTGYDMDDAMIINKSADERGFGYGTMYKVEKV+LS+NRSRGDPITQHFGFG DEWPK
Sbjct: 774  VISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVNLSMNRSRGDPITQHFGFGTDEWPK 833

Query: 833  EWLDKLDDDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNK 892
            EWL+KLDDDGLP IGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDES+K
Sbjct: 834  EWLEKLDDDGLPLIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVKLIGDESSK 893

Query: 893  FQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAF 952
            FQELQ ++IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT+DMPFSETGIQPDVIINPHAF
Sbjct: 894  FQELQAITIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAF 953

Query: 953  PSRMTIGMFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMY 1012
            PSRMTIGMFVESLAGK+GALHG+AQD+TPW FNE DTPADYFGDQL KAGYNYHGNEPMY
Sbjct: 954  PSRMTIGMFVESLAGKAGALHGIAQDSTPWTFNESDTPADYFGDQLAKAGYNYHGNEPMY 1013

Query: 1013 SGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM 1072
            SGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM
Sbjct: 1014 SGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEM 1073

Query: 1073 ERDALIGHGTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVR 1132
            ERDALIGHGTSFLLQDRLLNCSDYTQT+VCR+CG+ILTTQ SVP+IGS+STV CRRCA++
Sbjct: 1074 ERDALIGHGTSFLLQDRLLNCSDYTQTAVCRDCGAILTTQSSVPKIGSISTVRCRRCALK 1133

Query: 1133 FDEAKSMLAKDEETSN-VFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYLDSELTAMG 1191
            FDEAK ++ K E  S  V I DSEIWEDGQGNKFVGG +TTTVAIPFVLKYLDSEL AMG
Sbjct: 1134 FDEAKRLITKYESGSEPVHIADSEIWEDGQGNKFVGGGNTTTVAIPFVLKYLDSELAAMG 1193

Query: 1192 IRLRYNVEP 1200
            IRLRYNVEP
Sbjct: 1194 IRLRYNVEP 1202

>Kwal_14.1492
          Length = 1197

 Score = 2246 bits (5821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1050/1200 (87%), Positives = 1143/1200 (95%), Gaps = 4/1200 (0%)

Query: 1    MSKVIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGL 60
            MSKV+K P+NARTAHFRT+ERE+RF+NPPKDKSA+PLL+EAVEPH+GSFNALTEGP+GGL
Sbjct: 1    MSKVVKLPANARTAHFRTVERENRFVNPPKDKSAFPLLREAVEPHIGSFNALTEGPEGGL 60

Query: 61   LNQGVKDIGEKVIFDGKTGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVF 120
            LNQ VKDIG K++FDG++    +   +YLGNKL++SVEQVSI+KP SNDGV+SAVERK++
Sbjct: 61   LNQAVKDIGGKIVFDGRSSEENS---NYLGNKLTLSVEQVSISKPVSNDGVTSAVERKIY 117

Query: 121  PSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQ 180
            P+ESRQRL SY+GKL+LKLKWSVNDGEE+FTE++DCGGLPVMLQSNRCHLN LSP ELV+
Sbjct: 118  PAESRQRLSSYRGKLLLKLKWSVNDGEESFTEIKDCGGLPVMLQSNRCHLNNLSPNELVK 177

Query: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD 240
            +KEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSF+NRGA+Y+Q+GIQ+RSVRPD
Sbjct: 178  NKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFSNRGASYSQYGIQIRSVRPD 237

Query: 241  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFL 300
            QTSQTNVLHYLNDG+VTFRFSWRKNEYL+PVVMILKALC+ +DREIFDGI+GSD  +SFL
Sbjct: 238  QTSQTNVLHYLNDGEVTFRFSWRKNEYLIPVVMILKALCELNDREIFDGIVGSDTSNSFL 297

Query: 301  TDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHL 360
            TDRLELLLRG KK+Y  LQNR QVLQ+LGDKFRVV QASPD +D++VG+E+L RIVLVHL
Sbjct: 298  TDRLELLLRGHKKKYGQLQNRRQVLQYLGDKFRVVLQASPDATDFQVGEELLSRIVLVHL 357

Query: 361  GKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEYLQ 420
            G GNNEDK RMLLFMIRKLYSLVAGEC+PDNPDATQHQEVLLGGFLYGMIIKEKI+EYLQ
Sbjct: 358  G-GNNEDKSRMLLFMIRKLYSLVAGECAPDNPDATQHQEVLLGGFLYGMIIKEKIEEYLQ 416

Query: 421  NIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVS 480
            NI  QI++D NRGLA+NFK+RKYM+RVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVS
Sbjct: 417  NIRLQIQSDVNRGLAVNFKERKYMNRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVS 476

Query: 481  GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL 540
            GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL
Sbjct: 477  GYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLL 536

Query: 541  NHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQGK 600
            NHFAHKCKIST QSDVS+IP LLY LGV+PASHT+AAGP+ CCVQ+DGKI+GW SHEQGK
Sbjct: 537  NHFAHKCKISTTQSDVSRIPALLYSLGVAPASHTVAAGPTACCVQLDGKIVGWCSHEQGK 596

Query: 601  IIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDKED 660
            IIADTLRFWKVEG+  GLPLDLEIGYVPPS+RGQYPGLY+FGGHSRMMRPV+YLPL KED
Sbjct: 597  IIADTLRFWKVEGETAGLPLDLEIGYVPPSSRGQYPGLYLFGGHSRMMRPVKYLPLGKED 656

Query: 661  IVGPFEQVYMNVAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMG 720
            IVGPFEQVYMN+AVTPQEI+NN+HTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMG
Sbjct: 657  IVGPFEQVYMNIAVTPQEIQNNIHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMG 716

Query: 721  KQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYD 780
            KQTMGTPGVALCHRSDNKLYRLQ+GQTPIVKANLYDDYGMDNFPNG NAVVAVISYTGYD
Sbjct: 717  KQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGMNAVVAVISYTGYD 776

Query: 781  MDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKLDD 840
            MDDAMIINKSADERGFGYGTMYKVEK+DLS+NRSRGDPITQHFGFG+DEWPK WL+KLDD
Sbjct: 777  MDDAMIINKSADERGFGYGTMYKVEKIDLSMNRSRGDPITQHFGFGDDEWPKGWLEKLDD 836

Query: 841  DGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVS 900
            DGLP IGTYVEEGDPICA+FDDTLNKTKIKTYHSSEPAYIEEVNLIGDES+KFQELQT+S
Sbjct: 837  DGLPIIGTYVEEGDPICAFFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESSKFQELQTIS 896

Query: 901  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGM 960
            IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSE+G+QPD+IINPHAFPSRMTIGM
Sbjct: 897  IKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSESGMQPDIIINPHAFPSRMTIGM 956

Query: 961  FVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEEL 1020
            FVESLAGK+GALHG+A DATPW F+E DTPA+YFGDQL+ AGYNYHGNEPMYSGATGEEL
Sbjct: 957  FVESLAGKAGALHGMAHDATPWTFSEKDTPANYFGDQLLSAGYNYHGNEPMYSGATGEEL 1016

Query: 1021 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1080
            RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH
Sbjct: 1017 RADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGH 1076

Query: 1081 GTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKSML 1140
            GTSFLLQDRLLNCSDYTQ++VCRECGS+LTT  SVPRIGSL+TV CRRCAV+FDEAK ++
Sbjct: 1077 GTSFLLQDRLLNCSDYTQSAVCRECGSLLTTHYSVPRIGSLATVRCRRCAVKFDEAKKIV 1136

Query: 1141 AKDEETSNVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYLDSELTAMGIRLRYNVEP 1200
            AK +    +FIDDS IWEDGQGNKFVGG  TTTVAIPFVLKYLDSEL AMGI+LRYNVEP
Sbjct: 1137 AKYQGEDQIFIDDSHIWEDGQGNKFVGGGQTTTVAIPFVLKYLDSELAAMGIKLRYNVEP 1196

>ABR029W [620] [Homologous to ScYPR010C (RPA135) - SH]
            complement(450645..454241) [3597 bp, 1198 aa]
          Length = 1198

 Score = 2088 bits (5410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 999/1201 (83%), Positives = 1087/1201 (90%), Gaps = 10/1201 (0%)

Query: 4    VIKPPSNARTAHFRTLERESRFINPPKDKSAYPLLQEAVEPHVGSFNALTEGPDGGLLNQ 63
            V++P S  RTA FRTLERE+RF++PPKDKSAYPLL EAVEPHVGSFNALTEGP GGLLN 
Sbjct: 3    VMEPLSANRTAQFRTLEREARFVSPPKDKSAYPLLYEAVEPHVGSFNALTEGPGGGLLNL 62

Query: 64   GVKDIGEKVIFDGKTGAVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVFPSE 123
            G +DIG KV+FDGK         +YLGNKL++SV QVS+ KP SNDGV++A ER VFP+E
Sbjct: 63   GARDIGAKVVFDGKAS---DENPNYLGNKLALSVTQVSLTKPMSNDGVTAAAERNVFPAE 119

Query: 124  SRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQHKE 183
            +R+RL +Y+GKL+LKL WSVNDGEETF+EVRDCG LPVMLQSNRCHL+K+SP ELV+HKE
Sbjct: 120  ARKRLTTYRGKLLLKLNWSVNDGEETFSEVRDCGPLPVMLQSNRCHLHKMSPQELVEHKE 179

Query: 184  ESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPDQTS 243
            ESDELGGYFI+NGIEKLIRMLIVQRRNHPMAIIRPSF NRG +Y+ +G+Q+R VRPDQTS
Sbjct: 180  ESDELGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGTSYSHYGVQIRCVRPDQTS 239

Query: 244  QTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFLTDR 303
            QTNVLHYLNDGQVTFRFSWRKNEYLVPVV+ILKAL D SDREIFDGI+G+D  +SFLTDR
Sbjct: 240  QTNVLHYLNDGQVTFRFSWRKNEYLVPVVLILKALTDASDREIFDGIVGADTSNSFLTDR 299

Query: 304  LELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHLGKG 363
            LELLLRGFKKR+P L NR QVLQ+LGDKFRVV QASPD SDY VGQE+L RIVLVHLG  
Sbjct: 300  LELLLRGFKKRFPQLLNRRQVLQYLGDKFRVVLQASPDMSDYLVGQELLRRIVLVHLGD- 358

Query: 364  NNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEYLQNII 423
             N DK  ML+FMIRKLYSLVAGEC PDNPDATQHQEVLLGGFLYGMI+KEKI+EYLQNI 
Sbjct: 359  ENTDKSNMLMFMIRKLYSLVAGECCPDNPDATQHQEVLLGGFLYGMIVKEKIEEYLQNIK 418

Query: 424  QQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVSGYT 483
             QI+ D NRG+ ++FKDRKYM+RVL R+NENIGSKLQYFLSTGNLVSQSGLDLQQVSGYT
Sbjct: 419  LQIQADVNRGMPVDFKDRKYMTRVLTRINENIGSKLQYFLSTGNLVSQSGLDLQQVSGYT 478

Query: 484  VVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHF 543
            VVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHF
Sbjct: 479  VVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHF 538

Query: 544  AHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPSQCCVQIDGKIIGWVSHEQGKIIA 603
            AHKCKIST QSDVS+IP LLY LGVSPA+H  AAGPS CCVQ+DGKI+GW SHEQG+I+A
Sbjct: 539  AHKCKISTTQSDVSKIPTLLYSLGVSPAAHVTAAGPSLCCVQLDGKIVGWCSHEQGRIVA 598

Query: 604  DTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVRYLPLDKEDIVG 663
            DTLR+WKVEGK  GLPLDLEIGYVP S RGQYPGLY+FGGHSRMMRPVRYLPLDK+DIVG
Sbjct: 599  DTLRYWKVEGKTDGLPLDLEIGYVPASKRGQYPGLYLFGGHSRMMRPVRYLPLDKQDIVG 658

Query: 664  PFEQVYMNVAVTPQEIENNVHTHV---EFTPTNILSILANLTPFS-DFNQSPRNMYQCQM 719
            PFEQVYM++AVTP+E  N + T +    F    ILSILANLTPF       P+     QM
Sbjct: 659  PFEQVYMDIAVTPEE--NPLITSILMLNFHQQIILSILANLTPFLLTLTNLPKICTNYQM 716

Query: 720  GKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGY 779
            GKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGY
Sbjct: 717  GKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGY 776

Query: 780  DMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRGDPITQHFGFGNDEWPKEWLDKLD 839
            DMDDAMIINKSADERGF YGT+YK EK+DLSL+R RGDP+TQHFGFG DEWPKEWL+KLD
Sbjct: 777  DMDDAMIINKSADERGFSYGTVYKTEKIDLSLSRGRGDPVTQHFGFGTDEWPKEWLEKLD 836

Query: 840  DDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTV 899
            +DGLP IG+YVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEV LIGDESNKFQELQ +
Sbjct: 837  EDGLPIIGSYVEEGDPICAYFDDTLNKTKIKTYHSSEPAYIEEVTLIGDESNKFQELQYI 896

Query: 900  SIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIG 959
            +IKYRIRR PQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIG
Sbjct: 897  TIKYRIRRVPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIG 956

Query: 960  MFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEE 1019
            MFVESLAGK+GALHG+AQDATPW F+E+DTPADYFGDQL+KAGYNYHGNEPMYSGATGEE
Sbjct: 957  MFVESLAGKAGALHGIAQDATPWTFSEEDTPADYFGDQLLKAGYNYHGNEPMYSGATGEE 1016

Query: 1020 LRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIG 1079
            LRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIG
Sbjct: 1017 LRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIG 1076

Query: 1080 HGTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSVPRIGSLSTVCCRRCAVRFDEAKSM 1139
            HGTSFLLQDRLLN SDYTQ++VCRECGSILTTQ SVP+IGS+ T+ CRRCA+ FDEAK +
Sbjct: 1077 HGTSFLLQDRLLNSSDYTQSAVCRECGSILTTQSSVPKIGSMVTIRCRRCAISFDEAKKI 1136

Query: 1140 LAKDEETSNVFIDDSEIWEDGQGNKFVGGNDTTTVAIPFVLKYLDSELTAMGIRLRYNVE 1199
            + + +   ++FIDDS IWEDGQGNKFVGG +TTTVAIPFVLKYLDSEL AMGIRLRYNV+
Sbjct: 1137 ITQQDSEDSIFIDDSHIWEDGQGNKFVGGGNTTTVAIPFVLKYLDSELAAMGIRLRYNVD 1196

Query: 1200 P 1200
            P
Sbjct: 1197 P 1197

>Scas_70.1
          Length = 259

 Score =  410 bits (1053), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 203/235 (86%), Positives = 217/235 (92%), Gaps = 1/235 (0%)

Query: 294 DLHDSFLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLD 353
           D  +SFLTDRLELLLRGFKK+YP LQNR QVLQ+LGDKFRVVFQASPD +DY+VG+EVL 
Sbjct: 12  DTSNSFLTDRLELLLRGFKKKYPQLQNRRQVLQYLGDKFRVVFQASPDMTDYQVGEEVLR 71

Query: 354 RIVLVHLGKGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKE 413
           RIVLVHLG+ + +DKF MLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMI+KE
Sbjct: 72  RIVLVHLGE-DGKDKFHMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIVKE 130

Query: 414 KIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSG 473
           KI+EYLQNI  QI+ D NRGLA+NFKDRKYM+RVLMRVNENIGSKLQYFLSTGNLVSQSG
Sbjct: 131 KIEEYLQNIRLQIQADVNRGLAVNFKDRKYMTRVLMRVNENIGSKLQYFLSTGNLVSQSG 190

Query: 474 LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCP 528
           LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPE  G   P
Sbjct: 191 LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPEILGVPMP 245

>Kwal_26.8553
          Length = 1171

 Score =  400 bits (1028), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 322/1064 (30%), Positives = 509/1064 (47%), Gaps = 142/1064 (13%)

Query: 112  SSAVERKVFPSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLN 171
            SS+ +  V P E R R ++Y   + + ++++         +V + G +P+ML+SN+C LN
Sbjct: 131  SSSKDYIVPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHRDV-EIGRMPIMLRSNKCILN 189

Query: 172  KLSPYELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFG 231
              S  ++ +  E   + GGYFI+NG EK+I   +VQ +     II  +  +   A  Q  
Sbjct: 190  GASEKDMARINECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEA--DEKKAIVQAS 244

Query: 232  IQLRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGII 291
            +   S   ++ S+T V+    +G++  + +    E  VP+V++LKA    SD EI   + 
Sbjct: 245  VT--SSTHERKSKTYVI--TKNGKIYLKHNSIAEE--VPIVLVLKASGIVSDLEIMQLVC 298

Query: 292  GSD--LHDSFLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQ 349
            G+D    D F  +  E+     K +  T Q   Q L+++G K + V +     +  + G 
Sbjct: 299  GNDSSYQDIFAVNFEEVA----KMKIYTQQ---QALEYIGSKVKTVRRQK--LTTLQEGI 349

Query: 350  EVLDRIVLVHLG--KGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLY 407
            E +   V+ HL     +  +K   +  M R++   +      D+ D   ++ + L G L 
Sbjct: 350  EAIATTVIAHLTVEALDFREKALYIAVMTRRVVMAIHNPKMVDDRDYVGNKRLELAGQLM 409

Query: 408  GMIIKE---KIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVN---ENIGSKLQY 461
             ++ ++   K +   +  I ++    NR +  +          L+ +N    NI S L  
Sbjct: 410  SLLFEDLFKKFNNDFKANIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNR 460

Query: 462  FLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLL 519
             +STGN  S     +++ +G T V  ++++   IS   M+ R S  F    K +  R L 
Sbjct: 461  AISTGNW-SLKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQ 515

Query: 520  PESWGFLCPVHTPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGP 579
            P  +G LC   TP+G  CGL+ + A    I+T   +   I  L Y LGV     T+    
Sbjct: 516  PSQFGMLCTSDTPEGEACGLVKNLALMTHITTDDEE-EPIKKLCYLLGVEDI--TVVDSD 572

Query: 580  S---QCCVQIDGKIIGWVSHEQGKIIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYP 636
            S     CV ++G I+G V            R  +  GK+          ++   T     
Sbjct: 573  SLHFNYCVYLNGTIVGVVRFPTK--FVSQFRNLRRSGKVSE--------FISIYTNSHQK 622

Query: 637  GLYIFGGHSRMMRPVRY--------------------LPLDKEDIVGPFEQVYMN----- 671
             ++I     R+ RP+                      L  D    +G  E + +N     
Sbjct: 623  AVHIATDGGRICRPLIIVTDGKSLVTAQHLRQLLDGQLQFDDFLKLGLVEYLDVNEENDS 682

Query: 672  -VAVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVA 730
             +A+  +++E ++ TH+E  P  +L  +A L P+   NQSPRN YQC MGKQ +G     
Sbjct: 683  FIALYERDLEPSI-THMEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYN 741

Query: 731  LCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKS 790
               R D  LY +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NK+
Sbjct: 742  QFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKIPAGQNATVAVMSYSGYDIEDALVLNKA 801

Query: 791  ADERGFGYGTMYKVEKVDLSLNR---------------SRGDPITQHFGFGNDEWPKEWL 835
            + +RGFG     +  K+   L R                 G+PI QH   G         
Sbjct: 802  SIDRGFGRCETRR--KLTTVLKRYPNHTQDMVGGMRVDENGEPIWQHKALG--------- 850

Query: 836  DKLDDDGLPYIGTYVEEGD-------PICAYFDDTLNKTKIK------TYHSSEPAYIEE 882
                 DGL  +G  VE G        P  A  D  L +T+ +       Y + EP++I++
Sbjct: 851  ----PDGLGEVGMKVESGQIYVNKSVPTNAS-DSVLTQTQAQYRETPVVYRAPEPSHIDQ 905

Query: 883  VNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQ 942
            V +   E+++      + +  R  R P++GDKFSSRHGQKGVC       D+PF++ G+ 
Sbjct: 906  VMMSVSENDQ----ALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVNQEDLPFNDQGVV 961

Query: 943  PDVIINPHAFPSRMTIGMFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAG 1002
            PD+I+NPH FPSRMT+G  +E ++GK+G L+G  +  T +      +  +     L+  G
Sbjct: 962  PDIIMNPHGFPSRMTVGKMIELISGKAGVLNGTLEYGTCF----GGSKLEDMSQILMNNG 1017

Query: 1003 YNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRK 1062
            +NY G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR 
Sbjct: 1018 FNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRS 1077

Query: 1063 RHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTSVCRECG 1106
            R GG+R+GEMERD +I +G S LL +RL+  SD  +  VC +CG
Sbjct: 1078 RDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCG 1121

>Scas_605.14
          Length = 1150

 Score =  394 bits (1011), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 317/1062 (29%), Positives = 497/1062 (46%), Gaps = 137/1062 (12%)

Query: 112  SSAVERKVFPSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLN 171
            SSA +    P E R R ++Y   + + ++++         +V + G +P+ML+SN+C L 
Sbjct: 108  SSAKDYLTPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDV-ELGRMPIMLRSNKCTLY 166

Query: 172  KLSPYELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFG 231
             +   E+ +  E   + GGYFI+NG EK+I   +VQ +     II  +   +G       
Sbjct: 167  GIDEKEMAKLNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKGIVQAS-- 221

Query: 232  IQLRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGII 291
              + S   ++ S+T V+    + ++  + +    E  +P+V++LKA    SD EI   + 
Sbjct: 222  --VTSSTHERRSKTYVI--TKNDKIYLKHNSITEE--IPIVIVLKACGVVSDLEIMQLVC 275

Query: 292  GSD--LHDSFLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQ 349
            G+D    D F  + LE   R        +  + Q L+F+G K + + +     S  + G 
Sbjct: 276  GNDSSYQDIFAVN-LEEASR------LNIYTQQQALEFIGTKVKTMRRQKL--SVLQEGI 326

Query: 350  EVLDRIVLVHLG--KGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLY 407
            E +   V+ HL     +  +K   +  M R++   +      D+ D   ++ + L G L 
Sbjct: 327  EAIATTVVAHLTVEALDFREKALYMAMMTRRVVMAIQNPKMVDDRDYVGNKRLELAGQLI 386

Query: 408  GMIIKE---KIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVN---ENIGSKLQY 461
             ++ ++   K +   +  I ++    NR +  +          L+ +N    NI S L  
Sbjct: 387  SLLFEDLFKKFNSDFKATIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNR 437

Query: 462  FLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLL 519
             +STGN  S     +++ +G T V  ++++   IS   M+ R S  F    K +  R L 
Sbjct: 438  AISTGNW-SLKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQ 492

Query: 520  PESWGFLCPVHTPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGP 579
            P  +G LC   TP+G  CGL+ + A    I+T   +   I  L Y LGV   S   +A  
Sbjct: 493  PSQFGMLCTADTPEGEACGLVKNLALMTHITTDDEE-EPIKRLCYILGVEDVSLIDSASL 551

Query: 580  S-QCCVQIDGKIIGWVSHEQGKIIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGL 638
                 V ++G +IG              R  +  GKI          ++          +
Sbjct: 552  HLNFGVYLNGTLIGTTRFPIK--FVSQFRHLRRTGKISE--------FISIYANSHQKAV 601

Query: 639  YIFGGHSRMMRPVRYLPLDKEDI--------------------VGPFEQVYMN------V 672
            +I     R+ RP+  +   K  +                    +G  E + +N      +
Sbjct: 602  HIATDGGRICRPLIIVTKGKSHVTADHLRRLLNGELVFDDFLKLGLVEYLDVNEENDSFI 661

Query: 673  AVTPQEIENNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALC 732
            A+  ++IE+   TH+E  P  IL  +A L P+   NQSPRN YQC MGKQ +G       
Sbjct: 662  ALYEKDIES-ASTHLEIEPFTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQF 720

Query: 733  HRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSAD 792
             R D  LY +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NK++ 
Sbjct: 721  KRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKASI 780

Query: 793  ERGFGYGTMYKVEKVDLSLNR---------------SRGDPITQHFGFGNDEWPKEWLDK 837
            +RGFG     +  K    L R                 G+PI QH   G D         
Sbjct: 781  DRGFGRCETRR--KTTTVLKRYPNHTQDIIGGMRVDENGEPIWQHKALGAD--------- 829

Query: 838  LDDDGLPYIGTYVEEGD-------PICAYFDDTLNKTKIK------TYHSSEPAYIEEVN 884
                GL  +G  VE G        P     D T    + +       Y + EP++I++V 
Sbjct: 830  ----GLGEVGMKVESGQIYINKSVPTNQSNDMTTQAQQAQYRETPVIYRAPEPSHIDQVM 885

Query: 885  LIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPD 944
            +   ++++      + +  R  R P++GDKFSSRHGQKGVC       DMPF++ GI PD
Sbjct: 886  MSVSDNDQ----ALIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPD 941

Query: 945  VIINPHAFPSRMTIGMFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYN 1004
            +I+NPH FPSRMT+G  +E ++GK+G L+G  +  T +      +  +     LV  G+N
Sbjct: 942  IIMNPHGFPSRMTVGKMIELISGKAGVLNGSLEYGTCF----GGSKLEDMSKILVDQGFN 997

Query: 1005 YHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRH 1064
            Y G + +YSG TGE L+A I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R 
Sbjct: 998  YSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRD 1057

Query: 1065 GGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTSVCRECG 1106
            GG+R+GEMERD +I +G S LL +RL+  SD  +  VC +CG
Sbjct: 1058 GGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCDKCG 1099

>ADL275C [1466] [Homologous to ScYOR207C (RET1) - SH] (219105..222530)
            [3426 bp, 1141 aa]
          Length = 1141

 Score =  389 bits (1000), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 315/1048 (30%), Positives = 496/1048 (47%), Gaps = 128/1048 (12%)

Query: 121  PSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQ 180
            P E R R ++Y   + + ++++         +V + G +P+ML+SN+C LN  S   + +
Sbjct: 110  PHECRLRDMTYSAPIFVDIEYTRGRSIVLHKDV-EIGKMPIMLRSNKCILNGASEEVMAK 168

Query: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD 240
              E   + GGYFI+NG EK+I   +VQ +     II  +  +   A  Q  +   S   +
Sbjct: 169  LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEA--DEKKAIVQASVT--SSTHE 221

Query: 241  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFL 300
            + S+T V+    + ++  + +    E  VP+V++LKA    SD EI   + G   +DS  
Sbjct: 222  RKSKTYVV--TKNDKIYLKHNSIAEE--VPIVIVLKACGIVSDLEIMQLVCG---NDSSY 274

Query: 301  TDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHL 360
             D   +      K    +  + Q L+++G K + + +     +  + G E +   V+ HL
Sbjct: 275  QDIFAINFEEASKM--NIYTQQQALEYIGTKVKTIRRQKL--TVLQEGIEAIATTVIAHL 330

Query: 361  G--KGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEY 418
                 +  +K   +  M R++   +      D+ D   ++ + L G L  ++ ++   ++
Sbjct: 331  TVEALDFREKALYVAMMTRRVIMAIHNPKMVDDRDYVGNKRLELAGQLMSLLFEDLFKKF 390

Query: 419  LQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVN---ENIGSKLQYFLSTGNLVSQSGLD 475
              +    I         +   +R  M   L+ +N    NI S L   +STGN  S     
Sbjct: 391  NNDFKASIDK------VLKKPNRAEMYDALLSINVHSNNITSGLNRAISTGNW-SLKRFK 443

Query: 476  LQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPVHTPD 533
            +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC   TP+
Sbjct: 444  MER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDTPE 499

Query: 534  GSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPS-QCCVQIDGKIIG 592
            G  CGL+ + A    I+T   +   I  L Y LGV   +   +A       V ++G IIG
Sbjct: 500  GEACGLVKNLALMTHITTDDEE-EPIKNLCYLLGVEDITLLDSASIHLNYGVYLNGTIIG 558

Query: 593  WVSHEQGKIIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRPVR 652
                       +  R  +  GK+          ++   T      ++I     R+ RP+ 
Sbjct: 559  TTRFPAR--FVNQFRLLRRTGKVSE--------FISIYTNSHQKAVHIATDGGRICRPLI 608

Query: 653  Y--------------------LPLDKEDIVGPFEQVYMN------VAVTPQEIENNVHTH 686
                                 L  D    +G  E + +N      +A+  ++IE    TH
Sbjct: 609  IVRNGKSMVTAGHLRRLLEGELQFDDFLKLGLVEYLDVNEENDSYIALYEKDIEEGT-TH 667

Query: 687  VEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQ 746
            +E  P  +L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +   Q
Sbjct: 668  LEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQ 727

Query: 747  TPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEK 806
             P+VK+   +    D  P G NA VAV+SY+GYD++DA++INKS+ +RGFG     K  K
Sbjct: 728  QPMVKSKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVINKSSIDRGFGRCETRK--K 785

Query: 807  VDLSLNR---------------SRGDPITQHFGFGNDEWPKEWLDKLDDDGLPYIG---- 847
                L R                 G+PI QH   G              DGL  +G    
Sbjct: 786  TTTILKRYPNHTQDIIGGMRVDENGEPIWQHQSLG-------------PDGLGEVGMKVT 832

Query: 848  ---TYVEEGDPICAYFDDTLNKTKIK------TYHSSEPAYIEEVNLIGDESNKFQELQT 898
                Y+ +  P  A  D  LN+ + +       Y + EP++I++V +   ++++      
Sbjct: 833  SGQIYINKSIPTNAS-DSVLNQVQSQYREAPIIYRAPEPSHIDQVMMSVSDNDQ----AL 887

Query: 899  VSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTI 958
            + +  R  R P++GDKFSSRHGQKGVC       DMPF++ GI PD+I+NPH FPSRMT+
Sbjct: 888  IKVLLRQNRRPELGDKFSSRHGQKGVCGIIVQQEDMPFNDQGICPDIIMNPHGFPSRMTV 947

Query: 959  GMFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGE 1018
            G  +E ++GK+G L+G  +  T +  ++    AD   + LV  G+NY G + +Y G TGE
Sbjct: 948  GKMLELVSGKAGVLNGTLEYGTCFGGSQ---LAD-MSEILVNNGFNYSGKDMLYFGITGE 1003

Query: 1019 ELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALI 1078
             L+A ++ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I
Sbjct: 1004 CLQAYVFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVI 1063

Query: 1079 GHGTSFLLQDRLLNCSDYTQTSVCRECG 1106
             +G S LL +RL+  SD  +  VC +CG
Sbjct: 1064 AYGASQLLLERLMLSSDAFEVDVCNKCG 1091

>YOR207C (RET1) [5000] chr15 complement(730008..733457) RNA polymerase
            III, second-largest subunit (C128) [3450 bp, 1149 aa]
          Length = 1149

 Score =  388 bits (996), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 311/1045 (29%), Positives = 496/1045 (47%), Gaps = 119/1045 (11%)

Query: 121  PSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQ 180
            P E R R ++Y   + + ++++         +V + G +P+ML+SN+C L      ++ +
Sbjct: 115  PHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDV-EIGRMPIMLRSNKCILYDADESKMAK 173

Query: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD 240
              E   + GGYFI+NG EK+I   +VQ +     II  +   +G         + S   +
Sbjct: 174  LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKGIVQAS----VTSSTHE 226

Query: 241  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDSFL 300
            + S+T V+    +G++  + +    E  +P+ ++LKA    SD EI   + G   +DS  
Sbjct: 227  RKSKTYVI--TKNGKIYLKHNSIAEE--IPIAIVLKACGILSDLEIMQLVCG---NDSSY 279

Query: 301  TDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLVHL 360
             D   + L    K    +  + Q L+++G K + + +     +  + G E +   V+ HL
Sbjct: 280  QDIFAVNLEESSKL--DIYTQQQALEYIGAKVKTMRRQKL--TILQEGIEAIATTVIAHL 335

Query: 361  G--KGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEY 418
                 +  +K   +  M R++   +      D+ D   ++ + L G L  ++ ++   ++
Sbjct: 336  TVEALDFREKALYIAMMTRRVVMAMYNPKMIDDRDYVGNKRLELAGQLISLLFEDLFKKF 395

Query: 419  LQNI---IQQIRTDSNRGLAINFKDRKYMSRVLMRVN---ENIGSKLQYFLSTGNLVSQS 472
              +    I ++    NR +  +          L+ +N    NI S L   +STGN  S  
Sbjct: 396  NNDFKLSIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW-SLK 445

Query: 473  GLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCPVH 530
               +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC   
Sbjct: 446  RFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTAD 501

Query: 531  TPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPS-QCCVQIDGK 589
            TP+G  CGL+ + A    I+T   +   I  L Y LGV   +   +A       V ++G 
Sbjct: 502  TPEGEACGLVKNLALMTHITTDDEE-EPIKKLCYVLGVEDITLIDSASLHLNYGVYLNGT 560

Query: 590  IIGWVSHEQGKIIADTLRFWKVEGKIPGL------PLDLEIGYVPPSTRGQYPGLYIFGG 643
            +IG +            R  +  GK+            + +       R   P + +  G
Sbjct: 561  LIGSIRFPTK--FVTQFRHLRRTGKVSEFISIYSNSHQMAVHIATDGGRICRPLIIVSDG 618

Query: 644  HSRM----MRPVRYLPLDKEDIV--GPFEQVYMN------VAVTPQEIENNVHTHVEFTP 691
             SR+    +R +    LD +D +  G  E + +N      +A+  ++I  ++ TH+E  P
Sbjct: 619  QSRVKDIHLRKLLDGELDFDDFLKLGLVEYLDVNEENDSYIALYEKDIVPSM-THLEIEP 677

Query: 692  TNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVK 751
              IL  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +   Q P+VK
Sbjct: 678  FTILGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMTYPQQPMVK 737

Query: 752  ANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSL 811
                +    D  P G NA VAV+SY+GYD++DA+++NKS+ +RGFG     +  K    L
Sbjct: 738  TKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRR--KTTTVL 795

Query: 812  NR---------------SRGDPITQHFGFGNDEWPKEWLDKLDDDGLPYIGTYVEEGD-- 854
             R                 GDPI QH   G              DGL  +G  V+ G   
Sbjct: 796  KRYANHTQDIIGGMRVDENGDPIWQHQSLG-------------PDGLGEVGMKVQSGQIY 842

Query: 855  -----PICAYFDDTLNKTKIKT--------YHSSEPAYIEEVNLIGDESNKFQELQTVSI 901
                 P  +      N   ++T        Y   EP++I++V +   ++++      + +
Sbjct: 843  INKSVPTNSADAPNPNNVNVQTQYREAPVIYRGPEPSHIDQVMMSVSDNDQ----ALIKV 898

Query: 902  KYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMF 961
              R  R P++GDKFSSRHGQKGVC       DMPF++ GI PD+I+NPH FPSRMT+G  
Sbjct: 899  LLRQNRRPELGDKFSSRHGQKGVCGIIVKQEDMPFNDQGIVPDIIMNPHGFPSRMTVGKM 958

Query: 962  VESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEELR 1021
            +E ++GK+G L+G  +  T +      +  +     LV  G+NY G + +YSG TGE L+
Sbjct: 959  IELISGKAGVLNGTLEYGTCF----GGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQ 1014

Query: 1022 ADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHG 1081
            A I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G
Sbjct: 1015 AYIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYG 1074

Query: 1082 TSFLLQDRLLNCSDYTQTSVCRECG 1106
             S LL +RL+  SD  +  VC +CG
Sbjct: 1075 ASQLLLERLMISSDAFEVDVCDKCG 1099

>CAGL0L02849g 332195..335596 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, hypothetical start
          Length = 1133

 Score =  385 bits (989), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 309/1041 (29%), Positives = 496/1041 (47%), Gaps = 111/1041 (10%)

Query: 119  VFPSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYEL 178
            V P E R R ++Y   + + ++++          V + G +P+ML+SN+C L+      +
Sbjct: 101  VPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKNV-EIGRMPIMLRSNKCILHGADEKMM 159

Query: 179  VQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVR 238
             +  E   + GGYFI+NG EK+I   +VQ +     II  +   +          + S  
Sbjct: 160  ARLSECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKDIVQAS----VTSST 212

Query: 239  PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLHDS 298
             ++ S+T V+    +G++  + +    E  VP+V++LKA    SD EI   + G   +DS
Sbjct: 213  HERKSKTYVV--TKNGKIYLKHNSIAEE--VPIVIVLKAAGIISDLEIMQLVCG---NDS 265

Query: 299  FLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRIVLV 358
               D   + L    K    +  + Q L+++G K + + +     +  + G E +   ++ 
Sbjct: 266  SYQDIFSVNLEEAAKL--NICTQQQALEYIGAKVKTMRRQKL--TILQEGIEAIATTIIA 321

Query: 359  HLG--KGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKEKID 416
            HL     +  +K   +  M R++   +      D+ D   ++ + L G L  ++ ++   
Sbjct: 322  HLTVEALDFREKALYIATMTRRVVMAMHNPKMVDDRDYVGNKRLELAGQLISLLFEDLFK 381

Query: 417  EYLQNI---IQQIRTDSNRGLAINFKDRKYMSRVLMRVN---ENIGSKLQYFLSTGNLVS 470
            ++  +    I ++    NR +  +          L+ +N    NI S L   +STGN  S
Sbjct: 382  KFNNDFKLSIDKVLKKPNRAMEYD---------ALLSINVHSNNITSGLNRAISTGNW-S 431

Query: 471  QSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCP 528
                 +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC 
Sbjct: 432  LKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCT 487

Query: 529  VHTPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPS-QCCVQID 587
              TP+G  CGL+ + A    I+T   +   I  L Y LGV P S   +A       V ++
Sbjct: 488  ADTPEGEACGLVKNLALMTHITTDDEE-EPIRKLCYVLGVEPISLLDSASLHLNYGVYLN 546

Query: 588  GKIIGWVSHEQGKIIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRM 647
            G +IG              RF +  GK+          ++   T   +  ++I     R+
Sbjct: 547  GTLIGTTKFPSN--FVSRFRFLRRTGKVSE--------FISIYTNDHHNAVHIATDGGRI 596

Query: 648  MRPVRYLPLDKEDI--------------------VGPFEQVYMN------VAVTPQEIEN 681
             RP+  +   K  +                    +G  E + +N      +A+  ++I +
Sbjct: 597  CRPLIIVKDGKSMVEAEHLKRLLSGELVFDDFLKLGLVEYLDVNEENDSYIALYEKDITH 656

Query: 682  NVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYR 741
            ++ TH+E  P  +L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY 
Sbjct: 657  DI-THLEIEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYL 715

Query: 742  LQSGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTM 801
            +   Q P+VK    +    D  P G NA VAV+SY+GYD++DA+++NKS+ +RGFG    
Sbjct: 716  MIYPQQPMVKTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCET 775

Query: 802  YKVEKVDLSLNRSRGDPITQHFGFGNDE-----WPKEWLDKLDDDGLPYIG-------TY 849
             +  K    L +          G   DE     W  E    L  DGL  +G        Y
Sbjct: 776  RR--KTTTVLKKYPNHTKDALCGMRVDENGEAIWQHE---SLGPDGLGEVGLKIRSGQIY 830

Query: 850  VEEGDPICAYFDDTLNKTKIK----TYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRI 905
            + +  P+ +     +N+ + +     Y + E + I++V +    S+  Q+L  + +  R 
Sbjct: 831  INKSVPVQSSDAMAVNQAQYRETPVIYRAPELSIIDQVMM--STSDNDQDL--IKVLLRQ 886

Query: 906  RRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESL 965
             R P++GDKFSSRHGQKGVC       DMPF++ GI PD+I+NPH FPSRMT+G  +E +
Sbjct: 887  NRRPELGDKFSSRHGQKGVCGIIVQQEDMPFNDQGICPDIIMNPHGFPSRMTVGKMIELI 946

Query: 966  AGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEELRADIY 1025
            +GK+G L+G  +  T +      +  +     LV  G+NY G + +YSG TGE L+A I+
Sbjct: 947  SGKAGVLNGSLEYGTCF----GGSKLEDMSKILVDQGFNYSGKDMLYSGITGECLQAYIF 1002

Query: 1026 IGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFL 1085
             G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G S L
Sbjct: 1003 FGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQL 1062

Query: 1086 LQDRLLNCSDYTQTSVCRECG 1106
            L +RL+  SD  +  VC  CG
Sbjct: 1063 LLERLMISSDAFEVDVCSNCG 1083

>Kwal_47.18783
          Length = 1220

 Score =  385 bits (990), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 337/1168 (28%), Positives = 517/1168 (44%), Gaps = 165/1168 (14%)

Query: 80   AVQTGKDSYLGNKLSISVEQVSIAKP--TSNDGVSSAVERKVFPSESRQRLVSYKGKLML 137
            A  T +   +  K  IS  ++ +AKP  T +DGVS A+    +P E+R R ++Y   L +
Sbjct: 71   AQHTTETDNISRKYEISFGKIYLAKPSMTESDGVSHAM----YPQEARLRNLTYASGLFV 126

Query: 138  K---------------LKWSVNDGEETFTEVRDC--GGLPVMLQSNRCHLNKLSPYELVQ 180
            +               LK+ V D E   ++      G +P+ML+S  C L++L+  +L +
Sbjct: 127  EIRKRTYEAVDIPGRDLKYEVIDEESEMSDENKIFIGRVPIMLRSKYCLLDELTESDLYK 186

Query: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSV--- 237
             KE   ++GGYFIING EK+   LI Q R+     I   F     +      ++RS    
Sbjct: 187  LKECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEK 241

Query: 238  --RPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDL 295
              R   T Q  +     +   T + +    +  +P+V+I +AL    D EI + I   D+
Sbjct: 242  GSRFISTLQVKLYGREGNTNRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDV 300

Query: 296  HDSFLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRI 355
            +D  +   LELL    ++ +  +Q+R   L F+G +   +      +  Y   +++L + 
Sbjct: 301  NDWQM---LELLKPCVEEGF-VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKE 354

Query: 356  VLVHLGK--GNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKE 413
             L H+ +  G    K   L +MI +L          D+ D    + + L G L   + K 
Sbjct: 355  FLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKT 414

Query: 414  KIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSG 473
               +  ++I++ ++         N K        L      I + L+Y L+TGN   Q  
Sbjct: 415  LFRKLTRDILRFMQRSVEEAKDFNLK--------LAVKATTITAGLKYALATGNWGEQKK 466

Query: 474  LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPD 533
              +   +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+
Sbjct: 467  A-MTSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPE 524

Query: 534  GSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIA-AGPSQCCVQIDGKIIG 592
            G  CGL+ + +    IS   +D   I   L + G+ P    +    P    V ++G   G
Sbjct: 525  GQACGLVKNLSLMSCISVG-TDPLPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHG 583

Query: 593  WVSHEQGKIIADTLRFWKVEGKI-PGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRP- 650
               H     + DT+R  + +G + P + +  +I         +   L IF    R+ RP 
Sbjct: 584  I--HRNPAKLVDTIRKLRRKGDVTPEVSIVRDI---------REKELKIFTDAGRVYRPL 632

Query: 651  ----------VRYLPLDK-----------EDIVGPFEQVYMN------------------ 671
                      V+ L L K           +DI G FE+  +N                  
Sbjct: 633  FIVDENESTGVKELKLRKGHVRKLMMTEYQDIEGGFEEEDINYTWTSLLNEGLVEYIDAE 692

Query: 672  ------VAVTPQEIE-----------------------NNVHTHVEFTPTNILSILANLT 702
                  +A+  ++++                       +N  TH E  P+ IL + A++ 
Sbjct: 693  EEETILIAMQHEDLDPSFEADDPEGELDPAKRIKAIHHSNTFTHCEIHPSMILGVAASII 752

Query: 703  PFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDN 762
            PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +      
Sbjct: 753  PFPDHNQSPRNTYQSAMGKQAMGVFLTNYSVRMDTMANILYYPQKPLGTTRSMEYLKFRE 812

Query: 763  FPNGTNAVVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVDLSLNRSRGD 817
             P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG     F    M + +++ +S+  S   
Sbjct: 813  LPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRIGMSITESFEK 872

Query: 818  PI-TQHFGFGNDEWPKEWLDKLDDDGLPYIGTYVEEGD-------PICAYFDDTLNKTKI 869
            P  T      +  +     DKLDDDGL   G  V   D       PI    ++   +T  
Sbjct: 873  PQRTNTLRMKHGTY-----DKLDDDGLIAPGVRVSGDDMIIGKTTPIPPDAEELGQRTAF 927

Query: 870  KTYHSSEPAYIEEVNLIGDE---SNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCS 926
             +   +        N I D+   +   + L+ V ++ R  + PQIGDKF+SRHGQKG   
Sbjct: 928  HSKRDASTPLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKVPQIGDKFASRHGQKGTIG 987

Query: 927  RKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKSGALHGVAQDATPWIFNE 986
              +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  AL G   DA+P+    
Sbjct: 988  ITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT--- 1044

Query: 987  DDTPADYFGDQLVKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRS 1046
             D   D     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+
Sbjct: 1045 -DITVDGISRLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARA 1103

Query: 1047 TGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTSVCRECG 1106
             GPV  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+  SD  +  +C  CG
Sbjct: 1104 RGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGVCG 1163

Query: 1107 SILTTQQSVPRIGSLSTVCCRRCAVRFD 1134
             ++T    +      +   CR C  + D
Sbjct: 1164 -LMTVVAKLKH----NQFECRGCKNKID 1186

>KLLA0F01078g 98331..101759 highly similar to sp|P22276 Saccharomyces
            cerevisiae YOR207c RPC128 DNA-directed RNA polymerase
            III, 130 KD subunit, hypothetical start
          Length = 1142

 Score =  381 bits (979), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 311/1044 (29%), Positives = 501/1044 (47%), Gaps = 120/1044 (11%)

Query: 121  PSESRQRLVSYKGKLMLKLKWSVNDGEETFTEVRDCGGLPVMLQSNRCHLNKLSPYELVQ 180
            P E R R ++Y   + + ++++         +V + G +P+ML+SN+C L+  +  ++ +
Sbjct: 111  PHECRLRDMTYSTPIFVDIEYTRGRSIVLHRDV-EIGRMPIMLRSNKCILDGAAENDMAK 169

Query: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD 240
              E   + GGYFI+NG EK+I   +VQ +     II  +   +          + S   +
Sbjct: 170  LNECPLDPGGYFIVNGTEKVI---LVQEQLSKNRIIVEADEKKNIVQAS----VTSSTHE 222

Query: 241  QTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSD--LHDS 298
            + S+T V+    + ++  + +    E  VP+V++LKA    SD EI   + G+D    D 
Sbjct: 223  RKSKTYVV--TKNDKIYLKHNSIAEE--VPIVVVLKACGVVSDLEIMQLVCGNDSSYQDI 278

Query: 299  F---LTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRI 355
            F   L +  EL           +  + Q L+F+G K + V +     S  + G E +   
Sbjct: 279  FAVNLEEAAEL----------KIYTQQQALEFIGTKVKTVRRQKL--SILQEGIEAIATT 326

Query: 356  VLVHLG--KGNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKE 413
            V+ HL     +  +K   +  M R++   +      D+ D   ++ + L G L  ++ ++
Sbjct: 327  VIAHLTVEALDFREKALYIAMMTRRVVMAIDNPKMVDDRDYVGNKRLELAGQLMSLLFED 386

Query: 414  KIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVN---ENIGSKLQYFLSTGNLVS 470
               ++  +        +N    +   +R  M   L+ +N    NI + +   +STGN  S
Sbjct: 387  LFKKFNNDF------KANIDKVLKKPNRAEMYDALLTINVHSNNITTGMNRAISTGNW-S 439

Query: 471  QSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGS--FFAQLKTTTVRKLLPESWGFLCP 528
                 +++ +G T V  ++++   IS   M+ R S  F    K +  R L P  +G LC 
Sbjct: 440  LKRFKMER-AGVTHVLSRLSY---ISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCT 495

Query: 529  VHTPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIAAGPS-QCCVQID 587
              TP+G  CGL+ + A    I+T   +   I  + Y LGV   S   +A       V ++
Sbjct: 496  SDTPEGEACGLVKNLALMTHITTDDEE-EPIKRICYLLGVEDISLIDSASIHLNYGVYLN 554

Query: 588  GKIIGWVSHEQGKIIAD--TLRFWKVEGKIPGLPLDLEIGYVPPSTRGQY---PGLYIFG 642
            G IIG  +    K ++    LR      +   +  +     V  +T G     P + +  
Sbjct: 555  GTIIG-TTRFPTKFVSQFRCLRRTGRASEFISIYTNTHQKAVHIATDGGRICRPLIIVSN 613

Query: 643  GHSRM----MRPVRYLPLDKEDIV--GPFEQVYMN------VAVTPQEIENNVHTHVEFT 690
            G S +    +R +    L  +D +  G  E + +N      +A+  +++  N+ TH+E  
Sbjct: 614  GQSSVTADHLRSLLAGKLQFDDFLKLGLVEYLDVNEENDSFIALYEKDLSENI-THLEIE 672

Query: 691  PTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIV 750
               +L  +A L P+   NQSPRN YQC MGKQ +G        R D  LY +   Q P+V
Sbjct: 673  SFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMV 732

Query: 751  KANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDLS 810
            K    +    D  P G NA VAV+SY+GYD++DA+++NK++ +RGFG     +  K    
Sbjct: 733  KTKTIELIDYDKLPAGQNATVAVMSYSGYDIEDALVLNKASIDRGFGRCETRR--KNTTV 790

Query: 811  LNR---------------SRGDPITQHFGFGNDEWPKEWLDKLDDDGLPYIGTYVEEGD- 854
            L R                 G+PI QH   G              DGL  +G  VE G  
Sbjct: 791  LKRYPNHTQDIIGGMRVDENGEPIWQHQALG-------------PDGLGEVGMKVESGQI 837

Query: 855  ------PICAYFDDTLNKTKIK------TYHSSEPAYIEEVNLIGDESNKFQELQTVSIK 902
                  P  A  D  L +T+ +       Y + EP++I++V +   ++++      + + 
Sbjct: 838  YVNKSVPTNAS-DSILTQTQAQYKETPVVYRAPEPSHIDQVMMSVSDNDQ----ALIKVL 892

Query: 903  YRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFV 962
             R  R P++GDKFSSRHGQKGVC       D+PF++ G+ PD+I+NPH FPSRMT+G  +
Sbjct: 893  LRQNRRPELGDKFSSRHGQKGVCGIIVKQEDLPFNDQGVVPDIIMNPHGFPSRMTVGKMI 952

Query: 963  ESLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEELRA 1022
            E ++GK+G L+G  +  T +      +  +     LV  G+NY G + +YSG TGE L+A
Sbjct: 953  ELISGKAGVLNGTLEYGTCF----GGSKLEDMSKILVDNGFNYSGKDMLYSGITGECLQA 1008

Query: 1023 DIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGT 1082
             I+ G +YYQ+L+HMV DK   R+ GP   LT QP +GR R GG+R+GEMERD +I +G 
Sbjct: 1009 YIFFGPIYYQKLKHMVLDKMHARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGA 1068

Query: 1083 SFLLQDRLLNCSDYTQTSVCRECG 1106
            S LL +RL+  SD  +  VC +CG
Sbjct: 1069 SQLLLERLMLSSDAFEVDVCEKCG 1092

>YOR151C (RPB2) [4950] chr15 complement(612997..616671) RNA polymerase
            II, second-largest subunit [3675 bp, 1224 aa]
          Length = 1224

 Score =  380 bits (977), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 332/1156 (28%), Positives = 503/1156 (43%), Gaps = 192/1156 (16%)

Query: 80   AVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVFPSESRQRLVSYKGKLMLKL 139
            A  T +   +  K  IS  ++ + KP  N+  S  V   ++P E+R R ++Y   L + +
Sbjct: 75   AQHTTESDNISRKYEISFGKIYVTKPMVNE--SDGVTHALYPQEARLRNLTYSSGLFVDV 132

Query: 140  KWSVNDG----------EETFTEVRD--------CGGLPVMLQSNRCHLNKLSPYELVQH 181
            K    +           E    E  D         G LP+ML+S  C+L++ +  +L + 
Sbjct: 133  KKRTYEAIDVPGRELKYELIAEESEDDSESGKVFIGRLPIMLRSKNCYLSEATESDLYKL 192

Query: 182  KEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSV---- 237
            KE   ++GGYFIING EK+   LI Q R+     I   F     +      ++RS     
Sbjct: 193  KECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKG 247

Query: 238  -RPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDLH 296
             R   T Q  +         T + +    +  +P+V+I +AL    D EI + I   D++
Sbjct: 248  SRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC-YDVN 306

Query: 297  DSFLTDRLELLLR-GFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRI 355
            D  + + L+  +  GF      +Q+R   L F+G +   +      +  Y   +++L + 
Sbjct: 307  DWQMLEMLKPCVEDGF-----VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKE 359

Query: 356  VLVHLGK--GNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIK- 412
             L H+ +  G    K   L +MI +L          D+ D    + + L G L   + K 
Sbjct: 360  FLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKT 419

Query: 413  ------EKIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTG 466
                  + I  Y+Q  +++   D N  LAIN K               I S L+Y L+TG
Sbjct: 420  LFKKLTKDIFRYMQRTVEEAH-DFNMKLAINAK--------------TITSGLKYALATG 464

Query: 467  NLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFL 526
            N   Q    +   +G + V  +  +   +SH R  +        K    R+L    WG +
Sbjct: 465  NWGEQKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLV 522

Query: 527  CPVHTPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIA-AGPSQCCVQ 585
            CP  TP+G  CGL+ + +    IS   +D   I   L + G+ P    +    P    V 
Sbjct: 523  CPAETPEGQACGLVKNLSLMSCISVG-TDPMPIITFLSEWGMEPLEDYVPHQSPDATRVF 581

Query: 586  IDGKIIGWVSHEQGKIIADTLRFWKVEGKI-PGLPLDLEIGYVPPSTRGQYPGLYIFGGH 644
            ++G   G   H     + +TLR  + +G I P + +  +I         +   L IF   
Sbjct: 582  VNGVWHG--VHRNPARLMETLRTLRRKGDINPEVSMIRDI---------REKELKIFTDA 630

Query: 645  SRMMRPV----------------------RYLPLDKEDIVGPFEQV-------------- 668
             R+ RP+                      + +  + +DI G FE V              
Sbjct: 631  GRVYRPLFIVEDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLV 690

Query: 669  -YMN--------VAVTPQEIE-----------------------NNVHTHVEFTPTNILS 696
             Y++        +A+ P+++E                           TH E  P+ IL 
Sbjct: 691  EYIDAEEEESILIAMQPEDLEPAEANEENDLDVDPAKRIRVSHHATTFTHCEIHPSMILG 750

Query: 697  ILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYD 756
            + A++ PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +
Sbjct: 751  VAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAME 810

Query: 757  DYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRSRG 816
                   P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      ++     +   +  G
Sbjct: 811  YLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKKYG 867

Query: 817  DPITQHFGFGNDEWPKEW---------LDKLDDDGLPYIGTYVEEGD-------PICAYF 860
              IT+ F     E P+            DKLDDDGL   G  V   D       PI    
Sbjct: 868  MSITETF-----EKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDE 922

Query: 861  DDTLNKTKIKTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQ 910
            ++   +T    YHS          +E   +++V +  ++      L+ V ++ R  + PQ
Sbjct: 923  EELGQRT---AYHSKRDASTPLRSTENGIVDQVLVTTNQDG----LKFVKVRVRTTKIPQ 975

Query: 911  IGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKSG 970
            IGDKF+SRHGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K  
Sbjct: 976  IGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVA 1035

Query: 971  ALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEELRADIYIGVVY 1030
            AL G   DA+P+     D   +     L + GY   G E MY+G TG++L A I+ G  Y
Sbjct: 1036 ALSGNEGDASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTY 1091

Query: 1031 YQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRL 1090
            YQRLRHMV+DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL
Sbjct: 1092 YQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAASFLKERL 1151

Query: 1091 LNCSDYTQTSVCRECG 1106
            +  SD  +  +C  CG
Sbjct: 1152 MEASDAFRVHICGICG 1167

>AFR404C [3596] [Homologous to ScYOR151C (RPB2) - SH]
            (1162949..1166617) [3669 bp, 1222 aa]
          Length = 1222

 Score =  376 bits (966), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 337/1171 (28%), Positives = 506/1171 (43%), Gaps = 169/1171 (14%)

Query: 80   AVQTGKDSYLGNKLSISVEQVSIAKP--TSNDGVSSAVERKVFPSESRQRLVSYKGKLML 137
            A  T +   +  K  IS  ++ +AKP  T +DGVS A+    +P E+R R ++Y   L +
Sbjct: 71   AQHTTEADNISRKYEISFGKIYLAKPSMTESDGVSHAM----YPQEARLRNLTYASGLFV 126

Query: 138  K---------------LKWSVNDGEETFTEVRDC--GGLPVMLQSNRCHLNKLSPYELVQ 180
            +               LK+ +   E   TE      G +P+ML+S  C L+ LS  +L +
Sbjct: 127  EIKKRTYEAVDIPGRDLKYEIIQEESEDTEEGKIFIGRVPIMLRSKYCLLDDLSESDLYR 186

Query: 181  HKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPD 240
             KE   ++GGYFIING EK+   LI Q R+     I   F     +      ++RS    
Sbjct: 187  LKECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAEIRSALEK 241

Query: 241  QT---SQTNVLHYLNDGQV--TFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSDL 295
             +   S   V  Y  +G    T + +    +  +P+V+I +AL    D EI + I     
Sbjct: 242  GSRFISTLQVKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHIC---- 297

Query: 296  HDSFLTDRLELLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLDRI 355
            +D      LE+L    ++ +  +Q+R   L F+G +   +      +  Y   +++L + 
Sbjct: 298  YDQNDWQMLEMLKPCVEEGF-VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQKE 354

Query: 356  VLVHLGK--GNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMIIKE 413
             L H+ +  G    K   L +MI +L          D+ D    + + L G L   + K 
Sbjct: 355  FLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLAQLFKT 414

Query: 414  KIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSG 473
               +  ++I++ ++         N K        L      I + L+Y L+TGN   Q  
Sbjct: 415  LFRKLTRDILRFMQRSVEEAKDFNLK--------LAVKATTITAGLKYALATGNWGEQKK 466

Query: 474  LDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPD 533
              +   +G + V  +  +   +SH R  +        K    R+L    WG +CP  TP+
Sbjct: 467  A-MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGLVCPAETPE 524

Query: 534  GSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIA-AGPSQCCVQIDGKIIG 592
            G  CGL+ + +    IS   +D   I   L + G+ P    +    P    V ++G   G
Sbjct: 525  GQACGLVKNLSLMSCISVG-TDPVPIITFLNEWGMEPLEDYVPHQSPDATRVFVNGVWHG 583

Query: 593  WVSHEQGKIIADTLRFWKVEGKIPGLPLDLEIGYVPPSTRGQYPGLYIFGGHSRMMRP-- 650
               H     + DT+R  + +G I       E+  V      +   L IF    R+ RP  
Sbjct: 584  I--HRNPARLVDTIRKLRRKGDITA-----EVSIVRDIREKE---LKIFTDAGRVYRPLF 633

Query: 651  --------------------VRYLPLDK-EDIVGPFEQVYMNVAVT-------------- 675
                                +R L L + +DI G FE   +N   T              
Sbjct: 634  VVADTQHADGHKDLKVRKGHIRKLMLTEYQDIEGGFEDEDINYTWTSLLNDGIVEYIDAE 693

Query: 676  ------------------PQEIE----------------NNVHTHVEFTPTNILSILANL 701
                              PQ ++                +N  TH E  P+ IL + A++
Sbjct: 694  EEETILIAMQQEDLDPSVPQTVDPSDELDPARRIKAIHHSNTFTHCEIHPSMILGVAASV 753

Query: 702  TPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMD 761
             PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+      +     
Sbjct: 754  IPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFR 813

Query: 762  NFPNGTNAVVAVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVDLSLNRSRG 816
              P G NA+VA+  Y+GY+ +D+MI+N+S+ + G     F    M + +++ +S+  S  
Sbjct: 814  ELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDSGLFRSLFFRSYMDQEKRIGMSITESFE 873

Query: 817  DPI---TQHFGFGNDEWPKEWLDKLDDDGLPYIGTYVEEGD-------PICAYFDDTLNK 866
             P    T     G  E       KLDDDGL   G  V   D       PI    ++   +
Sbjct: 874  KPHRTNTLRMKHGTYE-------KLDDDGLIAPGVRVSGDDIIIGKTTPIPPDAEELGQR 926

Query: 867  TKIKTYHSSEPAYIEEVNLIGDE---SNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKG 923
            T   +   +        N I D+   +   + L+ V ++ R  + PQIGDKF+SRHGQKG
Sbjct: 927  TAFHSKRDASTPLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKVPQIGDKFASRHGQKG 986

Query: 924  VCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKSGALHGVAQDATPWI 983
                 +   DMPF+  G+ PD+IINPHA PSRMT+   +E L  K  AL G   DA+P+ 
Sbjct: 987  TIGITYRREDMPFTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT 1046

Query: 984  FNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQ 1043
                D   D     L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK  
Sbjct: 1047 ----DITVDGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIH 1102

Query: 1044 VRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTSVCR 1103
             R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++RL+  SD  +  +C 
Sbjct: 1103 ARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICG 1162

Query: 1104 ECGSILTTQQSVPRIGSLSTVCCRRCAVRFD 1134
             CG ++T    +      +   CR C  + D
Sbjct: 1163 ICG-LMTVVAKLKH----NQFECRGCKNKID 1188

>CAGL0L04246g complement(493026..496697) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, hypothetical start
          Length = 1223

 Score =  375 bits (964), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 337/1163 (28%), Positives = 506/1163 (43%), Gaps = 205/1163 (17%)

Query: 80   AVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVFPSESRQRLVSYKGKLMLKL 139
            A  T +   +  K  IS  ++ + KP  N+  S  V   ++P E+R R ++Y   L    
Sbjct: 73   AQHTTEQDNISRKYEISFGKIYVTKPMVNE--SDGVTHALYPQEARLRNLTYSSGLF--- 127

Query: 140  KWSVNDGEETFTEV----RDC--------------------GGLPVMLQSNRCHLNKLSP 175
               V+  + T+  V    RD                     G LP+ML+S  C+L+  + 
Sbjct: 128  ---VDVTKRTYEAVDVPGRDLNYQLIAEESEEDSESGKVFIGRLPIMLRSKNCYLSDATE 184

Query: 176  YELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLR 235
             +L + KE   ++GGYFIING EK+   LI Q R+     I   F     +      ++R
Sbjct: 185  SDLYKLKECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIR 239

Query: 236  SV-----RPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGI 290
            S      R   T Q  +    +    T + +    +  +P+V+I +AL    D EI + I
Sbjct: 240  SALEKGSRFISTLQVKLYGRESSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHI 299

Query: 291  IGSDLHDSFLTDRLELLLR-GFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQ 349
               D++D  + + L+  +  GF      +Q+R   L F+G +   +      +  Y   +
Sbjct: 300  C-YDVNDWQMLEMLKPCVEDGF-----VIQDRETALDFIGRRGTALGIKKEKRIQY--AK 351

Query: 350  EVLDRIVLVHLGK--GNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLY 407
            ++L +  L H+ +  G    K   L +MI +L          D+ D    + + L G L 
Sbjct: 352  DILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLL 411

Query: 408  GMIIK-------EKIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQ 460
              + K       + I  Y+Q  +++   D N  LAIN K               I S L+
Sbjct: 412  AQLFKTLFRKLTKDIFRYMQRTVEEA-NDFNMKLAINAK--------------TITSGLK 456

Query: 461  YFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLP 520
            Y L+TGN   Q    +   +G + V  +  +   +SH R  +        K    R+L  
Sbjct: 457  YALATGNWGEQKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHN 514

Query: 521  ESWGFLCPVHTPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIA-AGP 579
              WG +CP  TP+G  CGL+ + +    IS   +D   I   L + G+ P    +    P
Sbjct: 515  THWGLVCPAETPEGQACGLVKNLSLMSCISVG-ADPMPIITFLSEWGMEPLEDYVPHQSP 573

Query: 580  SQCCVQIDGKIIGWVSHEQGKIIADTLRFWKVEGKI-PGLPLDLEIGYVPPSTRGQYPGL 638
                V ++G   G   H     + +TLR  + +G I P + +  +I       R Q   L
Sbjct: 574  DATRVFVNGVWHG--VHRNPARLMETLRTLRRKGDINPEVSMIRDI-------REQ--EL 622

Query: 639  YIFGGHSRMMRPVRYLPLDKE----------------------DIVGPFEQV-------- 668
             IF    R+ RP+  +  D+E                      DI G FE          
Sbjct: 623  KIFTDAGRVYRPLFIVEDDEELGRKELKVRKGHVAKLMATEYQDIEGGFEDAEDYTWSSL 682

Query: 669  -------YMN--------VAVTPQEIE----------NNV--------------HTHVEF 689
                   Y++        +A+ P+++E           NV               TH E 
Sbjct: 683  LNEGLVEYIDAEEEESILIAMQPEDLEPTAVEQDIPKENVDLAKRIKVTHHATTFTHCEI 742

Query: 690  TPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPI 749
             P+ IL + A++ PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+
Sbjct: 743  HPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNFRMDTMANILYYPQKPL 802

Query: 750  VKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDL 809
                  +       P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      ++     +
Sbjct: 803  GTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---M 859

Query: 810  SLNRSRGDPITQHFGFGNDEWPKEW---------LDKLDDDGLPYIGTYVEEGD------ 854
               +  G  IT+ F     E P+            DKLD+DGL   G  V   D      
Sbjct: 860  DQEKKYGMSITETF-----EKPQRTNTLRMKHGTYDKLDEDGLIAPGVRVSGEDIIIGKT 914

Query: 855  -PICAYFDDTLNKTKIKTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKY 903
             PI    ++   +T    YHS          +E   +++V +  ++      L+ V ++ 
Sbjct: 915  TPIAPDEEELGQRT---AYHSKRDASTPLRSTENGIVDQVLITTNQDG----LKFVKVRV 967

Query: 904  RIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVE 963
            R  + PQIGDKF+SRHGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E
Sbjct: 968  RTTKVPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIE 1027

Query: 964  SLAGKSGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEELRAD 1023
             L  K  AL G   DA+P+     D   +     L + GY   G E MY+G TG++L A 
Sbjct: 1028 CLLSKVAALSGNEGDASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQ 1083

Query: 1024 IYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTS 1083
            I+ G  YYQRLRHMV+DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +
Sbjct: 1084 IFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAA 1143

Query: 1084 FLLQDRLLNCSDYTQTSVCRECG 1106
              L++RL+  SD  +  +C  CG
Sbjct: 1144 AFLKERLMEASDAFRVHICGICG 1166

>Scas_714.41
          Length = 1224

 Score =  375 bits (964), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 331/1158 (28%), Positives = 503/1158 (43%), Gaps = 196/1158 (16%)

Query: 80   AVQTGKDSYLGNKLSISVEQVSIAKPTSNDGVSSAVERKVFPSESRQRLVSYKGKLMLKL 139
            A  T +   +  K  I   ++ + KP  N+  S  V   ++P E+R R ++Y   L + +
Sbjct: 75   AQHTTETDNVSRKYEIGFGKIYVTKPMVNE--SDGVTHALYPQEARLRNLTYSSGLFVDV 132

Query: 140  KWSVND-----GEETFTEVRD-------------CGGLPVMLQSNRCHLNKLSPYELVQH 181
            K    +     G E   E+                G LP+ML+S  C+L+  +  +L + 
Sbjct: 133  KKRTYEAVDVPGRELKYELIAEESEEESESGKVFIGRLPIMLRSKNCYLSDATESDLYKL 192

Query: 182  KEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQLRSVRPDQ 241
            KE   ++GGYFIING EK+   LI Q R+     I   F     +      ++RS     
Sbjct: 193  KECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKAAPSPISHVAEIRSALEKG 247

Query: 242  T---SQTNVLHYLNDGQ----VTFRFSWRKNEYLVPVVMILKALCDTSDREIFDGIIGSD 294
            +   S   V  Y  +G     +     + K +  +P+V+I +AL    D EI + I   D
Sbjct: 248  SRFISTLQVKLYGREGSDARTINATLPYIKQD--IPIVIIFRALGIIPDGEILEHIC-YD 304

Query: 295  LHDSFLTDRLELLLR-GFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEVGQEVLD 353
            ++D  + + L+  +  GF      +Q+R   L F+G +   +      +  Y   +++L 
Sbjct: 305  VNDWQMLEMLKPCVEDGF-----VIQDRETALDFIGRRGTALGIKKEKRIQY--AKDILQ 357

Query: 354  RIVLVHLGK--GNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGFLYGMII 411
            +  L H+ +  G    K   L +MI +L          D+ D    + + L G L   + 
Sbjct: 358  KEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGPLLASLF 417

Query: 412  K-------EKIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLS 464
            K       + I  Y+Q  +++   D N  LAIN K               I S L+Y L+
Sbjct: 418  KTLFRKLTKDIFRYMQRTVEEAH-DFNMKLAINAK--------------TITSGLKYALA 462

Query: 465  TGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWG 524
            TGN   Q    +   +G + V  +  +   +SH R  +        K    R+L    WG
Sbjct: 463  TGNWGEQKKA-MSSRAGVSQVLNRYTYSSTLSHLRRTNT-PIGRDGKLAKPRQLHNTHWG 520

Query: 525  FLCPVHTPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIA-AGPSQCC 583
             +CP  TP+G  CGL+ + +    IS   +D   I   L + G+ P    +    P    
Sbjct: 521  LVCPAETPEGQACGLVKNLSLMSCISVG-TDPMPIITFLSEWGMEPLEDYVPHQSPDATR 579

Query: 584  VQIDGKIIGWVSHEQGKIIADTLRFWKVEGKI-PGLPLDLEIGYVPPSTRGQYPGLYIFG 642
            V ++G   G   H     + DTLR  + +G I P + +  +I         +   L IF 
Sbjct: 580  VFVNGVWHG--VHRNPARLMDTLRTLRRKGDINPEVSMIRDI---------REKELKIFT 628

Query: 643  GHSRMMRPV----------------------RYLPLDKEDIVGPFEQV------------ 668
               R+ RP+                      + +  + +DI G FE              
Sbjct: 629  DAGRVYRPLFIVEDDETLGHKELKVRKGHIAKLMATEYQDIEGGFEDAEEYTWTSLLNEG 688

Query: 669  ---YMN--------VAVTPQEIE-----------------------NNVHTHVEFTPTNI 694
               Y++        +++ P+++E                           TH E  P+ I
Sbjct: 689  LVEYIDAEEEETILISMQPEDLEPPMENEEVIDDMDPAKRIRATQHATTFTHCEIHPSMI 748

Query: 695  LSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANL 754
            L + A++ PF D NQSPRN YQ  MGKQ MG        R D     L   Q P+     
Sbjct: 749  LGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRS 808

Query: 755  YDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNRS 814
             +       P G NA+VA+  Y+GY+ +D+MI+N+S+ +RG      ++     +   + 
Sbjct: 809  MEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSY---MDQEKK 865

Query: 815  RGDPITQHFGFGNDEWPKEW---------LDKLDDDGLPYIGTYVEEGD-------PICA 858
             G  IT+ F     E P+            DKLDDDGL   G  V   D       PI  
Sbjct: 866  YGMSITETF-----EKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDIIIGKTTPISP 920

Query: 859  YFDDTLNKTKIKTYHS----------SEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRT 908
              ++   +T    YHS          +E   +++V +  ++      L+ V ++ R  + 
Sbjct: 921  DEEELGQRT---AYHSKRDASTPLRSTENGIVDQVLITTNQDG----LKFVKVRVRTTKV 973

Query: 909  PQIGDKFSSRHGQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGK 968
            PQIGDKF+SRHGQKG     +   DMPF+  GI PD+IINPHA PSRMT+   +E L  K
Sbjct: 974  PQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSK 1033

Query: 969  SGALHGVAQDATPWIFNEDDTPADYFGDQLVKAGYNYHGNEPMYSGATGEELRADIYIGV 1028
              AL G   DA+P+     D   +     L + GY   G E MY+G TG++L A I+ G 
Sbjct: 1034 VAALSGNEGDASPFT----DITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGP 1089

Query: 1029 VYYQRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQD 1088
             YYQRLRHMV+DK   R+ GP+  LT QPV+GR R GG+R GEMERD +I HG +  L++
Sbjct: 1090 TYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKE 1149

Query: 1089 RLLNCSDYTQTSVCRECG 1106
            RL+  SD  +  +C  CG
Sbjct: 1150 RLMEASDAFRVHICGNCG 1167

>KLLA0B05577g complement(501690..505355) highly similar to sp|P08518
            Saccharomyces cerevisiae YOR151c RPB2 DNA-directed RNA
            polymerase II, 140 kDa chain, start by similarity
          Length = 1221

 Score =  298 bits (763), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 186/499 (37%), Positives = 257/499 (51%), Gaps = 40/499 (8%)

Query: 654  LPL-DKEDIVGPFEQVYMNVAVTPQEIEN-NVHTHVEFTPTNILSILANLTPFSDFNQSP 711
            LP+ D ED + P  ++        + I N N+ TH E  P+ IL + A++ PF D NQSP
Sbjct: 711  LPVADSEDDLDPARRI--------RAIHNSNIFTHCEIHPSMILGVAASVIPFPDHNQSP 762

Query: 712  RNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSGQTPIVKANLYDDYGMDNFPNGTNAVV 771
            RN YQ  MGKQ MG        R D     L   Q P+      +       P G NA+V
Sbjct: 763  RNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQKPLGTTRAMEYLKFRELPAGQNAIV 822

Query: 772  AVISYTGYDMDDAMIINKSADERG-----FGYGTMYKVEKVDLSLNRSRGDP-ITQHFGF 825
            A+  Y+GY+ +D+MI+N+S+ +RG     F    M + +++ +S+  S   P  T     
Sbjct: 823  AIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRIGMSITESFEKPHRTNTLRM 882

Query: 826  GNDEWPKEWLDKLDDDGLPYIGTYVEEGD-------PICAYFDDTLNKTKIKTYHSSEPA 878
             +  +     DKLDDDGL   G  V   D       PI    ++   +T   +   +   
Sbjct: 883  KHGTY-----DKLDDDGLIAPGVRVSGDDMIIGKTTPIPPDAEELGQRTAFHSKRDASTP 937

Query: 879  YIEEVNLIGDE---SNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTVDMP 935
                 N I D+   +   + L+ V ++ R  + PQIGDKF+SRHGQKG     + T DMP
Sbjct: 938  LRSTENGIVDQVLITTNQEGLKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRTEDMP 997

Query: 936  FSETGIQPDVIINPHAFPSRMTIGMFVESLAGKSGALHGVAQDATPWIFNEDDTPADYFG 995
            F+  G+ PD+IINPHA PSRMT+   +E L  K  AL G   DA+P+     D   D   
Sbjct: 998  FTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFT----DITVDGIS 1053

Query: 996  DQLVKAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLRHMVNDKFQVRSTGPVNSLTM 1055
              L + GY   G E MY+G TG++L A I+ G  YYQRLRHMV+DK   R+ GP+  LT 
Sbjct: 1054 RLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTR 1113

Query: 1056 QPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNCSDYTQTSVCRECGSILTTQQSV 1115
            QPV+GR R GG+R GEMERD +I HG +  L++RL+  SD  +  +C  CG +     SV
Sbjct: 1114 QPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGICGLM-----SV 1168

Query: 1116 PRIGSLSTVCCRRCAVRFD 1134
                  +   CR C  + D
Sbjct: 1169 VAKLKHNQFECRSCKNKID 1187

 Score =  109 bits (272), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 140/571 (24%), Positives = 238/571 (41%), Gaps = 71/571 (12%)

Query: 80  AVQTGKDSYLGNKLSISVEQVSIAKP--TSNDGVSSAVERKVFPSESRQRLVSYKGKLML 137
           A  T +   +  K  IS  ++ +AKP  T +DGVS A+    +P E+R R ++Y   L +
Sbjct: 69  AQHTTETDNISRKYEISFGKIYLAKPSMTESDGVSHAM----YPQEARLRNLTYASGLFV 124

Query: 138 KLKWSVNDGEETFTEV----RD--------------------CGGLPVMLQSNRCHLNKL 173
           +++      + T+  +    RD                     G +P+ML+S  C L+ L
Sbjct: 125 EIQ------KRTYQAIDIPGRDLKYEIITEESEENEENNKIFIGRVPIMLRSKYCLLDDL 178

Query: 174 SPYELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFTNRGAAYTQFGIQ 233
           +  +L + KE   ++GGYFIING EK+   LI Q R+     I   F     +      +
Sbjct: 179 TESDLYRLKECPFDMGGYFIINGSEKV---LIAQERS--AGNIVQVFKKSAPSPISHIAE 233

Query: 234 LRSVRPDQT---SQTNVLHYLNDGQV--TFRFSWRKNEYLVPVVMILKALCDTSDREIFD 288
           +RS     +   S   V  Y  +G    T + +    +  +P+V+I +AL    D EI +
Sbjct: 234 IRSALEKGSRFISTLQVKLYGREGSTSRTIKATLPYIKQDIPIVIIFRALGIIPDGEILE 293

Query: 289 GIIGSDLHDSFLTDRLE-LLLRGFKKRYPTLQNRTQVLQFLGDKFRVVFQASPDKSDYEV 347
            I   D++D  + + L+  +  GF      +Q+R   L F+G +   +      +  Y  
Sbjct: 294 HIC-YDVNDWQMLEMLKPCVEEGF-----VIQDRETALDFIGRRGTALGIKKEKRIQY-- 345

Query: 348 GQEVLDRIVLVHLGK--GNNEDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQEVLLGGF 405
            +++L +  L H+ +  G    K   L +MI +L          D+ D    + + L G 
Sbjct: 346 AKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKKRLDLAGP 405

Query: 406 LYGMIIKEKIDEYLQNIIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLST 465
           L   + K    +  ++I++ ++         N K        L      I + L+Y L+T
Sbjct: 406 LLAQLFKTLFRKLTRDILRFMQRSVEEAKDFNLK--------LAVKATTITAGLKYALAT 457

Query: 466 GNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGF 525
           GN   Q    +   +G + V  +  +   +SH R  +        K    R+L    WG 
Sbjct: 458 GNWGEQKK-SMSSRAGVSQVLNRYTYSSTLSHLRRTN-TPIGRDGKLAKPRQLHNTHWGL 515

Query: 526 LCPVHTPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLYQLGVSPASHTIA-AGPSQCCV 584
           +CP  TP+G  CGL+ + +    IS   +D   I   L + G+ P    I    P    V
Sbjct: 516 VCPAETPEGQACGLVKNLSLMSCISV-GTDPLPIITFLNEWGMEPLEDYIPHQSPDATRV 574

Query: 585 QIDGKIIGWVSHEQGKIIADTLRFWKVEGKI 615
            ++G   G   H     + DT+R  + +G I
Sbjct: 575 FVNGVWHGI--HRNPAKLVDTIRKLRRKGDI 603

>YGL084C (GUP1) [1898] chr7 complement(350617..352299) Protein
           involved in active glycerol uptake, protein trafficking
           to the vacuole, maintenance of vacuolar morphology, and
           secretion [1683 bp, 560 aa]
          Length = 560

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 63/141 (44%), Gaps = 23/141 (16%)

Query: 364 NNEDKFRMLLFMIRKLYSLVAG--ECSPDNPDATQHQEVLLGGFLYGMIIKEKIDEYLQN 421
             E KF  + F++       AG    SP+NP+  +++ +L  G+L+G     K+D     
Sbjct: 39  TTEFKFYYIAFLVVVPLMFYAGLQASSPENPNYARYERLLSQGWLFG----RKVDN---- 90

Query: 422 IIQQIRTDSNRGLAINFKDRKYMSRVLMRVNENIGSKLQYFLSTGNLVSQSGLDLQQVSG 481
                 +DS       F+D   +  VLM V+ +I   + Y  ST   +++   DL     
Sbjct: 91  ------SDSQYRF---FRDNFALLSVLMLVHTSIKRIVLY--STN--ITKLRFDLIFGLI 137

Query: 482 YTVVAEKINFYRFISHFRMVH 502
           + V A  +N  R ++H  +++
Sbjct: 138 FLVAAHGVNSIRILAHMLILY 158

>CAGL0J07942g 772758..776492 similar to sp|P38717 Saccharomyces
           cerevisiae YNL257c SIP3 SNF1P or sp|P38851 Saccharomyces
           cerevisiae YHR155w, hypothetical start
          Length = 1244

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 46/106 (43%), Gaps = 10/106 (9%)

Query: 686 HVEFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQSG 745
           ++EF  +    I   +T F D  +S    Y+C   +  + + G         K++  Q+ 
Sbjct: 444 YIEFASSTTTKIDQQITTFDDTTESLFQKYKCAFSEYEVLSVG-------SEKIFNFQTI 496

Query: 746 QTPIVKANLYDDYGMDNFPNG---TNAVVAVISYTGYDMDDAMIIN 788
            TPI        +  DN   G   TNAVVA I  T Y  D ++I++
Sbjct: 497 ITPISTKMTNLAFLADNSVYGSYCTNAVVANIWGTTYWSDYSLILS 542

>CAGL0E00847g <73766..79244 highly similar to sp|P11075
           Saccharomyces cerevisiae YDR170c component of
           non-clathrin vesicle coat, start by similarity
          Length = 1825

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 74/181 (40%), Gaps = 35/181 (19%)

Query: 803 KVEKVDLS-------LNRSRGDPITQHFGFGNDEWPK---EWLDKLDDDGLPYIGTYVEE 852
           K+ K  LS       L   R  P+    GF NDE P+   +WL + D   L  +G Y+ E
Sbjct: 678 KIRKTKLSNCVNAFNLKPKRAIPLLLQNGFINDESPESIAKWLLETDGLDLAMVGDYLGE 737

Query: 853 GDPICAYFDDTLNKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIG 912
           GD           +  I   H    A++++ +  G   +    L+    K+R+    Q  
Sbjct: 738 GD-----------EKNIAVMH----AFVDQFDFTG--QSIVDALRDFLQKFRLPGEGQKI 780

Query: 913 DKFSSRHGQK------GVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLA 966
           D+F  +  ++      GV S+      + +S   +  D  ++     ++MT+  F+E+  
Sbjct: 781 DRFMLKFAERFVDQNPGVFSKADTAYVLSYSLIMLNTD--LHSSQIKNKMTLQEFLENNE 838

Query: 967 G 967
           G
Sbjct: 839 G 839

>Sklu_2213.6 YGR155W, Contig c2213 9246-10733 reverse complement
          Length = 495

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%)

Query: 515 VRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCKISTQQSDVSQIPGLLY 564
           V  +L E+     PV T DG  CGL+       K+ST +S V  I GL Y
Sbjct: 378 VVSILKENGFDQLPVLTEDGKLCGLVTLSQLLKKLSTSKSTVKTIEGLFY 427

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 41,119,337
Number of extensions: 1910532
Number of successful extensions: 4321
Number of sequences better than 10.0: 27
Number of HSP's gapped: 4374
Number of HSP's successfully gapped: 43
Length of query: 1200
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1087
Effective length of database: 12,684,275
Effective search space: 13787806925
Effective search space used: 13787806925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)