Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_707.45d45545523840.0
Kwal_14.2186465129701.2
YDR446W (ECM11)30296663.3
CAGL0M09999g312496665.7
Scas_513.41045105649.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_707.45d
         (455 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_707.45d                                                          922   0.0  
Kwal_14.2186                                                           32   1.2  
YDR446W (ECM11) [1265] chr4 (1353713..1354621) Protein possibly ...    30   3.3  
CAGL0M09999g 987540..996914 similar to sp|P18963 Saccharomyces c...    30   5.7  
Scas_513.4                                                             29   9.2  

>Scas_707.45d
          Length = 455

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/455 (100%), Positives = 455/455 (100%)

Query: 1   MYSPQGTDRNTSTIDVSEGLKPFDPVLAEERSAPALEFQASGSCNYDEHSLGDSILELST 60
           MYSPQGTDRNTSTIDVSEGLKPFDPVLAEERSAPALEFQASGSCNYDEHSLGDSILELST
Sbjct: 1   MYSPQGTDRNTSTIDVSEGLKPFDPVLAEERSAPALEFQASGSCNYDEHSLGDSILELST 60

Query: 61  EFSSVAEDESQKKINHLKALLQEKNRQILELQRFNSEKKELEREYQQKIELLNKTLVVED 120
           EFSSVAEDESQKKINHLKALLQEKNRQILELQRFNSEKKELEREYQQKIELLNKTLVVED
Sbjct: 61  EFSSVAEDESQKKINHLKALLQEKNRQILELQRFNSEKKELEREYQQKIELLNKTLVVED 120

Query: 121 VSLKESVIRITKSKCESEEENQLYNTSKEKLKFWKTNDNYDSVDKNYYLMTTLFLPFLKN 180
           VSLKESVIRITKSKCESEEENQLYNTSKEKLKFWKTNDNYDSVDKNYYLMTTLFLPFLKN
Sbjct: 121 VSLKESVIRITKSKCESEEENQLYNTSKEKLKFWKTNDNYDSVDKNYYLMTTLFLPFLKN 180

Query: 181 SIRNIQNCKLLTRDAENLLNKLESIQVENNSKIDNYNEFGTLFNDFFHLLRYQTSLLNEE 240
           SIRNIQNCKLLTRDAENLLNKLESIQVENNSKIDNYNEFGTLFNDFFHLLRYQTSLLNEE
Sbjct: 181 SIRNIQNCKLLTRDAENLLNKLESIQVENNSKIDNYNEFGTLFNDFFHLLRYQTSLLNEE 240

Query: 241 LFKDNDIRKIQELLGPLFAPDILARLSSSNFSLLQKEIRNLLFKYIKTNSNVEEEQSPST 300
           LFKDNDIRKIQELLGPLFAPDILARLSSSNFSLLQKEIRNLLFKYIKTNSNVEEEQSPST
Sbjct: 241 LFKDNDIRKIQELLGPLFAPDILARLSSSNFSLLQKEIRNLLFKYIKTNSNVEEEQSPST 300

Query: 301 SLPQNLSQNNKHGLYQECVPRLAAKNFFKAKTQSSLEDKGSITREPPFLQSPRKSVHEID 360
           SLPQNLSQNNKHGLYQECVPRLAAKNFFKAKTQSSLEDKGSITREPPFLQSPRKSVHEID
Sbjct: 301 SLPQNLSQNNKHGLYQECVPRLAAKNFFKAKTQSSLEDKGSITREPPFLQSPRKSVHEID 360

Query: 361 SDYNDPFDGISTSSKAKEKITHYLHNRHYEFTPIGYKTSKYYRTPRRFLDTAEFCNIVSP 420
           SDYNDPFDGISTSSKAKEKITHYLHNRHYEFTPIGYKTSKYYRTPRRFLDTAEFCNIVSP
Sbjct: 361 SDYNDPFDGISTSSKAKEKITHYLHNRHYEFTPIGYKTSKYYRTPRRFLDTAEFCNIVSP 420

Query: 421 ASPKKNEKRKLCNKVESEEYDDNNNLPEFLLQTNT 455
           ASPKKNEKRKLCNKVESEEYDDNNNLPEFLLQTNT
Sbjct: 421 ASPKKNEKRKLCNKVESEEYDDNNNLPEFLLQTNT 455

>Kwal_14.2186
          Length = 465

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 7/129 (5%)

Query: 165 KNYYLMTTLFLPFLKNSIRNIQNCKLLTRDAENLLNKLESIQ----VENNSKIDNYNEFG 220
           +N+       +PFL+ SI   Q+  +   DA+ L  KLE+ +     + +SK+    E  
Sbjct: 164 RNHKFFKNSVVPFLQKSIDTFQHSDIFGDDAKTLGRKLEAFKNCGAKDKDSKVQLMVE-- 221

Query: 221 TLFNDFFHLLRYQTSLLNEELFKDNDIRKIQELLGPLFAPDILARLSSSNFSLLQKEIRN 280
            + +   HL +   ++LN EL       +++ L      P+    L   +   L++E+  
Sbjct: 222 -ILDGLNHLQQQCVAVLNRELQSKKISSQLEFLFTIFLDPEQYGLLRQDHIKKLRQEMLE 280

Query: 281 LLFKYIKTN 289
           ++ +    N
Sbjct: 281 IMLEIWDHN 289

>YDR446W (ECM11) [1265] chr4 (1353713..1354621) Protein possibly
           involved in cell wall structure or biosynthesis [909 bp,
           302 aa]
          Length = 302

 Score = 30.0 bits (66), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 312 HGLYQECVPRLAAKNFFKAKTQSSLEDKGSITR-EPPFLQSPRK---SVHEIDS-DYNDP 366
           H  +Q   P ++ K   K K  S   D   ++R E P++Q   K   SV EI+S +Y   
Sbjct: 104 HTAFQPLTP-ISKKRALKEKAASEKCDSFDLSRDEKPYIQKKSKTLSSVTEINSSEYKLS 162

Query: 367 FDGISTSSKAKEKITHYLHNRHYEFTPIGYKTSKYY 402
            +G +TSS AKEK    + N      P  Y+ ++ Y
Sbjct: 163 LNGENTSSPAKEKSQEPIEN------PGSYQKTRNY 192

>CAGL0M09999g 987540..996914 similar to sp|P18963 Saccharomyces
            cerevisiae YBR140c IRA1 or sp|P19158 Saccharomyces
            cerevisiae YOL081w IRA2, hypothetical start
          Length = 3124

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 44/96 (45%), Gaps = 14/96 (14%)

Query: 127  VIRITKSKCESEE---ENQLYNTSKEKLKFWKTND-------NYDSVDKNYYLMTTLFLP 176
            +I IT  K E+E    +  +Y T +   K W T           DS+D NY  +T+LF  
Sbjct: 2092 IITITFRKFEAENIEVDAIVYRTIQVYSKMWMTKHYLVLDCTGSDSIDMNYNKLTSLFFS 2151

Query: 177  FLKNSIRNIQNC--KLLTRDAENLLNKLESIQVENN 210
             L +    I+NC   +    +EN +N+  ++   +N
Sbjct: 2152 LLPDI--AIENCIGAIYFNVSENFMNQWVNVLRGDN 2185

>Scas_513.4
          Length = 1045

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 15/105 (14%)

Query: 65  VAEDESQKKINHLKALLQEKNRQILELQRFNSEKKELEREYQQKIELLNKTLV--VEDVS 122
           V +  ++K   HL   LQE + +I  ++ F    K L   +  K   L  +L+  + D+S
Sbjct: 902 VKQSGTEKGKFHLIQFLQENSTRIGLIEVF----KILPNSFCLKD--LGPSLLQTIRDLS 955

Query: 123 LKESVIRITKSKCESEEENQLYNTSKEKLKFWKTNDNYDSVDKNY 167
           +K+  +RITKS  + E  +  Y       K W+   +Y ++D+NY
Sbjct: 956 IKKDEVRITKSLLQVEVVDNNY-------KMWQKLSDYMTLDENY 993

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.312    0.130    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,513,186
Number of extensions: 799106
Number of successful extensions: 3856
Number of sequences better than 10.0: 279
Number of HSP's gapped: 3760
Number of HSP's successfully gapped: 333
Length of query: 455
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 350
Effective length of database: 12,961,219
Effective search space: 4536426650
Effective search space used: 4536426650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)