Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_707.4633833813710.0
YPR015C247983321e-36
Scas_602.4266683086e-33
CAGL0L05786g348643102e-32
YPR013C317643064e-32
CAGL0J01595g344852988e-31
Scas_602.4d256592632e-26
KLLA0A04609g423582262e-20
Scas_656.1*102552065e-20
AEL077W336612181e-19
ADL040W330562118e-19
Kwal_26.8011190541977e-18
KLLA0F20636g285522002e-17
Scas_710.9505602023e-17
ADR308C278721931e-16
Sklu_2398.2288701904e-16
Kwal_27.10467302701871e-15
AGL207W277641852e-15
Scas_718.36d330661835e-15
Scas_717.18354541792e-14
CAGL0M01870g315611782e-14
ADL051W173551703e-14
Scas_717.17d350611773e-14
KLLA0F11682g374561731e-13
ADL042W281531702e-13
Sklu_2244.3271541682e-13
Kwal_14.2206254541664e-13
ADL050W146541561e-12
AGR186C287751594e-12
KLLA0F22319g203481531e-11
Scas_697.35839541262e-07
CAGL0E01331g689531252e-07
YDR043C (NRG1)231721203e-07
Scas_711.56832551243e-07
Scas_709.32822571234e-07
YOR113W (AZF1)914531234e-07
YJL056C (ZAP1)880551226e-07
CAGL0K12078g463701207e-07
AGL197W844571201e-06
CAGL0M06831g645601181e-06
KLLA0F01463g781581191e-06
ACR264W769531181e-06
Kwal_14.2543711551172e-06
KLLA0A10373g206581132e-06
CAGL0L03916g642531162e-06
CAGL0J05060g713551136e-06
CAGL0M04323g703521137e-06
Kwal_47.17888786531137e-06
YER028C394721101e-05
KLLA0F18524g357651092e-05
KLLA0E18645g431501092e-05
YNL027W (CRZ1)678601092e-05
CAGL0I02816g291551062e-05
Kwal_56.23925745531074e-05
KLLA0F23782g782511074e-05
Scas_718.44266601044e-05
CAGL0L07480g314661045e-05
Scas_713.52620531065e-05
KLLA0D16456g854581057e-05
CAGL0K03003g647501047e-05
Kwal_27.11460531771047e-05
KLLA0F26961g694621048e-05
ABR089C571571048e-05
AEL174W661541031e-04
ADL198W547771031e-04
Sklu_2357.715764981e-04
Kwal_26.8351698571031e-04
YDR146C (SWI5)709541031e-04
CAGL0F05995g597591021e-04
CAGL0C02519g318521011e-04
Scas_695.2571601012e-04
Scas_687.3328852992e-04
AFR471C38952992e-04
KLLA0F07073g558841003e-04
Scas_712.42*29052983e-04
YGL035C (MIG1)50467993e-04
YGL209W (MIG2)38252983e-04
CAGL0M13189g54157993e-04
Scas_649.2873057984e-04
AGL071C39650974e-04
Kwal_23.540042954975e-04
YKL062W (MSN4)63057985e-04
CAGL0A01628g42451975e-04
KLLA0B00605g23953955e-04
Scas_575.345570975e-04
Scas_712.232757966e-04
YLR131C (ACE2)77059967e-04
AGR031W14061917e-04
Sklu_2351.654851967e-04
Kwal_47.1904526652947e-04
Scas_693.3163553967e-04
Scas_717.1752565967e-04
Sklu_2389.276781950.001
Kwal_27.1092526459930.001
YMR070W (MOT3)49066940.001
Kwal_26.802150779940.001
Kwal_14.227846351940.001
YMR037C (MSN2)70456940.001
Sklu_2289.129150910.002
Scas_670.243558920.002
Kwal_27.1016728561910.002
YDR216W (ADR1)132369920.002
Scas_627.6120775910.003
Sklu_2443.2221347880.004
KLLA0E10989g47451900.004
AER159C119147900.005
CAGL0K02145g31752880.006
KLLA0E08679g59660880.007
YLR375W34358860.008
YBR066C (NRG2)22089850.008
Scas_378.120850850.009
Scas_569.229361850.010
CAGL0K09372g39652860.011
CAGL0M00594g102049870.011
Scas_602.954752860.012
KLLA0B04477g133247860.012
KLLA0B03454g47254850.013
YGL254W (FZF1)29963840.015
Scas_683.3047863850.016
YDL048C (STP4)49058840.018
CAGL0H04213g132147840.023
AFR580C83858840.024
Kwal_47.1724140352830.026
Sklu_2206.235858820.029
Kwal_47.16621117847820.036
CAGL0H07557g47657810.041
Sklu_2359.572262810.043
Sklu_2181.141052800.049
Scas_721.92115268810.054
YER130C44352800.060
Scas_703.23134147800.062
CAGL0H04873g45160800.064
YPL230W39164790.068
Kwal_26.930030458780.075
KLLA0E13519g23070770.082
ACL057W52052790.089
Scas_683.2587958790.099
YPR022C113366780.11
CAGL0K04697g51559770.12
YPR186C (PZF1)42982770.14
KLLA0B07909g92268770.15
Kwal_55.2063441979760.17
AEL278W47654760.18
Scas_707.3128955750.21
CAGL0L06072g30053740.23
YML081W125147760.24
Scas_631.743346730.37
KLLA0C17072g47452720.53
CAGL0K02343g116265720.69
YJR127C (ZMS1)138047710.81
KLLA0F13046g137960701.0
CAGL0K04631g101353701.0
KLLA0E00726g51767691.2
Scas_719.68135047691.3
CAGL0E03762g58464681.7
CAGL0E06116g61346682.0
CAGL0G10021g39438672.1
Sklu_2126.5448103672.2
Kwal_47.1657788135662.9
YMR182C (RGM1)21149653.1
AFR588W31958653.7
Sklu_1884.2546101636.1
YHL027W (RIM101)62543628.5
Scas_720.3331657619.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_707.46
         (338 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_707.46                                                           532   0.0  
YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protei...   132   1e-36
Scas_602.4                                                            123   6e-33
CAGL0L05786g complement(636176..637222) some similarities with t...   124   2e-32
YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putati...   122   4e-32
CAGL0J01595g 151584..152618 some similarities with tr|Q12531 Sac...   119   8e-31
Scas_602.4d                                                           105   2e-26
KLLA0A04609g complement(411494..412765) some similarities with s...    92   2e-20
Scas_656.1*                                                            84   5e-20
AEL077W [2429] [Homologous to NOHBY] complement(483028..484038) ...    89   1e-19
ADL040W [1701] [Homologous to ScYPR013C - SH] complement(618855....    86   8e-19
Kwal_26.8011                                                           80   7e-18
KLLA0F20636g complement(1914452..1915309) some similarities with...    82   2e-17
Scas_710.9                                                             82   3e-17
ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,...    79   1e-16
Sklu_2398.2 , Contig c2398 2210-3076 reverse complement                78   4e-16
Kwal_27.10467                                                          77   1e-15
AGL207W [4105] [Homologous to NOHBY] complement(310750..311583) ...    76   2e-15
Scas_718.36d                                                           75   5e-15
Scas_717.18                                                            74   2e-14
CAGL0M01870g complement(219813..220760) some similarities with t...    73   2e-14
ADL051W [1690] [Homologous to NOHBY] complement(595496..596017) ...    70   3e-14
Scas_717.17d                                                           73   3e-14
KLLA0F11682g complement(1068992..1070116) some similarities with...    71   1e-13
ADL042W [1699] [Homologous to ScYPR015C - SH] complement(615818....    70   2e-13
Sklu_2244.3 , Contig c2244 4100-4915 reverse complement                69   2e-13
Kwal_14.2206                                                           69   4e-13
ADL050W [1691] [Homologous to NOHBY] complement(597229..597669) ...    65   1e-12
AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,...    66   4e-12
KLLA0F22319g complement(2086613..2087224) some similarities with...    64   1e-11
Scas_697.35                                                            53   2e-07
CAGL0E01331g 124362..126431 weakly similar to sp|P08153 Saccharo...    53   2e-07
YDR043C (NRG1) [896] chr4 complement(542670..543365) Transcripti...    51   3e-07
Scas_711.56                                                            52   3e-07
Scas_709.32                                                            52   4e-07
YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent t...    52   4e-07
YJL056C (ZAP1) [2855] chr10 complement(330347..332989) Zinc-resp...    52   6e-07
CAGL0K12078g complement(1168989..1170380) weakly similar to sp|Q...    51   7e-07
AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C (...    51   1e-06
CAGL0M06831g 695162..697099 weakly similar to sp|P53968 Saccharo...    50   1e-06
KLLA0F01463g 140343..142688 some similarities with sp|P47043 Sac...    50   1e-06
ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH] complement(...    50   1e-06
Kwal_14.2543                                                           50   2e-06
KLLA0A10373g complement(907244..907864) some similarities with c...    48   2e-06
CAGL0L03916g complement(448955..450883) weakly similar to sp|P41...    49   2e-06
CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces c...    48   6e-06
CAGL0M04323g complement(474158..476269) similar to sp|P21192 Sac...    48   7e-06
Kwal_47.17888                                                          48   7e-06
YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein th...    47   1e-05
KLLA0F18524g complement(1701498..1702571) some similarities with...    47   2e-05
KLLA0E18645g complement(1648263..1649558) some similarities with...    47   2e-05
YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-depende...    47   2e-05
CAGL0I02816g complement(247817..248692) similar to sp|P41696 Sac...    45   2e-05
Kwal_56.23925                                                          46   4e-05
KLLA0F23782g 2219920..2222268 some similarities with sp|P41696 S...    46   4e-05
Scas_718.44                                                            45   4e-05
CAGL0L07480g complement(822240..823184) some similarities with s...    45   5e-05
Scas_713.52                                                            45   5e-05
KLLA0D16456g complement(1387846..1390410) weakly similar to sp|P...    45   7e-05
CAGL0K03003g 276756..278699 weakly similar to sp|P54785 Saccharo...    45   7e-05
Kwal_27.11460                                                          45   7e-05
KLLA0F26961g 2486804..2488888 some similarities with sp|P33748 S...    45   8e-05
ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C (M...    45   8e-05
AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH] complement(...    44   1e-04
ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH] complement(...    44   1e-04
Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement        42   1e-04
Kwal_26.8351                                                           44   1e-04
YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcripti...    44   1e-04
CAGL0F05995g complement(598819..600612) some similarities with s...    44   1e-04
CAGL0C02519g 253051..254007 weakly similar to sp|P39943 Saccharo...    44   1e-04
Scas_695.2                                                             44   2e-04
Scas_687.33                                                            43   2e-04
AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W (...    43   2e-04
KLLA0F07073g 675221..676897 some similarities with sgd|S0004367 ...    43   3e-04
Scas_712.42*                                                           42   3e-04
YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finge...    43   3e-04
YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein in...    42   3e-04
CAGL0M13189g complement(1294293..1295918) weakly similar to sp|P...    43   3e-04
Scas_649.28                                                            42   4e-04
AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH] (574723..57...    42   4e-04
Kwal_23.5400                                                           42   5e-04
YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger transcr...    42   5e-04
CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces c...    42   5e-04
KLLA0B00605g complement(46736..47455) some similarities with sp|...    41   5e-04
Scas_575.3                                                             42   5e-04
Scas_712.2                                                             42   6e-04
YLR131C (ACE2) [3541] chr12 complement(404511..406823) Metalloth...    42   7e-04
AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C (...    40   7e-04
Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement       42   7e-04
Kwal_47.19045                                                          41   7e-04
Scas_693.31                                                            42   7e-04
Scas_717.17                                                            42   7e-04
Sklu_2389.2 YJL056C, Contig c2389 3525-5828                            41   0.001
Kwal_27.10925                                                          40   0.001
YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription facto...    41   0.001
Kwal_26.8021                                                           41   0.001
Kwal_14.2278                                                           41   0.001
YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-fing...    41   0.001
Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement          40   0.002
Scas_670.2                                                             40   0.002
Kwal_27.10167                                                          40   0.002
YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger transcri...    40   0.002
Scas_627.6                                                             40   0.003
Sklu_2443.22 , Contig c2443 45390-46027                                39   0.004
KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA Kluy...    39   0.004
AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -...    39   0.005
CAGL0K02145g 190055..191008 some similarities with sp|P39959 Sac...    39   0.006
KLLA0E08679g 777005..778795 some similarities with sp|P53968 Sac...    39   0.007
YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with str...    38   0.008
YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor ...    37   0.008
Scas_378.1                                                             37   0.009
Scas_569.2                                                             37   0.010
CAGL0K09372g complement(924818..926008) similar to sp|P53035 Sac...    38   0.011
CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces cer...    38   0.011
Scas_602.9                                                             38   0.012
KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces c...    38   0.012
KLLA0B03454g complement(314015..315433) some similarities with s...    37   0.013
YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor i...    37   0.015
Scas_683.30                                                            37   0.016
YDL048C (STP4) [816] chr4 complement(366739..368211) Protein wit...    37   0.018
CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces c...    37   0.023
AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)...    37   0.024
Kwal_47.17241                                                          37   0.026
Sklu_2206.2 YLR375W, Contig c2206 7136-8212                            36   0.029
Kwal_47.16621                                                          36   0.036
CAGL0H07557g 738086..739516 some similarities with sp|P32805 Sac...    36   0.041
Sklu_2359.5 YPR022C, Contig c2359 10655-12818                          36   0.043
Sklu_2181.1 YER130C, Contig c2181 4015-5247                            35   0.049
Scas_721.92                                                            36   0.054
YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein...    35   0.060
Scas_703.23                                                            35   0.062
CAGL0H04873g complement(465069..466424) some similarities with t...    35   0.064
YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative transcr...    35   0.068
Kwal_26.9300                                                           35   0.075
KLLA0E13519g complement(1190615..1191307) some similarities with...    34   0.082
ACL057W [992] [Homologous to ScYER130C - SH] complement(264934.....    35   0.089
Scas_683.25                                                            35   0.099
YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predic...    35   0.11 
CAGL0K04697g 458366..459913 some similarities with tr|Q07351 Sac...    34   0.12 
YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA polym...    34   0.14 
KLLA0B07909g 697885..700653 some similarities with sp|P53243 Sac...    34   0.15 
Kwal_55.20634                                                          34   0.17 
AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH] complement(...    34   0.18 
Scas_707.31                                                            33   0.21 
CAGL0L06072g complement(679924..680826) some similarities with s...    33   0.23 
YML081W (YML081W) [3888] chr13 (104777..108532) Protein with sim...    34   0.24 
Scas_631.7                                                             33   0.37 
KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959 Saccha...    32   0.53 
CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces c...    32   0.69 
YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein w...    32   0.81 
KLLA0F13046g 1201353..1205492 some similarities with sp|P07248 S...    32   1.0  
CAGL0K04631g complement(440721..443762) some similarities with s...    32   1.0  
KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyce...    31   1.2  
Scas_719.68                                                            31   1.3  
CAGL0E03762g complement(351003..352757) weakly similar to sp|P33...    31   1.7  
CAGL0E06116g complement(604708..606549) some similarities with t...    31   2.0  
CAGL0G10021g complement(959154..960338) similar to sp|P39933 Sac...    30   2.1  
Sklu_2126.5 YHL027W, Contig c2126 7763-9109                            30   2.2  
Kwal_47.16577                                                          30   2.9  
YMR182C (RGM1) [4137] chr13 complement(624531..625166) Transcrip...    30   3.1  
AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C (...    30   3.7  
Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement         29   6.1  
YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor...    28   8.5  
Scas_720.33                                                            28   9.9  

>Scas_707.46
          Length = 338

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/338 (80%), Positives = 271/338 (80%)

Query: 1   MESIILKSHPFPPHINIGLMNSQHSEDLAHPQNHRHSFDASIIDSSAYKKNLEDAYSLPN 60
           MESIILKSHPFPPHINIGLMNSQHSEDLAHPQNHRHSFDASIIDSSAYKKNLEDAYSLPN
Sbjct: 1   MESIILKSHPFPPHINIGLMNSQHSEDLAHPQNHRHSFDASIIDSSAYKKNLEDAYSLPN 60

Query: 61  SPENGGRSAFITLPPCSSLVHTGQKSSRXXXXXXXXXXENKAKYXXXXXXXXXXXXXXXX 120
           SPENGGRSAFITLPPCSSLVHTGQKSSR          ENKAKY                
Sbjct: 61  SPENGGRSAFITLPPCSSLVHTGQKSSRTTPAPPPAPTENKAKYPAQPQGVPQGVSQGAP 120

Query: 121 XNYELQVSQQNKSPLQYPQQTIPLAAXXXXXXXXXXXXXXXXHATGLPSYPPIVFGQVSP 180
            NYELQVSQQNKSPLQYPQQTIPLAA                HATGLPSYPPIVFGQVSP
Sbjct: 121 QNYELQVSQQNKSPLQYPQQTIPLAAYPQFQNQQMYPPNQQYHATGLPSYPPIVFGQVSP 180

Query: 181 PQAAPMIDPRXXXXXXXXXXXXXXXXXXXXXXXXIVFPNNNNVKFPQDGYDPHQFPNYNI 240
           PQAAPMIDPR                        IVFPNNNNVKFPQDGYDPHQFPNYNI
Sbjct: 181 PQAAPMIDPRQGPNQPYIQIYPQPQTQMPMQSQPIVFPNNNNVKFPQDGYDPHQFPNYNI 240

Query: 241 LMNDGVVDYLQPPSRSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRC 300
           LMNDGVVDYLQPPSRSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRC
Sbjct: 241 LMNDGVVDYLQPPSRSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRC 300

Query: 301 PWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVINERKPT 338
           PWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVINERKPT
Sbjct: 301 PWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVINERKPT 338

>YPR015C (YPR015C) [5449] chr16 complement(590278..591021) Protein
           with similarity to human GT box-binding protein
           (SP:B44489), has two tandem C2H2-type zinc fingers [744
           bp, 247 aa]
          Length = 247

 Score =  132 bits (332), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 72/98 (73%)

Query: 231 DPHQFPNYNILMNDGVVDYLQPPSRSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYL 290
           + +  PN +I  N G +          IQK L    +LRKQCP+CGK+CSRPSTL+THYL
Sbjct: 146 EQYSLPNVHIGQNPGTLLSQTQTDLDLIQKQLRAVVKLRKQCPICGKVCSRPSTLRTHYL 205

Query: 291 IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAK 328
           IHTGDTPF+C W+ CNKSFNVKSNMLRHL++HQKK AK
Sbjct: 206 IHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAK 243

>Scas_602.4
          Length = 266

 Score =  123 bits (308), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 53/68 (77%), Positives = 59/68 (86%)

Query: 261 NLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320
           N  L S+LRKQCP CGKICSRPSTLK HYLIHTGDTPF+C W +CNK+FNVKSNMLRHLK
Sbjct: 191 NRTLLSKLRKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLK 250

Query: 321 SHQKKGAK 328
           +H+KK  K
Sbjct: 251 AHEKKVIK 258

>CAGL0L05786g complement(636176..637222) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 348

 Score =  124 bits (310), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 51/64 (79%), Positives = 59/64 (92%)

Query: 262 LNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKS 321
           ++  S+LRKQCPVCGK+CSRPSTLKTHYLIHTGDTPF+CPWK C K+FNVKSNMLRHLK 
Sbjct: 277 IDELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKC 336

Query: 322 HQKK 325
           H++K
Sbjct: 337 HERK 340

>YPR013C (YPR013C) [5448] chr16 complement(584627..585580) Putative
           transcription factor with similarity to mouse REX1
           encoded transcription factor, has two tandem C2H2-type
           zinc fingers [954 bp, 317 aa]
          Length = 317

 Score =  122 bits (306), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 59/64 (92%)

Query: 265 ASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           +++LRKQCPVCGKICSRPSTLKTHYLIHTGDTPF+C W+ C KSFNVKSNMLRHLKSH++
Sbjct: 249 STKLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHER 308

Query: 325 KGAK 328
           K  K
Sbjct: 309 KRNK 312

>CAGL0J01595g 151584..152618 some similarities with tr|Q12531
           Saccharomyces cerevisiae YPR015c or tr|Q12145
           Saccharomyces cerevisiae YPR013c, hypothetical start
          Length = 344

 Score =  119 bits (298), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 55/85 (64%), Positives = 64/85 (75%), Gaps = 1/85 (1%)

Query: 241 LMNDGVVDYLQPPSRSAIQKNLNLAS-RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFR 299
           LM   + D +        ++ L  A+ RLRKQCPVCGKICSRPSTLKTH LIHTGDTPF+
Sbjct: 254 LMEHQLTDAMTKQEIKLTKRQLKKATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFK 313

Query: 300 CPWKSCNKSFNVKSNMLRHLKSHQK 324
           C WK C K+FNVKSN+LRHLKSH+K
Sbjct: 314 CTWKDCRKAFNVKSNLLRHLKSHEK 338

>Scas_602.4d
          Length = 256

 Score =  105 bits (263), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 44/59 (74%), Positives = 51/59 (86%)

Query: 270 KQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAK 328
           K+CPVCGK+CSRPSTLKTH+LIHTGDTPF+C +  C KSFNVKSNM RHLK H++K  K
Sbjct: 195 KECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNK 253

>KLLA0A04609g complement(411494..412765) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 423

 Score = 91.7 bits (226), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 37/58 (63%), Positives = 47/58 (81%)

Query: 269 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           + QC +CG+ICSRPSTL+TH  IHTGD P++CP ++C+K FNVKSNMLRH K H+ K 
Sbjct: 340 KNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRHEFKS 397

>Scas_656.1*
          Length = 102

 Score = 84.0 bits (206), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 35/55 (63%), Positives = 44/55 (80%)

Query: 270 KQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           +QCP+CGKI +R S+L+TH L+HTGD PF+C W +C K+FNVKSNM RH K H K
Sbjct: 40  RQCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>AEL077W [2429] [Homologous to NOHBY] complement(483028..484038)
           [1011 bp, 336 aa]
          Length = 336

 Score = 88.6 bits (218), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 43/61 (70%)

Query: 268 LRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGA 327
           +R QCPVCGK+C RPS+L+ H  IHTG  PF C W  C K FNVKSNM+RH + HQ +  
Sbjct: 272 VRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQRG 331

Query: 328 K 328
           K
Sbjct: 332 K 332

>ADL040W [1701] [Homologous to ScYPR013C - SH]
           complement(618855..619847) [993 bp, 330 aa]
          Length = 330

 Score = 85.9 bits (211), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 35/56 (62%), Positives = 45/56 (80%)

Query: 270 KQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           K C VCG+ C+RPSTLKTH LIHTG+ PF+C W  C+K FNV+SNM RH+ SH+++
Sbjct: 258 KTCLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRR 313

>Kwal_26.8011
          Length = 190

 Score = 80.5 bits (197), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 34/54 (62%), Positives = 43/54 (79%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           QC +C KI SR S L+ H L HTG  PFRCP+ SC+K+FNVKSNM+RHLK+H++
Sbjct: 129 QCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTHKQ 182

>KLLA0F20636g complement(1914452..1915309) some similarities with
           sgd|S0006217 Saccharomyces cerevisiae YPR013c,
           hypothetical start
          Length = 285

 Score = 81.6 bits (200), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 40/52 (76%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           C  CGK  +RPS L+TH L+H+GD PF C W+ CNK FNVKSN++RHLK H+
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLHK 285

>Scas_710.9
          Length = 505

 Score = 82.4 bits (202), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 44/60 (73%), Gaps = 1/60 (1%)

Query: 264 LASRLRK-QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           L +R RK QC +CGK+ +R S+L+TH LIHTG  PF C W  C K+FNVKSNM RHLK H
Sbjct: 440 LQTRKRKKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLH 499

>ADR308C [2049] [Homologous to NOHBY] (1241869..1242705) [837 bp,
           278 aa]
          Length = 278

 Score = 79.0 bits (193), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 48/72 (66%), Gaps = 1/72 (1%)

Query: 253 PSRSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVK 312
           P  S  + N +++++ +  C VCG+ C RPSTLKTH L HTG  PF C    C+KSFNV+
Sbjct: 188 PGMSVAKPNYSVSTK-KNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVR 246

Query: 313 SNMLRHLKSHQK 324
           SNMLRH + H +
Sbjct: 247 SNMLRHERLHSR 258

>Sklu_2398.2 , Contig c2398 2210-3076 reverse complement
          Length = 288

 Score = 77.8 bits (190), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 44/70 (62%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           +L+  CP CGK   RPS LKTH +IH G +P+ C W  C+K FNVK N+LRH + H KK 
Sbjct: 215 KLQHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKK 274

Query: 327 AKTYVINERK 336
             + V   R+
Sbjct: 275 EASGVKTRRR 284

>Kwal_27.10467
          Length = 302

 Score = 76.6 bits (187), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 45/70 (64%), Gaps = 4/70 (5%)

Query: 267 RLRKQ----CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           RLR Q    C  CGK+ +RPS+L TH   HTGD P+ CP+ +C+K FN +SNM RH K H
Sbjct: 191 RLRNQPRYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLH 250

Query: 323 QKKGAKTYVI 332
            K    TYV+
Sbjct: 251 FKTDIGTYVL 260

>AGL207W [4105] [Homologous to NOHBY] complement(310750..311583)
           [834 bp, 277 aa]
          Length = 277

 Score = 75.9 bits (185), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 43/64 (67%)

Query: 269 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAK 328
           R  C  CGK  +R S+L+TH  IHTGD PF CP+K+C KSFN +SNMLRH K H +    
Sbjct: 182 RYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFRTDCG 241

Query: 329 TYVI 332
            Y++
Sbjct: 242 MYML 245

>Scas_718.36d
          Length = 330

 Score = 75.1 bits (183), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           +L   C VCGK   RPS+L+TH  I +G+ P++CP+ +C KSFN KSNMLRH K H +  
Sbjct: 236 KLGYFCDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHFRLT 295

Query: 327 AKTYVI 332
           +  YV+
Sbjct: 296 SGAYVL 301

>Scas_717.18
          Length = 354

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 42/54 (77%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           +CP+C KI +R ++L++H LIHTG+ P++C W +C+ S +VKSN+ RH KSH K
Sbjct: 297 KCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLK 350

>CAGL0M01870g complement(219813..220760) some similarities with
           tr|Q12145 Saccharomyces cerevisiae YPR013c or tr|Q12531
           Saccharomyces cerevisiae YPR015c, hypothetical start
          Length = 315

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 40/61 (65%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           C VC K   RPS+L TH  IHTG+ P+ CP+ +C KSFN KSNMLRH K H K     Y+
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFKLSNGAYI 234

Query: 332 I 332
           +
Sbjct: 235 L 235

>ADL051W [1690] [Homologous to NOHBY] complement(595496..596017)
           [522 bp, 173 aa]
          Length = 173

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 42/55 (76%)

Query: 270 KQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           K C +C K  +R ++L+TH LIHT   P+RCP+++CNK+FNVKSN+ RH + H++
Sbjct: 116 KTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>Scas_717.17d
          Length = 350

 Score = 72.8 bits (177), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 42/61 (68%), Gaps = 4/61 (6%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK----KGA 327
           C VCGK  +R ++L+TH LIHTG  PF+C W +C  S +VKSN+ RH KSH K    +GA
Sbjct: 287 CVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLKGQTTEGA 346

Query: 328 K 328
           K
Sbjct: 347 K 347

>KLLA0F11682g complement(1068992..1070116) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 374

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (69%)

Query: 269 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           + +C  CGK  +RPS+L TH  IHTGD P++C + +C K FN KSNMLRH K H K
Sbjct: 303 KYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLK 358

>ADL042W [1699] [Homologous to ScYPR015C - SH]
           complement(615818..616663) [846 bp, 281 aa]
          Length = 281

 Score = 70.1 bits (170), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 37/53 (69%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           C +CGK   RPS L+TH ++H  D P+ C  + C K FNVKSNMLRH++ H++
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKHKE 279

>Sklu_2244.3 , Contig c2244 4100-4915 reverse complement
          Length = 271

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 38/54 (70%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           CP C K   RPS L+TH +IH G  PF C W +C+K FNVKSN+LRH +SH ++
Sbjct: 218 CPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSHNRE 271

>Kwal_14.2206
          Length = 254

 Score = 68.6 bits (166), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (68%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           +C +CGK  SRPS L TH LIHTG  P+ C   +C K FNVKSN++RH K H K
Sbjct: 195 ECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>ADL050W [1691] [Homologous to NOHBY] complement(597229..597669)
           [441 bp, 146 aa]
          Length = 146

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 38/54 (70%)

Query: 270 KQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           K CPVC K  +R ++L TH LIH    P+ C + +CNKSFNVKSN+ RHL+ H+
Sbjct: 76  KTCPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIHR 129

>AGR186C [4497] [Homologous to NOHBY] (1099513..1100376) [864 bp,
           287 aa]
          Length = 287

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (66%), Gaps = 5/75 (6%)

Query: 253 PSRSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVK 312
           PS+++  + L   S++   CP+CGK  +R STL+ H LIHT   PF+C +  C+K FNVK
Sbjct: 153 PSQTSSNRGLIFVSKI---CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVK 207

Query: 313 SNMLRHLKSHQKKGA 327
           SN+ RH + H++K +
Sbjct: 208 SNLNRHERIHRQKAS 222

>KLLA0F22319g complement(2086613..2087224) some similarities with
           sgd|S0006219 Saccharomyces cerevisiae YPR015c,
           hypothetical start
          Length = 203

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%)

Query: 276 GKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           GK  SRPSTLKTH ++H+   PF+C +  CNKS+NVKSN+ RH K H+
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKHK 199

>Scas_697.35
          Length = 839

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           QC  CGK  ++   L+TH  +HTG+ P+ C    C+K F+ K N+  HL +HQK
Sbjct: 544 QCGYCGKRFTQGGNLRTHQRLHTGEKPYECEL--CDKKFSRKGNLAAHLLTHQK 595

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +C +C K  SR   L  H L H    PF C   +CN+SF    NM    K+HQ +
Sbjct: 572 ECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNM----KAHQNR 622

>CAGL0E01331g 124362..126431 weakly similar to sp|P08153
           Saccharomyces cerevisiae YDR146c transcription factor,
           hypothetical start
          Length = 689

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           P CGK   R   +++H   H  D P+RC +  C+K+F    +++RH K+HQ+K
Sbjct: 561 PQCGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEK 613

>YDR043C (NRG1) [896] chr4 complement(542670..543365)
           Transcriptional repressor involved in glucose repression
           of STA1 and MUC1, suppressor of snf mutations, has two
           tandem C2H2-type zinc fingers [696 bp, 231 aa]
          Length = 231

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%)

Query: 255 RSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSN 314
           R+ +    +L  R +  C +C +  +    L  H  IHTG+    CP+K C + F+   N
Sbjct: 159 RNTLSDEEDLEQRRKYICKICARGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDN 218

Query: 315 MLRHLKSHQKKG 326
            L+H ++H KKG
Sbjct: 219 CLQHYRTHLKKG 230

>Scas_711.56
          Length = 832

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +C +CGK  +  S+LK H   HTG+ P  C  K C K+FN  SN+ +H+K+H K+
Sbjct: 755 KCDICGKRFAISSSLKIHIRTHTGEKPLHC--KICGKAFNESSNLSKHMKTHLKR 807

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           QC +C K  S   TLK H   H+G+ PF+C    C K F + S++  H+++H
Sbjct: 727 QCSICKKHFSNEETLKQHERTHSGEKPFKC--DICGKRFAISSSLKIHIRTH 776

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 9/29 (31%), Positives = 19/29 (65%)

Query: 294 GDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           G + + C W +C+K F+ +  ++RH++ H
Sbjct: 692 GQSQYECHWANCHKIFSQRQRLVRHMRVH 720

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C KI S+   L  H  +H+G  PF+C    C K F+ +  + +H ++H
Sbjct: 703 CHKIFSQRQRLVRHMRVHSGYKPFQCS--ICKKHFSNEETLKQHERTH 748

>Scas_709.32
          Length = 822

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 3/57 (5%)

Query: 271 QCPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           +C  CGK   R   LK H   +H+ + PF CP  +C+K F+   N+ +H+K+H+K+G
Sbjct: 766 KCETCGKAFRRSEHLKRHIRSVHSSERPFACP--TCDKKFSRSDNLAQHIKTHKKRG 820

>YOR113W (AZF1) [4916] chr15 (534075..536819) Glucose-dependent
           transcriptional activator with four tandem C2H2-type
           zinc fingers [2745 bp, 914 aa]
          Length = 914

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           C  CGK  ++   L+TH  +HTG+ P+ C    C+K F+ K N+  HL +HQK
Sbjct: 623 CDYCGKRFTQGGNLRTHERLHTGEKPYSCDI--CDKKFSRKGNLAAHLVTHQK 673

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           C +C K  SR   L  H + H    PF C  ++CNK+F    NM    K+HQ +
Sbjct: 651 CDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNM----KAHQNR 700

>YJL056C (ZAP1) [2855] chr10 complement(330347..332989)
           Zinc-responsive transcriptional activator, regulates
           genes involved in zinc uptake, has eight C2H2-type zinc
           fingers [2643 bp, 880 aa]
          Length = 880

 Score = 51.6 bits (122), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +C +C K  +  S+LK H   HTG+ P +C  K C K FN  SN+ +H+K+HQKK
Sbjct: 797 KCHICNKKFAISSSLKIHIRTHTGEKPLQC--KICGKRFNESSNLSKHIKTHQKK 849

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 294 GDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           G + ++C W  C+++F  +  ++RHLK H K
Sbjct: 734 GKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 764

>CAGL0K12078g complement(1168989..1170380) weakly similar to
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 463

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 1/70 (1%)

Query: 263 NLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           ++  R +  C VCGK  +    L  H  IHTG+    CP++ C + FN   N L+H K+H
Sbjct: 395 DIELRRKYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTH 454

Query: 323 QKKGAKTYVI 332
            K+  K Y++
Sbjct: 455 LKR-LKEYMV 463

>AGL197W [4115] [Homologous to ScYDR146C (SWI5) - SH; ScYLR131C
           (ACE2) - SH] complement(325717..328251) [2535 bp, 844
           aa]
          Length = 844

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 271 QC--PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           QC  P CGK+ +R   +++H   H  D PFRC  + C K+F    +++RH K+H +K
Sbjct: 675 QCLYPECGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAEK 731

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 288 HYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
            Y+    D  F+C +  C K FN + N+  H+++H
Sbjct: 664 QYIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTH 698

>CAGL0M06831g 695162..697099 weakly similar to sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1, hypothetical
           start
          Length = 645

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           C VCGK+ SRP  LK+H   HT + P++C    C K+F  + +  RH   H   G K YV
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLH--TGKKRYV 578

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 34/88 (38%), Gaps = 14/88 (15%)

Query: 248 DYLQPPSRSAIQKNLNLASRLRK-------QCPVCGKICSRPSTLKTHYLIHTGDTPFRC 300
           DY+         +  NL S LR        QC +CGK  +R    K H  +HTG   + C
Sbjct: 520 DYVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSICGKAFARQHDKKRHEDLHTGKKRYVC 579

Query: 301 PWK-------SCNKSFNVKSNMLRHLKS 321
             K        C K F     + RH K+
Sbjct: 580 GGKLKDGTFWGCGKKFARSDALGRHFKT 607

>KLLA0F01463g 140343..142688 some similarities with sp|P47043
           Saccharomyces cerevisiae YJL056c ZAP1 metalloregulatory
           protein involved in zinc-responsive transcriptional
           regulation, hypothetical start
          Length = 781

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%), Gaps = 2/58 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAK 328
           +C +C K  S  S+L+ H   HTG+ P  CP   CNK FN  SN+ +H+++H+++  +
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRTHKRENCR 776

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 275 CGKICSRPSTLKTH---YLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           C K      +L  H   + + +G + ++C W+ CNK F  K  ++RHLK H K
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVHSK 688

 Score = 34.3 bits (77), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 2/48 (4%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C K+  +   L  H  +H+   PFRC    C K FN +  + +HL+ H
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRCA--ECGKCFNTQDILTQHLRVH 714

>ACR264W [1311] [Homologous to ScYOR113W (AZF1) - SH]
           complement(835313..837622) [2310 bp, 769 aa]
          Length = 769

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           QC  CGK  ++   L+TH  +HTG+ P+ C    C K F+ K N+  H+ +H+
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTHE 566

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +C  CGK  SR   L  H L H    PF+C    CNKSF    NM    K+HQ +
Sbjct: 544 ECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNM----KAHQNR 594

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           +CP C K  ++ + L+ H   H G  PF+C +  C K F    N+  H++ H
Sbjct: 488 KCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

>Kwal_14.2543
          Length = 711

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +C  CGK  +  S+L+ H   HTG+ P  C  K C K FN  SN+ +H+++H++K
Sbjct: 635 KCSHCGKGFATSSSLRIHIRTHTGEKPLEC--KVCGKRFNESSNLSKHMRTHERK 687

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 9/31 (29%), Positives = 18/31 (58%)

Query: 294 GDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           G + + C W++C +    +  +LRHL+ H +
Sbjct: 572 GKSSYVCGWENCGRVITQRQKLLRHLRVHTR 602

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTY 330
           CG++ ++   L  H  +HT   P +C    C K+F+ +  + +H+++H   G K Y
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKPCKCV--HCLKTFSTQDILQQHMRTH--SGEKPY 634

>KLLA0A10373g complement(907244..907864) some similarities with
           ca|CA1157|CaPZF1 Candida albicans TFIIIA (transcription
           initiation factor) (by homology), hypothetical start
          Length = 206

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 269 RKQCPV--CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           R  CP+  CGK  SRP  L+ H   HT + PF CP   C+K+F   S++  H+ SH K
Sbjct: 7   RYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPGCDKAFLRPSHLRVHMLSHSK 64

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKT 329
           P C K   RPS L+ H L H+   P+ C    C K F  K    RH ++H +    T
Sbjct: 43  PGCDKAFLRPSHLRVHMLSHSKVKPYNC--SVCGKGFATKQQFQRHQQTHTQNQDDT 97

>CAGL0L03916g complement(448955..450883) weakly similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 642

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           +C  CGK  ++   L+TH  +HTG+ PF+C    C+K+F  + N+  H  +H+
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTHE 559

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           QC  C K+ S+ + L  H   H G  PF C +  C K F    N+  H + H
Sbjct: 481 QCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

>CAGL0J05060g 478650..480791 similar to sp|P47043 Saccharomyces
           cerevisiae YJL056c ZAP1 metalloregulatory protein,
           hypothetical start
          Length = 713

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +C +C K  +  ++LK H   HTG+ P +C  K C + FN  SN+ +H+K+H KK
Sbjct: 626 ECHICHKRFAISNSLKIHIRTHTGEKPLKC--KVCGRCFNESSNLSKHMKTHMKK 678

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 294 GDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           G + + C W+ CNK+F+ +  ++RHLK H K
Sbjct: 563 GKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 295 DTPFRCPWKSCNKSFNVKSNMLRHLKS-HQKKGAKTYVI 332
           +T F C W  CN+ F    ++  HL+  H  KG   Y  
Sbjct: 531 ETEFCCKWAGCNERFKSAGDLNDHLEEMHLTKGKSQYTC 569

>CAGL0M04323g complement(474158..476269) similar to sp|P21192
           Saccharomyces cerevisiae YLR131c ACE2 or sp|P08153
           Saccharomyces cerevisiae YDR146c SWI5, hypothetical
           start
          Length = 703

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           P CGK   R   +K+H   H  D P++C ++ C K+F    ++ RH K+H K
Sbjct: 528 PNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTHDK 579

>Kwal_47.17888
          Length = 786

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           QC  CGK  ++   L+TH  +HTG+ P+ C  + C + F+ K N+  H  +H+
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTHE 582

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +C  CG+  SR   L  H L H    PF C    CNKSF    NM    K+HQ +
Sbjct: 560 ECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNM----KAHQNR 610

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTY 330
           +CP C K  ++ + L+ H   H G  PF+C +  C K F    N+  H++ H   G K Y
Sbjct: 504 ECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH--TGEKPY 559

>YER028C (MIG3) [1453] chr5 complement(210691..211875) Protein that
           contains two tandem C2H2-type zinc finger domains, has
           strong similarity to Mig2p, a Tup1p-dependent and
           glucose-dependent transcriptional repressor [1185 bp,
           394 aa]
          Length = 394

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 9/72 (12%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK------ 324
           +C +C +   R    K H   HTG+ P +C  + C KSF+    + RHL++H K      
Sbjct: 18  RCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTKGVQRRR 77

Query: 325 ---KGAKTYVIN 333
              KG++  V+N
Sbjct: 78  IKSKGSRKTVVN 89

>KLLA0F18524g complement(1701498..1702571) some similarities with
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1
           transcriptional repressor for glucose repression of STA1
           gene expression, hypothetical start
          Length = 357

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%)

Query: 260 KNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHL 319
           K+L LA R +  C +C +  +    L  H  IHTG+   +C +  CN+ F+   N ++H 
Sbjct: 274 KDLPLAERRKYICKICSRGFTTSGHLARHNRIHTGEKRHQCQFPGCNQRFSRHDNYIQHY 333

Query: 320 KSHQK 324
           ++H K
Sbjct: 334 RTHFK 338

>KLLA0E18645g complement(1648263..1649558) some similarities with
           sp|P54785 Saccharomyces cerevisiae YMR070w HMS1
           high-copy suppressor of MOT1-SPT3 synthetic lethality
           singleton, hypothetical start
          Length = 431

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320
           QC +C K   R S LK H L H+    F CPW  C+ +   K N+L+HLK
Sbjct: 307 QCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLK 354

>YNL027W (CRZ1) [4559] chr14 (579578..581614) Calcineurin-dependent
           transcription factor, regulates gene expression
           downstream of calcineurin in response to multiple
           environmental signals, has two C2H2-type zinc finger
           domains [2037 bp, 678 aa]
          Length = 678

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           C VCGK  +RP  LK+H   HT + PF C    C K+F  + +  RH   H   G K YV
Sbjct: 571 CDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHT--GKKRYV 626

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 31/78 (39%), Gaps = 16/78 (20%)

Query: 263 NLASRLRKQ-------CPVCGKICSRPSTLKTHYLIHTGDTPFRC--------PWKSCNK 307
           NL S LR         C +CGK  +R    K H  +HTG   + C        PW  C K
Sbjct: 583 NLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGK 641

Query: 308 SFNVKSNMLRHLKSHQKK 325
            F     + RH K+   +
Sbjct: 642 KFARSDALGRHFKTESGR 659

>CAGL0I02816g complement(247817..248692) similar to sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 291

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 4/55 (7%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +C +C K  SR   L  H + H    PF C   +CNKSF+     L ++KSHQ K
Sbjct: 12  ECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFS----QLGNMKSHQNK 62

>Kwal_56.23925
          Length = 745

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           P CGK   R   +++H   H  D P+ C ++ C+K+F    +++RH K+H +K
Sbjct: 590 PDCGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAEK 642

>KLLA0F23782g 2219920..2222268 some similarities with sp|P41696
           Saccharomyces cerevisiae YOR113w AZF1 asparagine-rich
           zinc finger protein, hypothetical start
          Length = 782

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C  CGK  ++   L+TH  +HTG+ P+ C  + C + F+ K N+  H  +H
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTH 601

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +C  CG+  SR   L  H L H    PF C    CNK+F    NM    K+HQ +
Sbjct: 580 ECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNM----KAHQNR 630

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTY 330
           QCP C K  ++ + L+ H   H G  PF C +  C K F    N+  H++ H   G K Y
Sbjct: 524 QCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH--TGEKPY 579

>Scas_718.44
          Length = 266

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           R +  C +C    +    L  H  IHTG+    CP++ CN+ F+   N L+H ++H KK 
Sbjct: 207 RRKHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLKKN 266

>CAGL0L07480g complement(822240..823184) some similarities with
           sp|P38082 Saccharomyces cerevisiae YBR066c NRG2 or
           sp|Q03125 Saccharomyces cerevisiae YDR043c NRG1,
           hypothetical start
          Length = 314

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 34/66 (51%)

Query: 264 LASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           +  R +  C +C    +    L  H  IHTG+    CP + CN+SF+   N L+H ++H 
Sbjct: 246 IEQRRKHICQICLTGFTTSGHLSRHAKIHTGEKSHVCPHEGCNQSFSRHDNCLQHYRTHS 305

Query: 324 KKGAKT 329
           KK  ++
Sbjct: 306 KKKEQS 311

>Scas_713.52
          Length = 620

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGA 327
           CGKI  R   +++H   H  D P+ C +  C K+F    +++RH KSH  + +
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANRTS 539

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 277 KICSRPSTLKTH----YLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           +I ++PSTL       Y+    D  F C ++ C K F  + N+  H+++H
Sbjct: 455 RITNKPSTLPRGTIDLYVKELPDKLFECLYEDCGKIFKRRYNVRSHIQTH 504

>KLLA0D16456g complement(1387846..1390410) weakly similar to
           sp|P21192 Saccharomyces cerevisiae YLR131c ACE2
           metallothionein expression activator, hypothetical start
          Length = 854

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 271 QCPV--CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           QC    C K  +R    +TH   H  D P++C +  C K+F    ++LRH KSH +KG
Sbjct: 694 QCKFKDCQKRFNRRYNARTHIQTHLCDRPYKCDFPGCQKAFVRNHDLLRHKKSHLEKG 751

 Score = 34.7 bits (78), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 20/34 (58%)

Query: 289 YLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           Y++  G   F+C +K C K FN + N   H+++H
Sbjct: 684 YILEIGPKQFQCKFKDCQKRFNRRYNARTHIQTH 717

>CAGL0K03003g 276756..278699 weakly similar to sp|P54785
           Saccharomyces cerevisiae YMR070w MOT3, hypothetical
           start
          Length = 647

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320
           +C +C K+  R S LK H L H+    F CPW  CN     + N+L+H+K
Sbjct: 535 RCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW--CNSRHKRRDNLLQHMK 582

>Kwal_27.11460
          Length = 531

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 255 RSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSN 314
           R ++QKN ++ +     C +C K  +RP  LK+H   HT + PF C    C K+F  + +
Sbjct: 403 RKSLQKNASVYA-----CELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHD 455

Query: 315 MLRHLKSHQKKGAKTYV 331
             RH   H   G K Y 
Sbjct: 456 RKRHEDLH--TGQKRYT 470

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 30/77 (38%), Gaps = 14/77 (18%)

Query: 263 NLASRLRK-------QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWK-------SCNKS 308
           NL S LR         C +CGK  +R    K H  +HTG   + C  K        C K 
Sbjct: 427 NLKSHLRTHTDERPFSCAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEWGCGKK 486

Query: 309 FNVKSNMLRHLKSHQKK 325
           F     + RH K+   K
Sbjct: 487 FARSDALGRHFKTEGGK 503

>KLLA0F26961g 2486804..2488888 some similarities with sp|P33748
           Saccharomyces cerevisiae YMR037c MSN2 stress responsive
           regulatory protein, hypothetical start
          Length = 694

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 271 QCPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKT 329
           +C  C K   R   LK H   +H+ + PF C +  C+K F+   N+ +HLK+H+K G  T
Sbjct: 622 KCDQCNKTFRRSEHLKRHVRSVHSTERPFHCQF--CDKKFSRSDNLSQHLKTHKKHGDIT 679

Query: 330 YV 331
            +
Sbjct: 680 EL 681

>ABR089C [680] [Homologous to ScYKL062W (MSN4) - SH; ScYMR037C
           (MSN2) - SH] (548266..549981) [1716 bp, 571 aa]
          Length = 571

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 271 QCPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           +C  C K   R   LK H   +H+ D PF C +  C+K F+   N+ +HLK+H+K G
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTHRKHG 559

>AEL174W [2332] [Homologous to ScYJL056C (ZAP1) - SH]
           complement(310950..312935) [1986 bp, 661 aa]
          Length = 661

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           C  C K  S  S+L+ H   HTG+ P  C    C K FN  SN+ +H+K H++K
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCT--VCGKRFNESSNLSKHMKIHERK 625

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 41/99 (41%), Gaps = 20/99 (20%)

Query: 242 MNDGVVDYLQPPSRSAIQKNLNLASRLRKQ------------------CPVCGKICSRPS 283
           +ND +V    P  RSA Q N    ++   Q                  CP C K  S   
Sbjct: 498 LNDHIVSSHVPSGRSAYQCNWAGCTKHFTQRQKLFAPHQGTHRHKPCSCPHCPKTFSTDD 557

Query: 284 TLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
            L  H   H+G+ PF C +  C K F+  S++  H+++H
Sbjct: 558 ILAQHIRTHSGERPFHCHY--CRKQFSTSSSLRVHIRTH 594

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 19/42 (45%), Gaps = 1/42 (2%)

Query: 293 TGDTPFRCPWKSCNKSFNVKSNMLRHL-KSHQKKGAKTYVIN 333
           + D  FRC W SC   F+ +  +  H+  SH   G   Y  N
Sbjct: 476 SADGTFRCLWGSCTDCFSSRQALNDHIVSSHVPSGRSAYQCN 517

>ADL198W [1543] [Homologous to ScYNL027W (CRZ1) - SH]
           complement(349070..350713) [1644 bp, 547 aa]
          Length = 547

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 255 RSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSN 314
           R ++QKN  + S     C +C K  +RP  LK+H   HT + PF C    C K+F  + +
Sbjct: 416 RKSLQKNPAIYS-----CNLCDKKFTRPYNLKSHLRTHTDERPFSC--SVCGKAFARQHD 468

Query: 315 MLRHLKSHQKKGAKTYV 331
             RH   H   G K YV
Sbjct: 469 RKRHEDLH--SGKKRYV 483

 Score = 36.6 bits (83), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 30/77 (38%), Gaps = 14/77 (18%)

Query: 263 NLASRLRKQ-------CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWK-------SCNKS 308
           NL S LR         C VCGK  +R    K H  +H+G   + C  K        C K 
Sbjct: 440 NLKSHLRTHTDERPFSCSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKK 499

Query: 309 FNVKSNMLRHLKSHQKK 325
           F     + RH K+   +
Sbjct: 500 FARSDALGRHFKTESGR 516

>Sklu_2357.7 YDR043C, Contig c2357 9816-10289 reverse complement
          Length = 157

 Score = 42.4 bits (98), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 33/64 (51%)

Query: 261 NLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320
           N+ +  R R  C +C +  +    L  H  IHTG+    CP++ C + F+   N ++H +
Sbjct: 91  NVPIEQRRRYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYR 150

Query: 321 SHQK 324
           +H K
Sbjct: 151 THLK 154

>Kwal_26.8351
          Length = 698

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 271 QCPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           +C  C K   R   LK H   +H+ + PF C +  C+K F+   N+ +HLK+H+K G
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKKHG 696

>YDR146C (SWI5) [991] chr4 complement(748607..750736) Transcription
           factor that controls cell cycle-specific transcription
           of HO, has three tandem C2H2-type zinc fingers [2130 bp,
           709 aa]
          Length = 709

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           P C K   R   +++H   H  D P+ C    C+K+F    +++RH KSHQ+K 
Sbjct: 555 PGCTKTFKRRYNIRSHIQTHLEDRPYSCDHPGCDKAFVRNHDLIRHKKSHQEKA 608

>CAGL0F05995g complement(598819..600612) some similarities with
           sp|P33748 Saccharomyces cerevisiae YMR037c MSN2,
           hypothetical start
          Length = 597

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 272 CPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKT 329
           C +C K   R   LK H   +H+ D PF C    C K F+   N+ +H+K+H+K G+ +
Sbjct: 537 CHLCSKAFKRSEHLKRHVRSVHSTDRPFSCHL--CEKKFSRSDNLSQHIKTHKKSGSTS 593

>CAGL0C02519g 253051..254007 weakly similar to sp|P39943
           Saccharomyces cerevisiae YER028c, hypothetical start
          Length = 318

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           +C +C +   R    K H+  HTG+ P +C + SC KSF+    + RH ++H
Sbjct: 21  RCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTH 72

>Scas_695.2
          Length = 571

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           C +C K  +RP  LK+H   HT + PF C    C K+F  + +  RH   H   G K YV
Sbjct: 454 CELCDKTFTRPYNLKSHLRTHTNEXPFVCNI--CGKAFARQHDRKRHEDLH--TGKKRYV 509

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 16/74 (21%)

Query: 263 NLASRLRKQ-------CPVCGKICSRPSTLKTHYLIHTGDTPFRC--------PWKSCNK 307
           NL S LR         C +CGK  +R    K H  +HTG   + C        PW  C+K
Sbjct: 466 NLKSHLRTHTNEXPFVCNICGKAFARQHDRKRHEDLHTGKKRYVCGGVLKNGTPW-GCHK 524

Query: 308 SFNVKSNMLRHLKS 321
            F     + RH K+
Sbjct: 525 KFARSDALGRHFKT 538

>Scas_687.33
          Length = 288

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           +CP+C +   R    K H   HTG+ P  C +  C KSF+    + RH++ H
Sbjct: 18  RCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIH 69

>AFR471C [3663] [Homologous to ScYGL035C (MIG1) - SH; ScYGL209W
           (MIG2) - NSH] (1287076..1288245) [1170 bp, 389 aa]
          Length = 389

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           CP+C +   R      H   HTG+ P  C +  C K F+ +  + RH + H+
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIHE 75

>KLLA0F07073g 675221..676897 some similarities with sgd|S0004367
           Saccharomyces cerevisiae YLR375w STP3 involved in
           pre-tRNA splicing and in uptake of branched-chain amino
           acids, hypothetical start
          Length = 558

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 49/84 (58%), Gaps = 12/84 (14%)

Query: 249 YLQPPSRSA---IQKNLNLAS----RLRKQCPVCGKICSRPSTLKTHYLIHTGDT-PFRC 300
           +L   S+SA   I+ N N+ S    R +KQCP+CG   S  ST K+ +L  + +T PF+C
Sbjct: 356 HLMDNSKSAKMKIENNANMVSKKQPRKKKQCPLCGLFFSNLSTHKSTHL--SPETRPFKC 413

Query: 301 PWKSCNKSFNVKSNMLRHLKSHQK 324
             + C++ F   ++++RH K H K
Sbjct: 414 --EVCSRGFARSNDLIRHKKLHWK 435

>Scas_712.42*
          Length = 290

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           +C  C +   R    K H   HTG+ P  C +  C K F+    + RHL++H
Sbjct: 19  RCETCARGFHRLEHKKRHMRTHTGEKPHHCAFPGCGKGFSRSDELKRHLRTH 70

>YGL035C (MIG1) [1940] chr7 complement(431551..433065) Zinc-finger
           transcriptional repressor involved in
           glucose-repression, has two tandem C2H2-type zinc
           fingers, has similarity to mammalian Sp1, Krox/Egr, and
           Wilms tumor proteins [1515 bp, 504 aa]
          Length = 504

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 6/67 (8%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ------KK 325
           CP+C +   R      H  IHTG+ P  C +  C K F+    + RH + H       K+
Sbjct: 40  CPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKR 99

Query: 326 GAKTYVI 332
           G K  V+
Sbjct: 100 GRKKKVV 106

>YGL209W (MIG2) [1787] chr7 (95860..97008) Zinc-finger protein
           involved in glucose repression of SUC2, contains two
           tandem zinc-fingers [1149 bp, 382 aa]
          Length = 382

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           +C  C +   R    K H   HTG+ P  C +  C KSF+    + RH+++H
Sbjct: 18  RCDTCHRGFHRLEHKKRHLRTHTGEKPHHCAFPGCGKSFSRSDELKRHMRTH 69

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 16/35 (45%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNK 307
           P CGK  SR   LK H   HTG +  R    S  K
Sbjct: 50  PGCGKSFSRSDELKRHMRTHTGQSQRRLKKASVQK 84

>CAGL0M13189g complement(1294293..1295918) weakly similar to
           sp|P33749 Saccharomyces cerevisiae YKL062w MSN4
           transcriptional activator, hypothetical start
          Length = 541

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 271 QCPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           QC  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK+H++ G
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKRHG 539

>Scas_649.28
          Length = 730

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 271 QCPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK+H+K G
Sbjct: 674 KCSECIKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 728

>AGL071C [4240] [Homologous to ScYMR070W (MOT3) - SH]
           (574723..575913) [1191 bp, 396 aa]
          Length = 396

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320
           +C  C K   R S LK H L H+   P+ CPW  C+     K N+ +HLK
Sbjct: 186 KCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLK 233

>Kwal_23.5400
          Length = 429

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 2/54 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           QC VC +  SR + L+ H   H+ D PF+C +  C K    K  + RH  +H +
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

 Score = 32.7 bits (73), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 256 SAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNK-SFNVKSN 314
           SA+Q+++   +  + QCP CGK C     L+ H  IH+         ++CN   F  K +
Sbjct: 210 SALQQHMK-ETHPKLQCPECGKACVGEQGLQMHMKIHSNAVIKNWKCETCNDLYFAKKID 268

Query: 315 MLRHLKSHQK 324
           ++ H   H K
Sbjct: 269 LMAHYMEHHK 278

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 9/76 (11%)

Query: 249 YLQPPSRSAIQKNLNLASRLRK-QCPVCGKICSRPSTLKTHYLIHTG---DTPFRCPWKS 304
           Y  P  R+ I     LA  L+K  C +CGK   RP  LK H   H        ++C   S
Sbjct: 147 YKHPQLRAHI-----LAFHLQKLNCEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGS 201

Query: 305 CNKSFNVKSNMLRHLK 320
           C ++F   S + +H+K
Sbjct: 202 CIEAFKTWSALQQHMK 217

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSF 309
           +C  CGK  +    L+ H + HT    F CP + C +SF
Sbjct: 110 KCSYCGKGVTTKQQLRRHEITHT--RSFVCPHEGCEESF 146

>YKL062W (MSN4) [3197] chr11 (322873..324765) Zinc-finger
           transcriptional activator for genes regulated through
           Snf1p, has strong similarity to Msn2p, has two tandem
           C2H2-type zinc fingers [1893 bp, 630 aa]
          Length = 630

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 271 QCPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           +C  C K   R   LK H   +H+ + PF C +  C K F+   N+ +HLK+H+K G
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKKHG 628

>CAGL0A01628g 156635..157909 similar to sp|P27705 Saccharomyces
           cerevisiae YGL035c MIG1 transcriptional repressor,
           hypothetical start
          Length = 424

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           CP+CG+   R      H   HTG+ P  C +  C K F+    + RH + H
Sbjct: 45  CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>KLLA0B00605g complement(46736..47455) some similarities with
           sp|P39943 Saccharomyces cerevisiae YER028c, hypothetical
           start
          Length = 239

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           C +CG    R      H   HTG+ PF C    C K F+    + RH+K+H K
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFK 66

>Scas_575.3
          Length = 455

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 6/70 (8%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ------KK 325
           CP+C +   R      H   HTG+ P  C +  C K F+    + RH + H       K+
Sbjct: 70  CPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIHTNPQPRGKR 129

Query: 326 GAKTYVINER 335
           G K  V+ ++
Sbjct: 130 GRKKKVVTDQ 139

>Scas_712.2
          Length = 327

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           CGK   RP  LK H   H+   P +C +  C K F     + RHL +H KK  K  +
Sbjct: 50  CGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAKKSRKALL 104

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           C +  +RP  L+ H   HT + P+ C  + C K F    ++  H  +H K
Sbjct: 20  CHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRFMRPCHLKVHKWTHSK 69

>YLR131C (ACE2) [3541] chr12 complement(404511..406823)
           Metallothionein expression activator with similarity to
           Swi5p, has three tandem C2H2-type zinc fingers [2313 bp,
           770 aa]
          Length = 770

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           P C K+  R   +++H   H  D P+ C +  C K+F    +++RH  SH    AK Y+
Sbjct: 608 PNCNKVFKRRYNIRSHIQTHLQDRPYSCDFPGCTKAFVRNHDLIRHKISH---NAKKYI 663

 Score = 32.0 bits (71), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 277 KICSRPSTLK----THYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           KI  +P+TL       Y+    D  F C + +CNK F  + N+  H+++H
Sbjct: 578 KITKKPTTLPPGTIDQYVKELPDKLFECLYPNCNKVFKRRYNIRSHIQTH 627

>AGR031W [4341] [Homologous to ScYDR043C (NRG1) - SH; ScYBR066C
           (NRG2) - SH] complement(769926..770348) [423 bp, 140 aa]
          Length = 140

 Score = 39.7 bits (91), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           R +  C  CGK  +    L  H  IHTG+    C +  C + F+   N L+H ++H K+ 
Sbjct: 77  RRKHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRT 136

Query: 327 A 327
           A
Sbjct: 137 A 137

>Sklu_2351.6 YGL035C, Contig c2351 12964-14610 reverse complement
          Length = 548

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           CP+C +   R      H   HTG+ P  C +  C K F+    + RH + H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>Kwal_47.19045
          Length = 266

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           +C +CGK   R    + H   HTG+ P  C +  C K F+    + RH+++H
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTH 66

>Scas_693.31
          Length = 635

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           P CGK   R    ++H   H  D P+ C + +C+K+F    +++RH K H +K
Sbjct: 494 PNCGKHFKRRYNTRSHIQTHLEDRPYACDFPNCDKAFVRNHDLVRHKKVHSEK 546

>Scas_717.17
          Length = 525

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           C +C K   R S LK H L H+ +  + CPW  C      + N+L+H+K    K     +
Sbjct: 390 CHICSKNFKRRSWLKRHLLSHSSERHYFCPW--CLSRHKRRDNLLQHMKLKHSKN----L 443

Query: 332 INERK 336
           INE K
Sbjct: 444 INELK 448

>Sklu_2389.2 YJL056C, Contig c2389 3525-5828
          Length = 767

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 26/81 (32%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPW--------------------------KS 304
           +CP C K  S    L+ H   H+G+ PF+C +                          K 
Sbjct: 659 KCPHCTKKFSTEDILQQHIRTHSGERPFKCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI 718

Query: 305 CNKSFNVKSNMLRHLKSHQKK 325
           C K FN  SN+ +H+K+H++K
Sbjct: 719 CGKRFNESSNLSKHMKTHERK 739

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 3/51 (5%)

Query: 275 CGKICSRPSTLKTHYL---IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C ++   P  L  H     I  G + ++C W +C+KSF  +  +LRHLK H
Sbjct: 602 CSQVFPNPEALNNHIESQHIPRGQSSYQCSWDTCSKSFTQRQKLLRHLKVH 652

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 274 VCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
            C K  ++   L  H  +H+G  PF+CP   C K F+ +  + +H+++H
Sbjct: 634 TCSKSFTQRQKLLRHLKVHSGYKPFKCP--HCTKKFSTEDILQQHIRTH 680

>Kwal_27.10925
          Length = 264

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           R R  C +C K  +    L  H  IHTG+    CP + C + F+   N ++H K+H ++
Sbjct: 198 RRRYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLRR 256

>YMR070W (MOT3) [4029] chr13 (409153..410625) Transcription factor
           that represses a variety of genes, including ANB1, FUS1,
           and ergosterol biosynthetic genes ERG2, ERG6, and ERG9,
           and activates other genes, including CYC1, LEU2, and
           SUC2, contains two tandem C2H2-type zinc fingers [1473
           bp, 490 aa]
          Length = 490

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 6/66 (9%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTY 330
           QC  C K   R S LK H L H+    F CPW  C      K N+L+H+K         Y
Sbjct: 347 QCQFCEKSFKRKSWLKRHLLSHSQQRHFLCPW--CLSRQKRKDNLLQHMKLKHTN----Y 400

Query: 331 VINERK 336
           +++E K
Sbjct: 401 LLDELK 406

>Kwal_26.8021
          Length = 507

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 243 NDGVVDYLQPPSRSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPW 302
           + G V  L P S       + L   +  +C +C K   R S  K H L H+   P+ CPW
Sbjct: 364 DSGPVALLAPMSNGPF--GMGLVPPVAYRCSMCDKSFKRRSWHKRHLLSHSSFKPYSCPW 421

Query: 303 KSCNKSFNVKSNMLRHLKS 321
             C      + N+ +H+K+
Sbjct: 422 --CQSRHKRRDNLFQHMKT 438

>Kwal_14.2278
          Length = 463

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 23/51 (45%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           CP+C +   R      H   HTG+ P  C +  C K F+    + RH + H
Sbjct: 25  CPICSRAFHRLEHQTRHIRTHTGEKPHACDFAGCTKRFSRSDELTRHKRIH 75

>YMR037C (MSN2) [4001] chr13 complement(344402..346516) Zinc-finger
           transcriptional activator for genes involved in the
           multistress response, has two tandem C2H2-type zinc
           fingers [2115 bp, 704 aa]
          Length = 704

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 272 CPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKG 326
           C +C K   R   LK H   +H+ + PF C    C+K F+   N+ +H+K+H+K G
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKKHG 702

>Sklu_2289.1 YGL254W, Contig c2289 150-1025 reverse complement
          Length = 291

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           CGK+ SRP  L+ H   HT + PF C    C K F   S++  H  SH +
Sbjct: 15  CGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVHKWSHSQ 64

 Score = 37.0 bits (84), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           P CGK   R S LK H   H+   P  CP   C+K F     + RH K+H+
Sbjct: 43  PGCGKGFLRASHLKVHKWSHSQVKPLACP--VCSKGFTTNQQLSRHKKTHK 91

>Scas_670.2
          Length = 435

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           R +KQCP+C    +  +T K  +L+   D P +CP   C + F   ++++RH K H K
Sbjct: 249 RRKKQCPICSGYYANLTTHKATHLV-PEDRPHKCPI--CQRGFGRNNDLIRHQKRHWK 303

>Kwal_27.10167
          Length = 285

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVI 332
           P CGK   R   +  H   H+   P +C  + C+K F  K  + RHL +H+K+ A +  +
Sbjct: 70  PNCGKRFLRVCHMNVHRWTHSKIKPLKC--EECSKGFTTKQQLSRHLATHKKRNAISTAV 127

Query: 333 N 333
           +
Sbjct: 128 S 128

>YDR216W (ADR1) [1053] chr4 (895027..898998) Zinc-finger
           transcription factor involved in regulation of ADH2 and
           peroxisomal genes [3972 bp, 1323 aa]
          Length = 1323

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 13/69 (18%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK----------- 320
           C VC +  +R   LK HY  HT + P+ C    CN+ F  +  ++RH +           
Sbjct: 106 CEVCTRAFARQEHLKRHYRSHTNEKPYPCGL--CNRCFTRRDLLIRHAQKIHSGNLGETI 163

Query: 321 SHQKKGAKT 329
           SH KK ++T
Sbjct: 164 SHTKKVSRT 172

>Scas_627.6
          Length = 1207

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 35/75 (46%), Gaps = 8/75 (10%)

Query: 258 IQKNLNLASRLRKQCP--VCGKICSRPSTLKTHYLIHTGDTPFRCPWK------SCNKSF 309
           +QK+  LA   R  CP   C K  +R   L  H L H     F CP+       +CNK+F
Sbjct: 30  VQKSAKLAVTERYICPHPDCNKSFTRQEHLSRHKLNHWPKEIFVCPFIFPNTNITCNKTF 89

Query: 310 NVKSNMLRHLKSHQK 324
             K  ++RH K H K
Sbjct: 90  VRKDLLIRHQKRHTK 104

>Sklu_2443.22 , Contig c2443 45390-46027
          Length = 213

 Score = 38.5 bits (88), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           CP+C +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 50  CPICTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 94

>KLLA0E10989g 966805..968229 gi|1709030|sp|P50898|MIG1_KLULA
           Kluyveromyces lactis Regulatory protein MIG1, start by
           similarity
          Length = 474

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           CP+C +   R      H   HTG+ P  C +  C+K F+    + RH + H
Sbjct: 28  CPICQRGFHRLEHQTRHIRTHTGERPHACDFPGCSKRFSRSDELTRHRRIH 78

>AER159C [2662] [Homologous to ScYML081W - SH; ScYJR127C (ZMS1) -
           SH] (935544..939119) [3576 bp, 1191 aa]
          Length = 1191

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           CPVC +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 82  CPVCTRGFARQEHLKRHQRSHTNEKPFLCAF--CGRCFARRDLVLRH 126

>CAGL0K02145g 190055..191008 some similarities with sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 317

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 272 CPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C  C +   R   LK H   +H G+ P+ C    CNK F+   N+ +H+K+H
Sbjct: 266 CEFCDRRFKRQEHLKRHIRSLHMGEKPYEC--HICNKKFSRSDNLNQHIKTH 315

>KLLA0E08679g 777005..778795 some similarities with sp|P53968
           Saccharomyces cerevisiae YNL027w CRZ1 calcineurin
           responsive zinc-finger, hypothetical start
          Length = 596

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 4/60 (6%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           C +C K  +RP  LK+H   HT + P+ C    C K+F    +  RH   H   G + YV
Sbjct: 471 CDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLH--TGKRRYV 526

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 29/78 (37%), Gaps = 16/78 (20%)

Query: 263 NLASRLRKQ-------CPVCGKICSRPSTLKTHYLIHTGDTPFRC--------PWKSCNK 307
           NL S LR         C VCGK  +R      H  +HTG   + C         W  C K
Sbjct: 483 NLKSHLRSHTDERPYVCSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSW-GCGK 541

Query: 308 SFNVKSNMLRHLKSHQKK 325
            F     + RH K+   K
Sbjct: 542 KFARSDALGRHFKTELGK 559

>YLR375W (YLR375W) [3755] chr12 (871696..872727) Protein with strong
           similarity to Stp1p, which is involved in tRNA splicing
           and branched-chain amino acid uptake [1032 bp, 343 aa]
          Length = 343

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           R +KQCP+C    +  +T K  +L    D P +CP   C++ F   +++LRH K H K
Sbjct: 139 RKKKQCPICRNFYANLTTHKATHLT-PEDRPHKCPI--CHRGFARNNDLLRHKKRHWK 193

>YBR066C (NRG2) [256] chr2 complement(369998..370660) Suppressor of
           snf mutations, predicted transcription factor with two
           tandem C2H2-type zinc fingers, involved in glucose
           repression of MUC1 transcription [663 bp, 220 aa]
          Length = 220

 Score = 37.4 bits (85), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 4/89 (4%)

Query: 250 LQPPSRSAIQ----KNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSC 305
           +  P+++ I+    K      R R  C +C    +    L  H  IHTG+    CP + C
Sbjct: 129 ISKPTKTVIKLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGC 188

Query: 306 NKSFNVKSNMLRHLKSHQKKGAKTYVINE 334
            + F+   N  +H ++H  K  + +   E
Sbjct: 189 GQRFSRHDNCNQHYRTHANKKKRNWKRRE 217

>Scas_378.1
          Length = 208

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320
           QC +C K   R S LK H L H+    + CP   C      K N+L+HLK
Sbjct: 85  QCHMCVKSFRRHSWLKRHLLAHSSQRHYSCP--KCVSKHKRKDNLLQHLK 132

>Scas_569.2
          Length = 293

 Score = 37.4 bits (85), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 28/61 (45%)

Query: 264 LASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           L  R +  C VC K  +    L  H  IHTG+    C +  C   F+   N ++H ++H 
Sbjct: 222 LEKRRKYICKVCSKGFTTSGHLARHNRIHTGEKKHHCSYPGCYLKFSRHDNCVQHYRTHF 281

Query: 324 K 324
           K
Sbjct: 282 K 282

>CAGL0K09372g complement(924818..926008) similar to sp|P53035
           Saccharomyces cerevisiae YGL209w MIG2 C2H2 zinc-finger
           protein, start by similarity
          Length = 396

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           +C  C +   R    K H   HTG+ P  C +  C KSF+    + RH ++H
Sbjct: 18  KCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

>CAGL0M00594g 70659..73721 similar to sp|P46974 Saccharomyces
           cerevisiae YJR127c ZMS1 or sp|Q04545 Saccharomyces
           cerevisiae YML081w, hypothetical start
          Length = 1020

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLK 320
           CP+C +   R   LK H   HT + PF C    C K F  K  +LRHL+
Sbjct: 29  CPICSRGFVRQEHLKRHQNSHTHEKPFLCL--ICGKCFARKDLVLRHLQ 75

>Scas_602.9
          Length = 547

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 3/52 (5%)

Query: 272 CPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C  C +   R   LK H   +H G+ P+ C    CNK+F+   N+ +H+K+H
Sbjct: 497 CDYCERRFKRQEHLKRHVRSLHIGEKPYACHI--CNKNFSRSDNLTQHIKTH 546

>KLLA0B04477g 400019..404017 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1332

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           CP+C +  +R   L+ H   HT + PF C +  C + F  +  +LRH
Sbjct: 85  CPICTRGFARQEHLRRHERSHTNEKPFLCAF--CGRCFARRDLVLRH 129

>KLLA0B03454g complement(314015..315433) some similarities with
           sp|P39933 Saccharomyces cerevisiae YPR186c TFC2 TFIIIA
           (transcription initiation factor), hypothetical start
          Length = 472

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           +C  CGK  ++ S L  H   HT D PF C    C K    +  + RH  +H K
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRHEITHTK 189

 Score = 35.4 bits (80), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKS-HQKK 325
           C +CGK  +    LK H + HT    F C ++ CN+SF     +  H+ S H+KK
Sbjct: 167 CSICGKGVTTRQQLKRHEITHTK--SFHCSYEGCNESFYKHPQLRSHILSVHEKK 219

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWK--SC-NKSFNVKSNMLRHLKSHQK 324
           CP+CGK C   S L+ H +IH      +  WK  SC + SF  K+ +++H +   K
Sbjct: 281 CPICGKPCVAESGLRNHMMIHDESLVTK-NWKCSSCPDTSFAKKTQLVQHYEESHK 335

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 7/54 (12%)

Query: 272 CPVCGKICSRPSTLKTHYLIH-----TGDTPFRCPWKSCNKSFNVKSNMLRHLK 320
           CP C K   RP  LK H   H     TG   ++C + SC   F+  S++ +H+K
Sbjct: 222 CPHCNKTFQRPYRLKNHIDKHHNPESTG--MYQCDFLSCTDVFSTWSSLQQHIK 273

>YGL254W (FZF1) [1746] chr7 (22304..23203) Transcription factor
           involved in sulfite metabolism, has five C2H2-type zinc
           fingers [900 bp, 299 aa]
          Length = 299

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 2/63 (3%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVI 332
           P CGK   RP  L+ H   H+   P  C    C K F     + RHL SH++K      I
Sbjct: 47  PGCGKKFIRPCHLRVHKWTHSQIKPKACTL--CQKRFVTNQQLRRHLNSHERKSKLASRI 104

Query: 333 NER 335
           + +
Sbjct: 105 DRK 107

 Score = 32.0 bits (71), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVINE 334
           C K+ +RPS L+ H   HT   P+ C    C K F    ++  H  +H +   K   + +
Sbjct: 19  CEKVYNRPSLLQQHQNSHTNQKPYHCDEPGCGKKFIRPCHLRVHKWTHSQIKPKACTLCQ 78

Query: 335 RK 336
           ++
Sbjct: 79  KR 80

>Scas_683.30
          Length = 478

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 266 SRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           +R +KQCP C    +  ST K+ +L    D P +CP   C + F   ++++RH K H K 
Sbjct: 283 TRRKKQCPTCLNYYANLSTHKSTHLT-PEDRPHKCPI--CERGFARNNDLIRHKKRHWKD 339

Query: 326 GAK 328
             K
Sbjct: 340 EFK 342

>YDL048C (STP4) [816] chr4 complement(366739..368211) Protein with
           strong similarity to Stp1p, which is involved in tRNA
           splicing and branched-chain amino acid uptake [1473 bp,
           490 aa]
          Length = 490

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           R +K+CP+C    +  ST K+ +L    D P +CP   C + F   ++++RH K H K
Sbjct: 274 RKKKECPICHNFYANLSTHKSTHLT-PEDRPHKCPI--CQRGFARNNDLIRHKKRHWK 328

>CAGL0H04213g 398544..402509 similar to sp|Q04545 Saccharomyces
           cerevisiae YML081w, start by similarity
          Length = 1321

 Score = 37.0 bits (84), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           CP+C +   R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 35  CPICTRGFVRLEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 79

>AFR580C [3772] [Homologous to ScYGR067C - SH] (1478059..1480575)
           [2517 bp, 838 aa]
          Length = 838

 Score = 37.0 bits (84), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 264 LASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKS 321
           +AS+ +  C  C +  SR      H   HTG  PF C  K CN SF  +  + RH+++
Sbjct: 2   VASQRKYICSFCAQAFSRSEHKTRHERSHTGVKPFSC--KVCNHSFVRRDLLQRHIRT 57

>Kwal_47.17241
          Length = 403

 Score = 36.6 bits (83), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 272 CPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C  C +   R   LK H   +H G+ PF C    C K F+   N+ +H+K+H
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

>Sklu_2206.2 YLR375W, Contig c2206 7136-8212
          Length = 358

 Score = 36.2 bits (82), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           R +K+CPVC    +  ST K+ +L    D P +C    C++ F   +++LRH K H K
Sbjct: 158 RRKKECPVCHNFYANLSTHKSTHLT-PEDRPHKC--SVCSRGFARSNDLLRHKKRHWK 212

>Kwal_47.16621
          Length = 1178

 Score = 36.2 bits (82), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           C +C +  +R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 80  CSICTRGFARQEHLKRHQRAHTNEKPFLCAF--CGRCFARRDLVLRH 124

>CAGL0H07557g 738086..739516 some similarities with sp|P32805
           Saccharomyces cerevisiae YGL254w FZF1, hypothetical
           start
          Length = 476

 Score = 35.8 bits (81), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKT 329
           P CGK   RP  L+ H   H    P +C +  C + F     + RH  +H+++ A +
Sbjct: 92  PNCGKRFLRPCHLRVHKWTHAQVKPLKCSY--CERRFITNQQLKRHTNTHERRIAAS 146

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 8/55 (14%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLR--HLKSHQ 323
           Q   C +  S PS L  H   HT + P+ C   +C K F      LR  HL+ H+
Sbjct: 60  QIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRF------LRPCHLRVHK 108

>Sklu_2359.5 YPR022C, Contig c2359 10655-12818
          Length = 722

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 6/62 (9%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWK------SCNKSFNVKSNMLRHLKSHQKKG 326
           P C K  +R   L  H L H     FRC +       +CN++F  +  ++RH K H + G
Sbjct: 21  PNCSKSFTRQEHLSRHKLNHWPKEIFRCHYVYPEDGVACNRTFVRRDLLVRHEKRHSRSG 80

Query: 327 AK 328
           ++
Sbjct: 81  SR 82

>Sklu_2181.1 YER130C, Contig c2181 4015-5247
          Length = 410

 Score = 35.4 bits (80), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 272 CPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C  C +   R   LK H   +H G+ P+ C  + C K F+   N+ +H+K+H
Sbjct: 356 CEFCDRRFKRQEHLKRHVRSLHMGEKPYGC--EICGKKFSRSDNLNQHIKTH 405

>Scas_721.92
          Length = 1152

 Score = 35.8 bits (81), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 3/68 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHL-KSHQKKGAKTY 330
           C VC +  +R   L  H   HT + P++C    C K F  +  +LRH  K H     +T 
Sbjct: 80  CDVCSRAFARQEHLDRHARSHTNEKPYQCGI--CTKKFTRRDLLLRHAQKVHNGNCGETI 137

Query: 331 VINERKPT 338
              +R+ T
Sbjct: 138 QRKKRQKT 145

>YER130C (YER130C) [1560] chr5 complement(421111..422442) Protein
           with two tandem zinc finger domains [1332 bp, 443 aa]
          Length = 443

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 272 CPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C  C +   R   LK H   +H  + PF C    CNK+F+   N+ +H+K+H
Sbjct: 391 CEFCDRRFKRQEHLKRHVRSLHMCEKPFTCHI--CNKNFSRSDNLNQHVKTH 440

>Scas_703.23
          Length = 1341

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           CP C +   R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 74  CPTCTRGFVRQEHLKRHQRSHTNEKPFLCVF--CGRCFARRDLVLRH 118

>CAGL0H04873g complement(465069..466424) some similarities with
           tr|Q05937 Saccharomyces cerevisiae YLR375w STP3 or
           tr|Q07351 Saccharomyces cerevisiae YDL048c STP4,
           hypothetical start
          Length = 451

 Score = 35.4 bits (80), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHT--GDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           R RKQCP+C       + L TH  IH      PF C    C + F  +++++RH K H K
Sbjct: 261 RRRKQCPICHGFF---ANLTTHKAIHLEPDIKPFVC--SVCQRGFVRQNDVMRHEKMHWK 315

>YPL230W (YPL230W) [5219] chr16 (115312..116487) Putative
           transcription factor that contains two tandem C2H2-type
           zinc fingers [1176 bp, 391 aa]
          Length = 391

 Score = 35.0 bits (79), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKS-HQKKGAKTYVIN 333
           C    +R   L  H   HTG+ PF+CP  +C K F+   N+ +H +S H  K   +   +
Sbjct: 49  CTMSFTRAEHLARHIRKHTGEKPFQCP--ACLKFFSRVDNLKQHRESVHAHKNHHSTSSH 106

Query: 334 ERKP 337
           +RKP
Sbjct: 107 QRKP 110

>Kwal_26.9300
          Length = 304

 Score = 34.7 bits (78), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           R +K+CP+C    +  ST ++ +L    + P +CP   C + F   +++LRH K H K
Sbjct: 143 RRKKECPICHNFYANLSTHRSSHL-QPENKPHKCP--VCGRGFTRHNDLLRHRKRHWK 197

>KLLA0E13519g complement(1190615..1191307) some similarities with
           sgd|S0006226 Saccharomyces cerevisiae YPR022c,
           hypothetical start
          Length = 230

 Score = 34.3 bits (77), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 6/70 (8%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWK------SCNKSFNVKSNMLRHLKSHQKKG 326
           P C K  SR   L+ H L H     FRC +        CN++F  K  ++RH + H   G
Sbjct: 23  PDCEKTFSRYEHLQRHKLNHWPKQIFRCEYVYPDDGIVCNRTFVRKDLLVRHQRRHTNNG 82

Query: 327 AKTYVINERK 336
            +  +   R+
Sbjct: 83  VRMQMKVRRE 92

>ACL057W [992] [Homologous to ScYER130C - SH]
           complement(264934..266496) [1563 bp, 520 aa]
          Length = 520

 Score = 35.0 bits (79), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 272 CPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C  C +   R   LK H   +H G+ P+ C    C K F+   N+ +H+K+H
Sbjct: 462 CEYCERRFKRQEHLKRHIRSLHMGEKPYGC--DICGKKFSRSDNLNQHIKTH 511

>Scas_683.25
          Length = 879

 Score = 35.0 bits (79), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 269 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNM-LRHLKSHQKK 325
           R  C  C K  SR      H   HTG  P++C  K C   F V+S++ LRH+K+  KK
Sbjct: 14  RFICSFCAKGFSRAEHKIRHERSHTGLKPYKC--KVCTHCF-VRSDLALRHIKTVHKK 68

>YPR022C (YPR022C) [5456] chr16 complement(603906..607307) Predicted
           transcription factor with two tandem C2H2-type zinc
           fingers, contains Q/N-rich regions which may mediate
           prion-like aggregation [3402 bp, 1133 aa]
          Length = 1133

 Score = 34.7 bits (78), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 28/66 (42%), Gaps = 6/66 (9%)

Query: 265 ASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPW------KSCNKSFNVKSNMLRH 318
           A R R   P C K  SR   L  H L H     + C +        CNK+F  K  ++RH
Sbjct: 28  AERFRCPHPECNKTFSRQEHLSRHKLNHWPKEIYVCSYVLPTTNAPCNKTFVRKDLLIRH 87

Query: 319 LKSHQK 324
            K H K
Sbjct: 88  EKRHSK 93

 Score = 29.6 bits (65), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 298 FRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVINERKPT 338
           FRCP   CNK+F+ + ++ RH  +H  K  + YV +   PT
Sbjct: 31  FRCPHPECNKTFSRQEHLSRHKLNHWPK--EIYVCSYVLPT 69

>CAGL0K04697g 458366..459913 some similarities with tr|Q07351
           Saccharomyces cerevisiae YDL048c STP4 or tr|Q05937
           Saccharomyces cerevisiae YLR375w STP3, hypothetical
           start
          Length = 515

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 266 SRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           ++ ++QCP+C K  +  ST K+ +L  + D P +C    C   F   ++++RH K H K
Sbjct: 320 TKKKRQCPICHKYFANLSTHKSTHLT-SQDRPHKCII--CQSGFARNNDLIRHRKRHWK 375

>YPR186C (PZF1) [5600] chr16 complement(909727..911016) RNA
           polymerase III transcription initiation factor TFIIIA,
           has nine C2H2-type zinc fingers [1290 bp, 429 aa]
          Length = 429

 Score = 34.3 bits (77), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 35/82 (42%), Gaps = 4/82 (4%)

Query: 244 DGVVDYLQPPSRSAIQKNLNLASRLRK-QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPW 302
           DG       PS    +  L++   LR  QC  C K   + S L+ H   H+   PF+C +
Sbjct: 54  DGCDKAFTRPS-ILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY 112

Query: 303 KSCNKSFNVKSNMLRHLKSHQK 324
             C K    +  + RH  +H K
Sbjct: 113 --CGKGVTTRQQLKRHEVTHTK 132

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 9/77 (11%)

Query: 249 YLQPPSRSAIQKNLNLASRLRK-QCPVCGKICSRPSTLKTHYLIHTG---DTPFRCPWKS 304
           Y  P  R+ I     L+  L K  CP C K   RP  L+ H   H     + P++C +  
Sbjct: 146 YKHPQLRAHI-----LSVHLHKLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAG 200

Query: 305 CNKSFNVKSNMLRHLKS 321
           C K F + S +  H+K+
Sbjct: 201 CCKEFRIWSQLQSHIKN 217

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 11/47 (23%), Positives = 26/47 (55%)

Query: 290 LIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVINERK 336
           L++T    +RC + +C+++F  K    +H+  H+    K  ++ E++
Sbjct: 357 LLNTVGRKYRCFYNNCSRTFKTKEKYEKHIDKHKVHELKLKILQEKE 403

 Score = 29.6 bits (65), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 4/54 (7%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKS--C-NKSFNVKSNMLRHLKS 321
           +CP+C K C   + L+ H +IH  D+     WK   C + SF+ K ++L H  S
Sbjct: 223 KCPICSKPCVGENGLQMHMIIH-DDSLVTKNWKCHICPDMSFSRKHDLLTHYGS 275

>KLLA0B07909g 697885..700653 some similarities with sp|P53243
           Saccharomyces cerevisiae YGR067c singleton, hypothetical
           start
          Length = 922

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 264 LASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           +AS+ +  C  C K  SR      H   HTG  PF C    C+ SF  +  + RH+++  
Sbjct: 2   VASQRKYICSFCAKPFSRSEHKARHERSHTGSKPFSC--SICSHSFVRRDLLQRHIRTVH 59

Query: 324 KKGAKTYV 331
           K    + +
Sbjct: 60  KSSLNSML 67

>Kwal_55.20634
          Length = 419

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 8/79 (10%)

Query: 259 QKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           QKNL L  R  K    C     +   + +H  +H    PF C   +C K+F    ++ +H
Sbjct: 87  QKNLQLNCRWGK----CTAKTVKRDHITSHLRVHVPLKPFAC--STCTKTFKRPQDLKKH 140

Query: 319 LKSHQKKGAKTYVINERKP 337
           LK H +   +T V   R P
Sbjct: 141 LKVHLED--ETIVRRRRGP 157

>AEL278W [2227] [Homologous to ScYPR186C (PZF1) - SH]
           complement(117043..118473) [1431 bp, 476 aa]
          Length = 476

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           QC  CG+  ++ S L+ H   H+   PF C    C K    +  + RH  +H K
Sbjct: 151 QCEQCGRGFTKKSHLERHLFSHSETKPFSCT--VCGKGVTTRQQLRRHEITHTK 202

>Scas_707.31
          Length = 289

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 272 CPVCGKICSRPSTLKTHY-LIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKK 325
           C +C K   R   LK H+  IH    PF C    C+K F+   N+ +H++ H+++
Sbjct: 225 CHLCKKRFKRHEHLKRHFRTIHLRVRPFEC--SVCHKRFSRNDNLNQHVRIHEQQ 277

>CAGL0L06072g complement(679924..680826) some similarities with
           sp|P39959 Saccharomyces cerevisiae YER130c or sp|P33749
           Saccharomyces cerevisiae YKL062w MSN4 transcriptional
           activator, hypothetical start
          Length = 300

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 271 QCPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           +C +C +   R   LK H   +H G+ P+ C    C KSF+   N+ +H ++H
Sbjct: 219 KCDMCERRFKRQEHLKRHVSSLHMGERPYSCDI--CLKSFSRSDNLNQHKRTH 269

>YML081W (YML081W) [3888] chr13 (104777..108532) Protein with
           similarity to Zms1p and Adr1p, has two tandem C2H2-type
           zinc fingers [3756 bp, 1251 aa]
          Length = 1251

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           C +C +   R   LK H   HT + PF C +  C + F  +  +LRH
Sbjct: 63  CHICTRGFVRQEHLKRHQRAHTNEKPFLCVF--CGRCFARRDLVLRH 107

>Scas_631.7
          Length = 433

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 12/46 (26%), Positives = 28/46 (60%)

Query: 290 LIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVINER 335
           L++T    FRCP+ +C+++F ++    +H++ H+    K  ++ E+
Sbjct: 363 LLNTVGRKFRCPFLNCSRTFKLEERYKKHIEKHKIHQLKMKILEEK 408

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 35/76 (46%), Gaps = 9/76 (11%)

Query: 249 YLQPPSRSAIQKNLNLASRLRK-QCPVCGKICSRPSTLKTHYLIHTG---DTPFRCPWKS 304
           Y  P  RS I     L+  L K  C  CGK   RP  L+ H   H      TP++C + +
Sbjct: 154 YKHPQLRSHI-----LSFHLEKLTCKHCGKKFQRPYRLQNHIAKHHNPDVKTPYQCTFAN 208

Query: 305 CNKSFNVKSNMLRHLK 320
           C++SF   +    H+K
Sbjct: 209 CHRSFRTWTLYQSHVK 224

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           +C  C K  SR + L+ H + H+   PF C    C K    +  + RH  +H K
Sbjct: 89  KCEQCDKQFSRKTHLERHLISHSDSKPFCCL--HCGKGVTTRQQLKRHEVTHTK 140

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 2/38 (5%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSF 309
           C  CGK  +    LK H + HT    F+CP+++C++++
Sbjct: 118 CLHCGKGVTTRQQLKRHEVTHTK--SFKCPYENCDEAY 153

>KLLA0C17072g 1494101..1495525 weakly similar to sp|P39959
           Saccharomyces cerevisiae YER130c, hypothetical start
          Length = 474

 Score = 32.3 bits (72), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 272 CPVCGKICSRPSTLKTHYL-IHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSH 322
           C  C +   R   LK H   +H  + P+ C    C K F+   N+ +HLK+H
Sbjct: 420 CEYCDRRFKRQEHLKRHIRSLHICEKPYGCHL--CGKKFSRSDNLSQHLKTH 469

>CAGL0K02343g 208645..212133 similar to tr|Q12139 Saccharomyces
           cerevisiae YPR022c, hypothetical start
          Length = 1162

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 29/65 (44%), Gaps = 8/65 (12%)

Query: 269 RKQCP--VCGKICSRPSTLKTHYLIHTGDTPFRCPWKS------CNKSFNVKSNMLRHLK 320
           R +CP   C K  SR   L  H L H     F+C + S      C K+F  +  + RH K
Sbjct: 44  RYKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHEK 103

Query: 321 SHQKK 325
            H+ K
Sbjct: 104 RHENK 108

>YJR127C (ZMS1) [3019] chr10 complement(658832..662974) Protein with
           similarity to Adr1p and Yml081p, has two tandem zinc
           finger domains [4143 bp, 1380 aa]
          Length = 1380

 Score = 32.0 bits (71), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           CP C +   R   LK H   HT + P+ C +  C + F  +  +LRH
Sbjct: 153 CPTCTRGFVRQEHLKRHQHSHTREKPYLCIF--CGRCFARRDLVLRH 197

>KLLA0F13046g 1201353..1205492 some similarities with sp|P07248
           Saccharomyces cerevisiae YDR216w ADR1 zinc-finger
           transcription factor, hypothetical start
          Length = 1379

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           C VC +  +R   L  H   HT + P+ C    C + F  +  ++RH +         Y+
Sbjct: 127 CKVCTRAFARQEHLTRHERSHTKEKPYVCGI--CERRFTRRDLLIRHCQKLHGGNCGDYI 184

>CAGL0K04631g complement(440721..443762) some similarities with
           sp|P53243 Saccharomyces cerevisiae YGR067c, hypothetical
           start
          Length = 1013

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 2/53 (3%)

Query: 269 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKS 321
           R  C  C K  SR      H   H G  PF C  + C+ SF  +  + RH+++
Sbjct: 11  RHFCSFCNKAFSRSEHKTRHERSHAGVKPFEC--QVCSHSFVRRDLLQRHIRT 61

>KLLA0E00726g 80516..82069 gi|5531271|emb|CAB50896.1 Kluyveromyces
           lactis RIM101 homologue, start by similarity
          Length = 517

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 6/67 (8%)

Query: 259 QKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           QKNL    +L  Q   C     +   + +H  +H    PF C   +CNK F    ++ +H
Sbjct: 142 QKNL----QLNCQWGDCQTKTVKRDHITSHLRVHVQLKPFAC--STCNKKFKRPQDLKKH 195

Query: 319 LKSHQKK 325
           LK H ++
Sbjct: 196 LKVHNEE 202

>Scas_719.68
          Length = 1350

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 6/47 (12%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           CP    IC+R   LK H   HT + PF C +  C + F  +  +LR+
Sbjct: 43  CP----ICTRTEHLKRHQRSHTREKPFVCVF--CGRCFARRDLVLRY 83

>CAGL0E03762g complement(351003..352757) weakly similar to sp|P33400
           Saccharomyces cerevisiae YHL027w RIM101 meiotic
           regulatory protein, hypothetical start
          Length = 584

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 6/64 (9%)

Query: 259 QKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           QKNL    +L+ Q   C     +   + +H  +H    PF C   +C+K F    ++ +H
Sbjct: 184 QKNL----QLKCQWDNCTSKTEKRDHMTSHLRVHVPLKPFAC--STCSKRFKRPQDLKKH 237

Query: 319 LKSH 322
           LK H
Sbjct: 238 LKIH 241

>CAGL0E06116g complement(604708..606549) some similarities with
           tr|Q12132 Saccharomyces cerevisiae YPL230w USV1,
           hypothetical start
          Length = 613

 Score = 30.8 bits (68), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRH 318
           P C    SR   L  H   HTG+ PF+C    C K F+   N+ +H
Sbjct: 31  PGCEMSFSRAEHLARHIRRHTGEKPFKCDI--CLKYFSRIDNLKQH 74

>CAGL0G10021g complement(959154..960338) similar to sp|P39933
           Saccharomyces cerevisiae YPR186c TFC2, hypothetical
           start
          Length = 394

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 2/38 (5%)

Query: 272 CPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSF 309
           C  CGK       LK H + HT    F C ++ CN+SF
Sbjct: 97  CSFCGKGLITRQQLKRHEVTHTK--SFNCEYEGCNESF 132

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 4/68 (5%)

Query: 271 QCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKS--CN-KSFNVKSNMLRHLKSHQKKGA 327
           +CP+C K C     L  H  IH  +   R  WK   CN +SF  K  +L H  +   +  
Sbjct: 210 KCPICSKPCVGEDGLNMHMKIHDENLVSR-NWKCHICNDQSFAKKLELLDHYSNSHSEEI 268

Query: 328 KTYVINER 335
             Y++ ++
Sbjct: 269 PAYLLEQK 276

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 19/34 (55%)

Query: 290 LIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQ 323
           L++T    FRCP+  C +SF  +     H++ H+
Sbjct: 328 LLNTVGRKFRCPYSKCYRSFKTEEKYNIHIEKHR 361

>Sklu_2126.5 YHL027W, Contig c2126 7763-9109
          Length = 448

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 42/103 (40%), Gaps = 12/103 (11%)

Query: 235 FPNYNILMNDGVVDYLQPPSRSAIQKNLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTG 294
           FP   +L +    D++   S+  +Q N N  +        C     +   + +H  +H  
Sbjct: 63  FPQPELLYHHLCNDHVGRKSQKNLQLNCNWGN--------CNTKTVKRDHITSHLRVHVP 114

Query: 295 DTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYVINERKP 337
             PF C   +C K F    ++ +HL+ H   G  T +  +R P
Sbjct: 115 LKPFGC--STCGKKFKRPQDLKKHLRVHLDDG--TTIKRKRGP 153

>Kwal_47.16577
          Length = 881

 Score = 30.0 bits (66), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 294 GDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAK 328
           G  PF CP+  C+KSF+   ++ RH  +H  +  K
Sbjct: 9   GSGPFFCPFPGCSKSFSRSDHLGRHKANHSSEKYK 43

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 1/57 (1%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKT 329
           P C K  SR   L  H   H+ +  ++C W +C + F+      +H   H +   +T
Sbjct: 18  PGCSKSFSRSDHLGRHKANHSSEK-YKCEWPACGREFSRLDVKKKHFGRHLRDVDET 73

>YMR182C (RGM1) [4137] chr13 complement(624531..625166)
           Transcriptional repressor, has strong similarity to
           mammalian EGR (early growth response) factor, contains
           two tandem C2H2-type zinc fingers [636 bp, 211 aa]
          Length = 211

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 23/49 (46%), Gaps = 2/49 (4%)

Query: 273 PVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKS 321
           P C    +R   L  H   HTG+ PF+C    C K F+   N+ +H  S
Sbjct: 25  PDCNMSFNRTEHLARHIRKHTGEKPFQC--NICLKFFSRIDNLRQHQSS 71

>AFR588W [3780] [Homologous to ScYLR375W (STP3) - SH; ScYDL048C
           (STP4) - SH] complement(1496510..1497469) [960 bp, 319
           aa]
          Length = 319

 Score = 29.6 bits (65), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 267 RLRKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQK 324
           R +K+CPVC    +  ST K+ +L      P +C    C++ F   +++ RH K H K
Sbjct: 124 RKKKECPVCHNFYANLSTHKSTHLDPEA-RPHKCDI--CSRGFARSNDLQRHKKRHWK 178

>Sklu_1884.2 YDR242W, Contig c1884 1484-3124 reverse complement
          Length = 546

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 47/101 (46%), Gaps = 14/101 (13%)

Query: 244 DGVVDYLQPPSRSAIQK----NLNLASRLRKQCPVCGKICSRPSTLKTHYLIHTGD-TPF 298
           D V+D       + IQK     + L+  + K CP    + +  + LK H  +HTG+ T +
Sbjct: 21  DWVID------ETTIQKLREVKVGLSEEIDKLCPESENLVTHSTILKLHSSVHTGELTCY 74

Query: 299 RCPWKSCNKSFNVKS--NMLRHLKSHQKKGAKTYVINERKP 337
           +  +  C+++  +    N L  +   +    +  +++ERKP
Sbjct: 75  QVVYSFCHRAALIHQVVNCLSEIMFTEAL-ERAKLLDERKP 114

>YHL027W (RIM101) [2259] chr8 (51109..52986) Transcription factor
           involved in induction of IME1, IME2, DIT1, and DIT2
           transcription, has three C2H2-type zinc fingers [1878
           bp, 625 aa]
          Length = 625

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%)

Query: 285 LKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGA 327
           + +H  +H    PF C   +C+K F    ++ +HLK H + G 
Sbjct: 199 ITSHLRVHVPLKPFGC--STCSKKFKRPQDLKKHLKIHLESGG 239

>Scas_720.33
          Length = 316

 Score = 28.1 bits (61), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 2/57 (3%)

Query: 275 CGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAKTYV 331
           C    +R   L  H   HTG+ PF+C    C + F+   N+ +H  +   K    +V
Sbjct: 23  CHMTFTREEHLARHIRKHTGEKPFQCYI--CFRFFSRMDNLKQHRDTVHGKSNNRFV 77

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,786,167
Number of extensions: 359407
Number of successful extensions: 1396
Number of sequences better than 10.0: 172
Number of HSP's gapped: 1292
Number of HSP's successfully gapped: 249
Length of query: 338
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 236
Effective length of database: 13,065,073
Effective search space: 3083357228
Effective search space used: 3083357228
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 62 (28.5 bits)