Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_705.2355355326980.0
CAGL0B04147g56653421260.0
Scas_716.3357349621140.0
YGR092W (DBF2)57249621040.0
CAGL0G03047g53949420700.0
Kwal_23.399257148920130.0
ADR033W57749720040.0
KLLA0D14905g56752619680.0
AFR035W7194825552e-62
Kwal_33.145547144845524e-62
YNL161W (CBK1)7564765492e-61
KLLA0D07810g7184905447e-61
CAGL0J06072g7734775404e-60
Scas_654.127374915291e-58
YMR104C (YPK2)6773534055e-42
CAGL0C03509g8952944078e-42
YNR047W8933774015e-41
YCR091W (KIN82)7203503977e-41
Scas_720.1038042843952e-40
Scas_629.169183543935e-40
KLLA0C18568g7743283916e-40
Kwal_23.64588683083926e-40
ADR167W8733023882e-39
Kwal_47.167617443813853e-39
CAGL0K07458g7043793826e-39
ABL028W7223953828e-39
KLLA0B07205g4553443738e-39
Scas_651.183713023679e-39
CAGL0K03399g7033963801e-38
YJL164C (TPK1)3973623645e-38
Scas_689.25*4093023621e-37
Scas_703.57493993741e-37
YHR205W (SCH9)8243903731e-37
KLLA0B03586g7344393721e-37
YKL126W (YPK1)6803803712e-37
AEL115C3864023592e-37
KLLA0B12716g7163953702e-37
Scas_721.1246843963676e-37
CAGL0F09075g7464403669e-37
CAGL0G09020g3613643521e-36
Kwal_26.76356913753632e-36
YKL166C (TPK3)3982983522e-36
KLLA0D03190g3723763503e-36
ADL389W7113893623e-36
AFL090W3463023448e-36
Kwal_56.240593533823459e-36
Kwal_33.138463753023461e-35
Scas_717.696743963561e-35
CAGL0M08404g4623153482e-35
Scas_690.133543023291e-33
CAGL0B04301g5422433231e-31
YBR028C5252153221e-31
Kwal_56.227885151963202e-31
Scas_593.14d4952493122e-30
KLLA0F24618g5562153142e-30
YOL100W (PKH2)10813473163e-30
KLLA0E06413g11613333111e-29
YDR490C (PKH1)7663203092e-29
AFR377C7262473082e-29
YDR466W (PKH3)8982623083e-29
Scas_715.3411503333084e-29
YBL105C (PKC1)11513333031e-28
CAGL0M09361g11443333022e-28
Scas_660.209572972994e-28
Kwal_27.1058111543722978e-28
ACR191C11493642951e-27
AEL083W5361972911e-27
Kwal_56.226939843382898e-27
YMR001C (CDC5)7053432781e-25
CAGL0K06479g9912462763e-25
KLLA0C12485g9252472701e-24
CAGL0I07513g10761942702e-24
YFL033C (RIM15)17701582693e-24
KLLA0E03487g6472512655e-24
CAGL0K12562g16821652613e-23
KLLA0F09020g9282012577e-23
CAGL0G04609g9652752569e-23
Kwal_47.183076212692541e-22
AFR335C10332732551e-22
Scas_707.315981872552e-22
ACR218W15691522497e-22
KLLA0F11143g8132152452e-21
Kwal_56.240913813052392e-21
Scas_502.211162552452e-21
Kwal_14.115915211692426e-21
ACL006W7082352372e-20
Kwal_26.87967962672372e-20
Kwal_56.224766972092362e-20
ACR142W8372652336e-20
KLLA0B02332g3613012259e-20
Scas_700.546982982254e-19
AFL101C3672582196e-19
CAGL0J11638g7462092237e-19
KLLA0C01650g11122382212e-18
KLLA0C06138g7082502192e-18
CAGL0K08514g14892362175e-18
KLLA0F09031g6331432156e-18
Scas_627.73492522106e-18
Scas_493.211172472151e-17
CAGL0M02233g7672872131e-17
AFR696C11422372132e-17
Scas_616.1014612322132e-17
YDR507C (GIN4)11422382122e-17
CAGL0K05709g11032382122e-17
Kwal_55.215458652202112e-17
Scas_644.157262072103e-17
YCL024W (KCC4)10372322086e-17
CAGL0I09504g5281702058e-17
CAGL0M03729g8612022069e-17
CAGL0E05720g3583032011e-16
YCR073C (SSK22)13311662007e-16
Scas_700.288962431997e-16
CAGL0M02519g7561811998e-16
YNR031C (SSK2)15791711998e-16
CAGL0L11550g10721721999e-16
AER264C14831651999e-16
YNL298W (CLA4)8422021989e-16
ABL034W14252321981e-15
YKL101W (HSL1)15182431981e-15
YBR274W (CHK1)5271831951e-15
Kwal_23.52908192021962e-15
YOL113W (SKM1)6552041952e-15
KLLA0F11319g8431771952e-15
KLLA0F13552g12672321962e-15
KLLA0C04191g7972221952e-15
CAGL0M08910g6122501933e-15
YHR102W (KIC1)10801771943e-15
YGL158W (RCK1)5121761914e-15
KLLA0A07403g8792021934e-15
Scas_675.25271951915e-15
CAGL0C05005g10761941925e-15
Scas_580.610151771926e-15
AAL029W5342761907e-15
AFR724C4402511888e-15
YHL007C (STE20)9391941909e-15
AEL205W7932021901e-14
Scas_668.228931941901e-14
AEL185C5152341881e-14
YDR477W (SNF1)6332481891e-14
ABR014W9711941891e-14
Kwal_23.632515421661901e-14
Scas_660.286232561881e-14
Scas_598.67902021891e-14
CAGL0K02673g9151941882e-14
Kwal_47.182335983261872e-14
Scas_720.9416832351892e-14
Kwal_26.778812672461882e-14
ACL104C9471711872e-14
Kwal_26.87518482511872e-14
KLLA0E21780g10161671872e-14
Scas_618.156201991853e-14
KLLA0F12188g5462661843e-14
KLLA0C08525g15511651864e-14
CAGL0M02299g8931811854e-14
YOR233W (KIN4)8001931835e-14
CAGL0M10153g8672231836e-14
Kwal_26.78619551941836e-14
KLLA0A03806g6022481826e-14
CAGL0J03828g4671901817e-14
YDL101C (DUN1)5132161817e-14
KLLA0B13607g9891941837e-14
ACL191C3651761798e-14
KLLA0F01276g5191811818e-14
Scas_673.20*7581971828e-14
AEL230W6082501801e-13
Scas_640.165051971791e-13
ACR133C8512211811e-13
AER223C9021891811e-13
KLLA0E01584g4153061772e-13
YGL179C (TOS3)5602211772e-13
KLLA0D07304g4651941763e-13
Kwal_27.97638681931783e-13
Kwal_0.1555872531773e-13
YDR523C (SPS1)4902561763e-13
Kwal_14.24974181761753e-13
Scas_685.245151931753e-13
YLR248W (RCK2)6102401764e-13
Scas_477.57031991764e-13
CAGL0K02167g11622851774e-13
Kwal_14.14163652411718e-13
Scas_700.354391891728e-13
Scas_628.9621851721e-12
CAGL0B03509g5972071721e-12
Scas_564.712102661731e-12
KLLA0E11979g614851702e-12
KLLA0A02497g3622111672e-12
ACR117W5241941692e-12
Scas_613.55172471692e-12
Scas_573.105692271692e-12
YCR008W (SAT4)603851692e-12
KLLA0C00979g4831951683e-12
Kwal_33.13222148871563e-12
Scas_713.79831991693e-12
Scas_693.1710491821693e-12
Scas_700.348642371693e-12
YLR096W (KIN2)11471821693e-12
CAGL0M11396g11921821684e-12
KLLA0F19536g11042661684e-12
ACL054W9723011685e-12
CAGL0H01639g5212031665e-12
Kwal_0.3074901001665e-12
Kwal_33.131125052391665e-12
KLLA0B13112g7301911666e-12
Kwal_55.203267501911667e-12
Scas_640.14*7282461667e-12
CAGL0J03872g6611871658e-12
YLR362W (STE11)7171911658e-12
CAGL0B02739g6761911641e-11
CAGL0L07810g596851631e-11
Kwal_23.35904992851631e-11
YGL180W (ATG1)8972671641e-11
YOR231W (MKK1)5081901621e-11
YOR351C (MEK1)4972571621e-11
AER195C504851621e-11
CAGL0L07326g5062661621e-11
CAGL0B01925g9441951632e-11
CAGL0L06006g9422661632e-11
Kwal_26.87034442021612e-11
AFL188C4722731612e-11
AGR058W10711821622e-11
CAGL0D02244g4872061612e-11
Kwal_33.138317001971612e-11
AAR009W4531871602e-11
Kwal_56.237178581821612e-11
Kwal_47.1726311273831613e-11
Scas_651.198011821594e-11
Scas_707.369152091595e-11
Kwal_27.125594142971575e-11
KLLA0B11946g4392091575e-11
KLLA0D11990g3042411546e-11
Kwal_55.217093402761556e-11
Kwal_26.87098291811586e-11
YNL307C (MCK1)3752281556e-11
Scas_711.2515151791596e-11
Kwal_23.55765041691567e-11
Kwal_17.26873622381557e-11
Scas_635.13782501557e-11
KLLA0E17127g8522051578e-11
Kwal_23.566816891691579e-11
Scas_602.1111862101571e-10
AFR092W14231791571e-10
YJL095W (BCK1)14781791571e-10
YDL028C (MPS1)7641861561e-10
ADR300C8902651561e-10
CAGL0H07535g2982831521e-10
Kwal_55.201898122061561e-10
AEL284C4791891551e-10
Scas_688.144791691541e-10
ABL011C7011921551e-10
ADR379C4922231541e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_705.23
         (553 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_705.23                                                          1043   0.0  
CAGL0B04147g 402798..404498 highly similar to sp|P22204 Saccharo...   823   0.0  
Scas_716.33                                                           818   0.0  
YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine pro...   815   0.0  
CAGL0G03047g 282299..283918 highly similar to sp|P22204 Saccharo...   801   0.0  
Kwal_23.3992                                                          780   0.0  
ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W (...   776   0.0  
KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1 Kluyvero...   762   0.0  
AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH] complement(...   218   2e-62
Kwal_33.14554                                                         217   4e-62
YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine pr...   216   2e-61
KLLA0D07810g complement(669095..671251) gi|401646|sp|P31034|YL44...   214   7e-61
CAGL0J06072g complement(572377..574698) similar to sp|P53894 Sac...   212   4e-60
Scas_654.12                                                           208   1e-58
YMR104C (YPK2) [4061] chr13 complement(473419..475452) Serine/th...   160   5e-42
CAGL0C03509g complement(350846..353533) similar to sp|P53739 Sac...   161   8e-42
YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine...   159   5e-41
YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine pro...   157   7e-41
Scas_720.103                                                          156   2e-40
Scas_629.16                                                           155   5e-40
KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1 Kluyvero...   155   6e-40
Kwal_23.6458                                                          155   6e-40
ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) ...   154   2e-39
Kwal_47.16761                                                         152   3e-39
CAGL0K07458g complement(736336..738450) similar to sp|P12688 Sac...   151   6e-39
ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C (Y...   151   8e-39
KLLA0B07205g complement(624606..625973) some similarities with s...   148   8e-39
Scas_651.18                                                           145   9e-39
CAGL0K03399g complement(310487..312598) highly similar to sp|P12...   150   1e-38
YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic...   144   5e-38
Scas_689.25*                                                          144   1e-37
Scas_703.5                                                            148   1e-37
YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine pro...   148   1e-37
KLLA0B03586g complement(326871..329075) similar to sp|P11792 Sac...   147   1e-37
YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine pr...   147   2e-37
AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C (...   142   2e-37
KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces...   147   2e-37
Scas_721.124                                                          145   6e-37
CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces c...   145   9e-37
CAGL0G09020g 860266..861351 highly similar to sp|P06245 Saccharo...   140   1e-36
Kwal_26.7635                                                          144   2e-36
YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic...   140   2e-36
KLLA0D03190g 267933..269051 highly similar to sp|P06245 Saccharo...   139   3e-36
ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH] complement(...   144   3e-36
AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH] complement(...   137   8e-36
Kwal_56.24059                                                         137   9e-36
Kwal_33.13846                                                         137   1e-35
Scas_717.69                                                           141   1e-35
CAGL0M08404g complement(836791..838179) some similarities with s...   138   2e-35
Scas_690.13                                                           131   1e-33
CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces c...   129   1e-31
YBR028C (YBR028C) [220] chr2 complement(294387..295964) Serine/t...   128   1e-31
Kwal_56.22788                                                         127   2e-31
Scas_593.14d                                                          124   2e-30
KLLA0F24618g complement(2288943..2290613) similar to sp|P38070 S...   125   2e-30
YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine pr...   126   3e-30
KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732....   124   1e-29
YDR490C (PKH1) [1306] chr4 complement(1431956..1434256) Serine/t...   123   2e-29
AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)...   123   2e-29
YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine p...   123   3e-29
Scas_715.34                                                           123   4e-29
YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase...   121   1e-28
CAGL0M09361g complement(928484..931918) highly similar to sp|P24...   120   2e-28
Scas_660.20                                                           119   4e-28
Kwal_27.10581                                                         119   8e-28
ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..68...   118   1e-27
AEL083W [2423] [Homologous to ScYBR028C - SH] complement(470964....   116   1e-27
Kwal_56.22693                                                         115   8e-27
YMR001C (CDC5) [3966] chr13 complement(269019..271136) Serine/th...   111   1e-25
CAGL0K06479g 636296..639271 some similarities with tr|Q03306 Sac...   110   3e-25
KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236 Saccha...   108   1e-24
CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces c...   108   2e-24
YFL033C (RIM15) [1651] chr6 complement(69113..74425) Serine/thre...   108   3e-24
KLLA0E03487g complement(323764..325707) similar to sgd|S0002874 ...   106   5e-24
CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces...   105   3e-23
KLLA0F09020g 836287..839073 weakly similar to sp|P43565 Saccharo...   103   7e-23
CAGL0G04609g complement(437162..440059) similar to sp|Q12236 Sac...   103   9e-23
Kwal_47.18307                                                         102   1e-22
AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C (...   102   1e-22
Scas_707.3                                                            102   2e-22
ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH] complement...   100   7e-22
KLLA0F11143g complement(1026129..1028570) similar to sp|P22216 S...    99   2e-21
Kwal_56.24091                                                          97   2e-21
Scas_502.2                                                             99   2e-21
Kwal_14.1159                                                           98   6e-21
ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH] complement(...    96   2e-20
Kwal_26.8796                                                           96   2e-20
Kwal_56.22476                                                          96   2e-20
ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH] complement...    94   6e-20
KLLA0B02332g complement(206863..207948) similar to sp|P38991 Sac...    91   9e-20
Scas_700.54                                                            91   4e-19
AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH] (249144..25...    89   6e-19
CAGL0J11638g complement(1128620..1130860) highly similar to sp|P...    91   7e-19
KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces c...    90   2e-18
KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces c...    89   2e-18
CAGL0K08514g complement(853314..857783) similar to sp|P34244 Sac...    88   5e-18
KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces c...    87   6e-18
Scas_627.7                                                             86   6e-18
Scas_493.2                                                             87   1e-17
CAGL0M02233g complement(267332..269635) highly similar to sp|P22...    87   1e-17
AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W (...    87   2e-17
Scas_616.10                                                            87   2e-17
YDR507C (GIN4) [1321] chr4 complement(1462346..1465774) Serine/t...    86   2e-17
CAGL0K05709g complement(555903..559214) similar to sp|Q12263 Sac...    86   2e-17
Kwal_55.21545                                                          86   2e-17
Scas_644.15                                                            86   3e-17
YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protei...    85   6e-17
CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces c...    84   8e-17
CAGL0M03729g complement(420316..422901) similar to sp|P48562 Sac...    84   9e-17
CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces c...    82   1e-16
YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase...    82   7e-16
Scas_700.28                                                            81   7e-16
CAGL0M02519g complement(290723..292993) highly similar to tr|Q03...    81   8e-16
YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinas...    81   8e-16
CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces...    81   9e-16
AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C ...    81   9e-16
YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine prot...    81   9e-16
ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH] complement(3...    81   1e-15
YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine pr...    81   1e-15
YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase, re...    80   1e-15
Kwal_23.5290                                                           80   2e-15
YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine pr...    80   2e-15
KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomy...    80   2e-15
KLLA0F13552g complement(1252906..1256709) gi|33386566|emb|CAD877...    80   2e-15
KLLA0C04191g 384198..386591 weakly similar to sp|P27636 Saccharo...    80   2e-15
CAGL0M08910g complement(887703..889541) highly similar to sp|Q00...    79   3e-15
YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine pro...    79   3e-15
YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine pro...    78   4e-15
KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces c...    79   4e-15
Scas_675.2                                                             78   5e-15
CAGL0C05005g complement(467626..470856) similar to sp|P27636 Sac...    79   5e-15
Scas_580.6                                                             79   6e-15
AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W (R...    78   7e-15
AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH] (1769897..1...    77   8e-15
YHL007C (STE20) [2279] chr8 complement(95113..97932) Serine/thre...    78   9e-15
AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W (...    78   1e-14
Scas_668.22                                                            78   1e-14
AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH] (291129..29...    77   1e-14
YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine p...    77   1e-14
ABR014W [605] [Homologous to ScYHL007C (STE20) - SH] complement(...    77   1e-14
Kwal_23.6325                                                           78   1e-14
Scas_660.28                                                            77   1e-14
Scas_598.6                                                             77   1e-14
CAGL0K02673g complement(240509..243256) similar to sp|Q03497 Sac...    77   2e-14
Kwal_47.18233                                                          77   2e-14
Scas_720.94                                                            77   2e-14
Kwal_26.7788                                                           77   2e-14
ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH] (157357..160...    77   2e-14
Kwal_26.8751                                                           77   2e-14
KLLA0E21780g complement(1936438..1939488) similar to sp|P38692 S...    77   2e-14
Scas_618.15                                                            76   3e-14
KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces...    75   3e-14
KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces c...    76   4e-14
CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces c...    76   4e-14
YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine pr...    75   5e-14
CAGL0M10153g complement(1010688..1013291) some similarities with...    75   6e-14
Kwal_26.7861                                                           75   6e-14
KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235....    75   6e-14
CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces c...    74   7e-14
YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kin...    74   7e-14
KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497 Saccha...    75   7e-14
ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..2757...    74   8e-14
KLLA0F01276g complement(120001..121560) similar to sp|P38147 Sac...    74   8e-14
Scas_673.20*                                                           75   8e-14
AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH] complement(...    74   1e-13
Scas_640.16                                                            74   1e-13
ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023) [...    74   1e-13
AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH] (1044971.....    74   1e-13
KLLA0E01584g 149713..150960 highly similar to sp|P39009 Saccharo...    73   2e-13
YGL179C (TOS3) [1812] chr7 complement(163413..165095) Serine/thr...    73   2e-13
KLLA0D07304g 623352..624749 some similarities with sp|P32491 Sac...    72   3e-13
Kwal_27.9763                                                           73   3e-13
Kwal_0.155                                                             73   3e-13
YDR523C (SPS1) [1335] chr4 complement(1485554..1487026) Serine/t...    72   3e-13
Kwal_14.2497                                                           72   3e-13
Scas_685.24                                                            72   3e-13
YLR248W (RCK2) [3644] chr12 (634254..636086) Calcium/calmodulin-...    72   4e-13
Scas_477.5                                                             72   4e-13
CAGL0K02167g complement(191468..194956) similar to sp|P38990 Sac...    73   4e-13
Kwal_14.1416                                                           70   8e-13
Scas_700.35                                                            71   8e-13
Scas_628.9                                                             71   1e-12
CAGL0B03509g complement(349638..351431) similar to sp|P38623 Sac...    71   1e-12
Scas_564.7                                                             71   1e-12
KLLA0E11979g complement(1060048..1061892) some similarities with...    70   2e-12
KLLA0A02497g 218592..219680 highly similar to sp|P14681 Saccharo...    69   2e-12
ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C (...    70   2e-12
Scas_613.5                                                             70   2e-12
Scas_573.10                                                            70   2e-12
YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine prot...    70   2e-12
KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces cer...    69   3e-12
Kwal_33.13222                                                          65   3e-12
Scas_713.7                                                             70   3e-12
Scas_693.17                                                            70   3e-12
Scas_700.34                                                            70   3e-12
YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine pr...    70   3e-12
CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces...    69   4e-12
KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces...    69   4e-12
ACL054W [995] [Homologous to ScYGL180W (APG1) - SH] complement(2...    69   5e-12
CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces c...    69   5e-12
Kwal_0.307                                                             69   5e-12
Kwal_33.13112                                                          69   5e-12
KLLA0B13112g complement(1146006..1148198) similar to sp|P23561 S...    69   6e-12
Kwal_55.20326                                                          69   7e-12
Scas_640.14*                                                           69   7e-12
CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces c...    68   8e-12
YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase ...    68   8e-12
CAGL0B02739g complement(262590..264620) similar to sp|P23561 Sac...    68   1e-11
CAGL0L07810g complement(857656..859446) similar to sp|P25333 Sac...    67   1e-11
Kwal_23.3590                                                           67   1e-11
YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine pro...    68   1e-11
YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine pr...    67   1e-11
YOR351C (MEK1) [5128] chr15 complement(995013..996506) Serine/th...    67   1e-11
AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH] (1005431..1...    67   1e-11
CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces c...    67   1e-11
CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces c...    67   2e-11
CAGL0L06006g complement(670707..673535) similar to sp|P53104 Sac...    67   2e-11
Kwal_26.8703                                                           67   2e-11
AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..902...    67   2e-11
AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W (...    67   2e-11
CAGL0D02244g complement(229504..230967) similar to sp|P24719 Sac...    67   2e-11
Kwal_33.13831                                                          67   2e-11
AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C (C...    66   2e-11
Kwal_56.23717                                                          67   2e-11
Kwal_47.17263                                                          67   3e-11
Scas_651.19                                                            66   4e-11
Scas_707.36                                                            66   5e-11
Kwal_27.12559                                                          65   5e-11
KLLA0B11946g complement(1048033..1049352) similar to sp|P41808 S...    65   5e-11
KLLA0D11990g join(complement(1023928..1023944), gi|2499590|sp|Q9...    64   6e-11
Kwal_55.21709                                                          64   6e-11
Kwal_26.8709                                                           65   6e-11
YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of t...    64   6e-11
Scas_711.25                                                            66   6e-11
Kwal_23.5576                                                           65   7e-11
Kwal_17.2687                                                           64   7e-11
Scas_635.1                                                             64   7e-11
KLLA0E17127g complement(1515721..1518279) similar to sp|P38691 S...    65   8e-11
Kwal_23.5668                                                           65   9e-11
Scas_602.11                                                            65   1e-10
AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH] complement(...    65   1e-10
YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine pr...    65   1e-10
YDL028C (MPS1) [834] chr4 complement(400994..403288) Multi-funct...    65   1e-10
ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH] (1222346..1...    65   1e-10
CAGL0H07535g 736241..737137 highly similar to sp|P00546 Saccharo...    63   1e-10
Kwal_55.20189                                                          65   1e-10
AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919) [...    64   1e-10
Scas_688.14                                                            64   1e-10
ABL011C [581] [Homologous to ScYLR362W (STE11) - SH] (378259..38...    64   1e-10
ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH] (1386601..1...    64   1e-10
ADL315C [1426] [Homologous to ScYPR054W (SMK1) - SH] (146098..14...    64   2e-10
CAGL0H01199g 110610..115556 highly similar to sp|P15442 Saccharo...    64   2e-10
Scas_721.46                                                            62   2e-10
CAGL0F04741g 478256..479584 similar to sp|P22517 Saccharomyces c...    64   2e-10
CAGL0L03520g complement(401103..405446) similar to sp|Q01389 Sac...    64   2e-10
CAGL0I03498g 297344..298699 similar to sp|P06784 Saccharomyces c...    64   2e-10
KLLA0B11902g 1041657..1043144 gi|7385125|gb|AAF61706.1|AF226711_...    64   2e-10
YDR122W (KIN1) [969] chr4 (694694..697888) Serine/threonine prot...    64   2e-10
Scas_689.24                                                            64   2e-10
ACR119W [1166] [Homologous to ScYPL141C - SH; ScYOR233W (KIN4) -...    64   2e-10
Scas_643.20                                                            64   3e-10
Kwal_33.14167                                                          64   3e-10
YBR160W (CDC28) [345] chr2 (560034..560930) Cyclin-dependent pro...    62   3e-10
YLL019C (KNS1) [3399] chr12 complement(105685..107898) Serine/th...    63   3e-10
Scas_619.5*                                                            63   3e-10
KLLA0F14190g 1311121..1315137 gi|3021329|emb|CAA06336.1 Kluyvero...    64   3e-10
ADL043C [1698] [Homologous to ScYLL019C (KNS1) - SH] (612091..61...    63   4e-10
CAGL0F00649g 71961..73505 similar to sp|P38623 Saccharomyces cer...    62   5e-10
KLLA0C16577g complement(1451181..1452695) some similarities with...    62   5e-10
CAGL0I06248g 600351..602792 similar to sp|P38970 Saccharomyces c...    63   5e-10
AER232C [2734] [Homologous to ScYHR030C - SH; ScYKL161C (SLT2) -...    62   5e-10
CAGL0E01683g complement(166584..167711) highly similar to sp|P21...    62   5e-10
KLLA0C04213g 386815..387999 similar to sp|P22209 Saccharomyces c...    62   5e-10
Scas_707.34                                                            63   5e-10
Kwal_55.22001                                                          61   6e-10
YDL159W (STE7) [712] chr4 (172482..174029) Serine/threonine/tyro...    62   7e-10
YHR030C (SLT2) [2317] chr8 complement(168882..170336) Serine/thr...    62   7e-10
Kwal_27.11803                                                          60   8e-10
Kwal_27.10004                                                          62   8e-10
KLLA0B09790g complement(855327..856214) highly similar to sp|P00...    60   9e-10
YBL016W (FUS3) [179] chr2 (192416..193477) Serine/threonine prot...    61   9e-10
Kwal_27.9773                                                           61   9e-10
Scas_678.24                                                            62   9e-10
YDR283C (GCN2) [1112] chr4 complement(1025062..1030041) Serine/t...    62   9e-10
KLLA0F23155g 2157146..2158429 similar to sp|P22517 Saccharomyces...    61   9e-10
Kwal_26.7355                                                           62   1e-09
Scas_713.38                                                            61   1e-09
KLLA0F16467g 1519800..1520822 highly similar to sp|P19454 Saccha...    60   1e-09
CAGL0G02035g 179911..180930 highly similar to sp|P19454 Saccharo...    60   1e-09
AGL242C [4070] [Homologous to ScYPL031C (PHO85) - SH] (246896..2...    60   1e-09
Kwal_14.1273                                                           60   1e-09
KLLA0E12177g 1080245..1081612 gi|4096112|gb|AAC99804.1 Kluyverom...    60   1e-09
CAGL0F00913g 97023..100643 similar to sp|P31374 Saccharomyces ce...    61   1e-09
YER129W (PAK1) [1559] chr5 (417277..420705) Protein kinase capab...    61   2e-09
KLLA0D07348g 626999..629728 weakly similar to sgd|S0006062 Sacch...    61   2e-09
AFR205C [3397] [Homologous to ScYKL139W (CTK1) - SH] (805583..80...    60   2e-09
Scas_648.17                                                            60   2e-09
Scas_568.9*                                                            59   2e-09
Scas_683.6                                                             60   2e-09
YDL025C (YDL025C) [836] chr4 complement(405341..407203) Serine/t...    60   2e-09
Kwal_0.96                                                              60   2e-09
CAGL0K04169g 383738..384934 similar to sp|P14681 Saccharomyces c...    60   2e-09
Kwal_33.14192                                                          60   2e-09
KLLA0E10527g 929989..931104 similar to sp|P16892 Saccharomyces c...    60   2e-09
CAGL0H06259g 615045..619055 similar to sp|P31374 Saccharomyces c...    60   3e-09
YOR061W (CKA2) [4869] chr15 (441535..442554) Casein kinase II (P...    59   3e-09
YLR113W (HOG1) [3526] chr12 (371621..372928) MAP kinase (MAPK), ...    60   3e-09
Scas_548.6                                                             60   3e-09
YKL168C (KKQ8) [3102] chr11 complement(131293..133497) Serine/th...    60   3e-09
YKL048C (ELM1) [3211] chr11 complement(346859..348781) Serine/th...    60   3e-09
AFR019W [3211] [Homologous to ScYBL016W (FUS3) - SH] complement(...    59   3e-09
Scas_710.28                                                            59   4e-09
Kwal_26.7552                                                           59   4e-09
Kwal_56.23841                                                          59   4e-09
CAGL0J04290g complement(400939..402012) similar to sp|P16892 Sac...    59   4e-09
YMR139W (RIM11) [4096] chr13 (546124..547236) Member of the GSK3...    59   4e-09
CAGL0J00539g 47095..48561 highly similar to sp|Q00772 Saccharomy...    59   4e-09
YKL139W (CTK1) [3128] chr11 (182963..184549) C-terminal domain (...    59   4e-09
CAGL0L12474g complement(1345044..1345952) highly similar to sp|P...    59   4e-09
KLLA0C17160g 1498959..1501454 similar to sp|P53104 Saccharomyces...    60   4e-09
ACR196C [1243] [Homologous to ScYDL159W (STE7) - SH] (692321..69...    59   4e-09
YGR040W (KSS1) [2006] chr7 (575400..576506) Serine/threonine pro...    59   5e-09
KLLA0B07579g 659591..661759 weakly similar to sp|P32944 Saccharo...    59   5e-09
YAL017W (PSK1) [51] chr1 (120228..124298) Serine/threonine prote...    60   5e-09
KLLA0F20053g 1867209..1868543 highly similar to sp|P32485 Saccha...    59   5e-09
AGR048C [4358] [Homologous to ScYLR113W (HOG1) - SH] (807470..80...    59   5e-09
Kwal_56.24584                                                          59   5e-09
ADR204W [1945] [Homologous to ScYOR061W (CKA2) - SH] complement(...    58   5e-09
YAR019C (CDC15) [74] chr1 complement(172211..175135) MAP kinase ...    59   6e-09
Scas_544.6                                                             59   6e-09
CAGL0D01694g complement(176981..178279) similar to sp|P41808 Sac...    59   6e-09
YMR291W (YMR291W) [4245] chr13 (852629..854389) Serine/threonine...    59   6e-09
YFR014C (CMK1) [1695] chr6 complement(172529..173869) Calcium/ca...    59   7e-09
Scas_634.5                                                             59   7e-09
KLLA0C07535g 658746..660620 some similarities with sgd|S0005793 ...    59   7e-09
Scas_718.90                                                            59   7e-09
YOL128C (YGK3) [4695] chr15 complement(78351..79478) Member of t...    58   7e-09
CAGL0M11748g 1167306..1168649 highly similar to sp|P32485 Saccha...    58   8e-09
YIL035C (CKA1) [2632] chr9 complement(287789..288907) Casein kin...    58   1e-08
KLLA0F07623g 720246..723935 similar to sp|P31374 Saccharomyces c...    59   1e-08
Scas_633.29                                                            58   1e-08
YOL045W (PSK2) [4773] chr15 (243495..246800) Serine/threonine pr...    59   1e-08
KLLA0C10802g complement(926916..931934) similar to sp|P15442 Sac...    59   1e-08
Scas_713.21                                                            58   1e-08
KLLA0C03828g 349187..351568 similar to sp|P54199 Saccharomyces c...    58   1e-08
KLLA0F23507g complement(2198603..2200066) similar to sp|P24719 S...    57   1e-08
ADR253W [1994] [Homologous to ScYMR139W (RIM11) - SH; ScYDL079C ...    57   2e-08
Kwal_47.17252                                                          58   2e-08
KLLA0D09328g complement(788565..791705) some similarities with s...    58   2e-08
KLLA0E08371g complement(756205..758538) similar to sp|P40494 Sac...    57   2e-08
KLLA0E07414g complement(672690..673787) highly similar to sp|P21...    57   2e-08
CAGL0J11308g 1097845..1100031 similar to sp|P22211 Saccharomyces...    57   2e-08
CAGL0K01661g complement(146952..148400) some similarities with t...    57   3e-08
AAL083W [104] [Homologous to ScYDR283C (GCN2) - SH] complement(1...    57   3e-08
CAGL0K01617g complement(142479..144803) similar to sp|P54199 Sac...    57   3e-08
ADL168C [1573] [Homologous to ScYNL307C (MCK1) - SH; ScYOL128C -...    56   3e-08
Kwal_47.18098                                                          56   4e-08
Kwal_47.17345                                                          56   4e-08
KLLA0E04136g 382874..383995 similar to sp|P15790 Saccharomyces c...    56   4e-08
ADR058C [1799] [Homologous to ScYBR160W (CDC28) - SH] (810941..8...    55   5e-08
Scas_703.47                                                            56   5e-08
ACL053C [996] [Homologous to ScYER129W (PAK1) - SH; ScYGL179C (T...    56   5e-08
Scas_653.25                                                            56   5e-08
CAGL0I05192g complement(493635..494756) highly similar to sp|P15...    55   5e-08
AEL118C [2388] [Homologous to ScYKL168C (KKQ8) - SH; ScYJL165C (...    56   6e-08
Scas_721.110                                                           55   6e-08
Scas_698.37                                                            55   6e-08
Scas_683.12                                                            55   7e-08
Scas_704.50                                                            55   7e-08
Kwal_26.7154                                                           56   8e-08
ADR317C [2058] [Homologous to ScYDL028C (MPS1) - SH] (1263082..1...    55   8e-08
YHR082C (KSP1) [2372] chr8 complement(268460..271549) Serine/thr...    55   8e-08
ACR281C [1328] [Homologous to ScYOL045W - SH; ScYAL017W (FUN31) ...    55   9e-08
Scas_201.1*                                                            54   9e-08
Scas_649.30                                                            55   9e-08
CAGL0M08360g complement(833220..835520) some similarities with s...    55   9e-08
ADR313W [2054] [Homologous to ScYDL025C - SH] complement(1255932...    55   9e-08
YJR059W (PTK2) [2953] chr10 (545701..548157) Serine/threonine pr...    55   1e-07
KLLA0C03938g complement(358851..360632) some similarities with s...    55   1e-07
ADL102C [1639] [Homologous to ScYIL035C (CKA1) - SH] (503670..50...    54   1e-07
YOL016C (CMK2) [4800] chr15 complement(294777..296120) Calcium/c...    55   1e-07
YOR267C (HRK1) [5054] chr15 complement(822585..824864) Serine/th...    55   1e-07
Kwal_33.14434                                                          55   1e-07
Scas_684.28                                                            55   1e-07
YDR247W (VHS1) [1081] chr4 (956005..957390) Serine/threonine pro...    54   1e-07
YKL161C (YKL161C) [3109] chr11 complement(149391..150692) Serine...    54   1e-07
CAGL0D02002g 207419..209080 similar to sp|Q03957 Saccharomyces c...    54   1e-07
Scas_623.11                                                            54   1e-07
AGR334W [4645] [Homologous to ScYMR291W - SH] complement(1354612...    54   2e-07
Scas_618.8                                                             54   2e-07
Kwal_26.8941                                                           54   2e-07
CAGL0K04301g 404419..405486 similar to sp|P53233 Saccharomyces c...    54   2e-07
Scas_651.3                                                             54   2e-07
CAGL0I08349g complement(813728..815731) similar to sp|P23293 Sac...    54   2e-07
Scas_22.1                                                              52   2e-07
AGL249C [4063] [Homologous to ScYPL042C (SSN3) - SH] (234347..23...    54   2e-07
Scas_667.18                                                            54   3e-07
YKL198C (PTK1) [3074] chr11 complement(68274..70223) Protein con...    54   3e-07
KLLA0A06820g complement(615686..618004) some similarities with s...    54   3e-07
CAGL0L05632g 610481..612514 similar to sp|P08018 Saccharomyces c...    54   3e-07
Scas_655.2                                                             54   3e-07
YJL128C (PBS2) [2790] chr10 complement(178015..180021) MAP kinas...    54   3e-07
Kwal_33.14081                                                          54   3e-07
Kwal_27.11919                                                          52   3e-07
Kwal_33.13681                                                          54   3e-07
CAGL0C02893g complement(286017..287966) similar to tr|Q08732 Sac...    54   3e-07
AER222C [2724] [Homologous to ScYAR018C (KIN3) - SH] (1043479..1...    53   4e-07
CAGL0D06600g 626571..628748 similar to tr|Q12399 Saccharomyces c...    53   4e-07
CAGL0L12650g 1357789..1359492 similar to sp|P39073 Saccharomyces...    53   4e-07
CAGL0K10604g complement(1029226..1030566) similar to sp|P27466 S...    53   5e-07
YAR018C (KIN3) [73] chr1 complement(170393..171700) Serine/threo...    52   5e-07
KLLA0A02717g 245082..246380 some similarities with sp|P53233 Sac...    52   5e-07
KLLA0D08415g 714473..716797 similar to sp|P22211 Saccharomyces c...    53   5e-07
Scas_610.7                                                             53   6e-07
AFL217C [2978] [Homologous to ScYJL128C (PBS2) - SH] (30765..328...    52   7e-07
Kwal_47.17868                                                          52   7e-07
CAGL0G05720g complement(547617..549833) similar to sp|P22211 Sac...    52   7e-07
Scas_692.24                                                            52   8e-07
ADR174C [1916] [Homologous to ScYOR267C - SH] (1008798..1010813)...    52   8e-07
KLLA0E15378g 1362851..1365025 some similarities with sp|P08018 S...    52   8e-07
Kwal_33.13984                                                          52   9e-07
ABL143C [449] [Homologous to ScYNL183C (NPR1) - SH; ScYDL214C (P...    52   9e-07
Kwal_27.11830                                                          52   1e-06
KLLA0E14828g complement(1323743..1324675) gi|27526973|emb|CAD369...    51   1e-06
Scas_680.20                                                            52   1e-06
CAGL0F03311g complement(327599..330736) similar to sp|P38691 Sac...    52   1e-06
YJL141C (YAK1) [2777] chr10 complement(147885..150308) Serine/th...    52   1e-06
Scas_695.33                                                            52   1e-06
KLLA0D11814g complement(1007240..1009021) similar to sp|P39073 S...    51   1e-06
AEL149C [2357] [Homologous to ScYJL187C (SWE1) - SH] (348350..35...    51   1e-06
Scas_582.1                                                             51   2e-06
Scas_677.18                                                            51   2e-06
CAGL0L06820g 767038..768138 highly similar to sp|P38615 Saccharo...    50   2e-06
ADL283W [1458] [Homologous to ScYDL108W (KIN28) - SH] complement...    50   2e-06
YNL183C (NPR1) [4417] chr14 complement(293137..295509) Serine/th...    51   2e-06
ABR177C [770] [Homologous to ScYPR161C (SGV1) - SH] (735828..738...    51   2e-06
KLLA0D10527g 892955..894892 similar to sp|P23293 Saccharomyces c...    51   2e-06
KLLA0F26983g 2489326..2490729 some similarities with sp|P32801 S...    50   3e-06
CAGL0J04972g 472984..474003 some similarities with tr|Q12100 Sac...    50   3e-06
Kwal_55.21900                                                          50   3e-06
Scas_718.72                                                            50   3e-06
Scas_584.11                                                            51   3e-06
CAGL0I05896g 560169..562505 some similarities with sp|P14680 Sac...    50   3e-06
CAGL0F03707g complement(359839..361665) similar to sp|Q08732 Sac...    50   4e-06
YNL020C (ARK1) [4567] chr14 complement(595621..597537) Serine/th...    50   4e-06
YDL079C (MRK1) [789] chr4 complement(312951..314044,314337..3147...    50   4e-06
CAGL0M13167g complement(1291524..1293356) similar to sp|P32801 S...    50   5e-06
KLLA0F22297g complement(2083448..2085547) some similarities with...    50   5e-06
CAGL0M13541g 1332296..1334164 similar to sp|Q03533 Saccharomyces...    50   5e-06
YJL187C (SWE1) [2737] chr10 complement(76802..79261) Serine/tyro...    49   7e-06
Scas_671.16                                                            49   7e-06
ACR249C [1296] [Homologous to ScYJL141C (YAK1) - SH] (797020..79...    49   7e-06
Scas_673.34*                                                           49   7e-06
CAGL0H09152g complement(895722..898055) similar to sp|P47116 Sac...    49   7e-06
Kwal_23.3471                                                           48   8e-06
Scas_716.73                                                            49   8e-06
CAGL0I04422g 394159..395427 some similarities with sp|P22209 Sac...    49   8e-06
ABR088C [679] [Homologous to ScYKL048C (ELM1) - SH] (546324..547...    49   9e-06
CAGL0K00693g complement(74637..77267) similar to sp|P32944 Sacch...    49   9e-06
Scas_601.6                                                             49   1e-05
YDL214C (PRR2) [660] chr4 complement(74447..76546) Serine/threon...    49   1e-05
YGR052W (YGR052W) [2015] chr7 (593598..594707) Serine/threonine ...    48   1e-05
CAGL0H01837g complement(176352..178736) tr|Q9C1R8 Candida glabra...    48   1e-05
AFR372W [3564] [Homologous to ScYJR059W (PTK2 ) - SH] complement...    48   2e-05
KLLA0D12100g complement(1031728..1033161) some similarities with...    48   2e-05
AFR150C [3342] [Homologous to ScYFL029C (CAK1) - SH] (707306..70...    47   2e-05
CAGL0G02607g complement(240244..242310) similar to sp|P40494 Sac...    48   2e-05
YIL095W (PRK1) [2580] chr9 (183934..186366) Serine/threonine pro...    48   2e-05
Scas_568.13                                                            47   2e-05
Scas_613.13*                                                           47   2e-05
KLLA0A05819g 541545..543659 similar to sp|P14680 Saccharomyces c...    47   2e-05
KLLA0A09713g 851952..853625 similar to sp|Q03533 Saccharomyces c...    47   2e-05
CAGL0H10318g complement(1006299..1007222) highly similar to sp|P...    47   3e-05
YJL165C (HAL5) [2756] chr10 complement(106887..109454) Serine/th...    47   3e-05
YKL116C (PRR1) [3148] chr11 complement(220990..222546) Serine/th...    47   4e-05
Scas_721.61                                                            47   4e-05
KLLA0F17006g complement(1561859..1563106) gi|3127831|emb|CAA6115...    46   4e-05
Scas_721.132                                                           47   5e-05
CAGL0J03432g 327428..329296 similar to sp|P53974 Saccharomyces c...    46   6e-05
Kwal_27.11542                                                          46   6e-05
KLLA0B06501g complement(576636..579089) some similarities with s...    46   7e-05
Scas_678.13                                                            46   7e-05
CAGL0G06138g complement(585585..587204) similar to sp|P23291 Sac...    46   8e-05
YDL108W (KIN28) [761] chr4 (267698..267725,267807..268699) Cycli...    45   9e-05
Scas_654.17                                                            45   1e-04
Scas_336.1                                                             45   1e-04
ADL217W [1524] [Homologous to ScYIL095W (PRK1) - SH; ScYNL020C (...    45   1e-04
YDL017W (CDC7) [843] chr4 (424206..425729) Protein kinase that a...    45   1e-04
YJL106W (IME2) [2809] chr10 (221307..223244) Serine/threonine pr...    45   2e-04
CAGL0K11275g 1093797..1095374 similar to tr|Q03785 Saccharomyces...    44   2e-04
CAGL0K11990g complement(1155395..1158370) some similarities with...    45   2e-04
Kwal_26.8347                                                           44   2e-04
CAGL0I05390g complement(508677..510041) similar to sp|Q12505 Sac...    44   3e-04
YHR135C (YCK1) [2422] chr8 complement(372695..374311) Casein kin...    44   3e-04
Kwal_27.11777                                                          44   3e-04
KLLA0F01408g 135424..136302 weakly similar to sgd|S0002183 Sacch...    43   3e-04
Kwal_23.4276                                                           44   3e-04
CAGL0G04455g 426386..428641 similar to sp|P32581 Saccharomyces c...    44   3e-04
KLLA0C14278g 1240990..1242615 similar to sp|P28708 Saccharomyces...    44   4e-04
Kwal_27.9804                                                           44   4e-04

>Scas_705.23
          Length = 553

 Score = 1043 bits (2698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/553 (91%), Positives = 508/553 (91%)

Query: 1   MFPRSDKDVDXXXXXXXXXXXXKPNARFVSVTPTRANKENRXXXXXXXXXNKTKRFTADE 60
           MFPRSDKDVD            KPNARFVSVTPTRANKENR         NKTKRFTADE
Sbjct: 1   MFPRSDKDVDQLVGNLNQLGLNKPNARFVSVTPTRANKENRSSLSPSPSPNKTKRFTADE 60

Query: 61  TELKNSPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLE 120
           TELKNSPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLE
Sbjct: 61  TELKNSPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLE 120

Query: 121 RNQNSLSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDT 180
           RNQNSLSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMIT           LARKRDT
Sbjct: 121 RNQNSLSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITQVGQGGYGQVYLARKRDT 180

Query: 181 KEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPG 240
           KEVCA             ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPG
Sbjct: 181 KEVCALKILNKKLLFKLNETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPG 240

Query: 241 GDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDF 300
           GDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDF
Sbjct: 241 GDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDF 300

Query: 301 GLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSP 360
           GLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSP
Sbjct: 301 GLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSP 360

Query: 361 DYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVL 420
           DYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVL
Sbjct: 361 DYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVL 420

Query: 421 DNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSE 480
           DNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSE
Sbjct: 421 DNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSE 480

Query: 481 TDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQKGLSGILY 540
           TDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQKGLSGILY
Sbjct: 481 TDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQKGLSGILY 540

Query: 541 NGSEHSDPFATFY 553
           NGSEHSDPFATFY
Sbjct: 541 NGSEHSDPFATFY 553

>CAGL0B04147g 402798..404498 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase related to DBF20P or sp|P32328 Saccharomyces
           cerevisiae YPR111w DBF20 cell cycle protein kinase
           related to DBF2P, hypothetical start
          Length = 566

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/534 (74%), Positives = 448/534 (83%), Gaps = 5/534 (0%)

Query: 24  PNARFVSVTPTRANKENRXXXXXXXXXNKTKRFTADETE--LKNSPKKLPHDFYKKALSN 81
           P  ++   TPT+  KENR              F  ++    + NSPKKLP DF++KA SN
Sbjct: 34  PFKKYAPSTPTQY-KENRSGASPYSTSPTKSIFKKEKPRERIINSPKKLPRDFHRKATSN 92

Query: 82  DTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVL-NYLERNQN-SLSTEELNNEWTAYL 139
            T+R+V+VCQMYFLDYYCDMFDYVISRRQRTK ++ N  E  QN ++  E+LN EW  YL
Sbjct: 93  KTQRLVSVCQMYFLDYYCDMFDYVISRRQRTKQMISNIQEYKQNHTIPDEQLNEEWNNYL 152

Query: 140 QQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXE 199
           Q+EH+VLRKRRLKPKNKDFEMIT           LARKRDTKEVCA             E
Sbjct: 153 QKEHEVLRKRRLKPKNKDFEMITQVGQGGYGQVYLARKRDTKEVCALKILNKKLLVKLNE 212

Query: 200 TNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHAR 259
           TNH+LTERDILTTTRS+WLVKLLYAFQD ESLYLAMEFVPGGDFRTLLINTR LR+ HAR
Sbjct: 213 TNHILTERDILTTTRSEWLVKLLYAFQDPESLYLAMEFVPGGDFRTLLINTRTLRSPHAR 272

Query: 260 FYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRL 319
           FYISEMFCAVNALHELGYTHRDLKPENFLID+EGHIKLTDFGLAAGT+S ERI+SMKIRL
Sbjct: 273 FYISEMFCAVNALHELGYTHRDLKPENFLIDAEGHIKLTDFGLAAGTVSNERIESMKIRL 332

Query: 320 EEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDY 379
           EEVKNLEFPAFTEKSIEDRRK+Y +LRQ ++NYANSMVGSPDYMALEVLEGKKYD+TVDY
Sbjct: 333 EEVKNLEFPAFTEKSIEDRRKIYQNLRQNDINYANSMVGSPDYMALEVLEGKKYDYTVDY 392

Query: 380 WSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLI 439
           WSLGCMLFE+L+GYTPFSGSSTNETYENLRHWK+TLRRP L++GR A SDR W++ITRLI
Sbjct: 393 WSLGCMLFEALIGYTPFSGSSTNETYENLRHWKRTLRRPFLNDGRSAISDRAWELITRLI 452

Query: 440 ADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSETDAGYFDDFTNEADMAKYA 499
           ADPINRLRSFEH+KRM YF E+NF+TLRQ +PPFTPQLD+ETDAGYFDDFTNEADMAKYA
Sbjct: 453 ADPINRLRSFEHVKRMNYFHEINFDTLRQLSPPFTPQLDNETDAGYFDDFTNEADMAKYA 512

Query: 500 DVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEHSDPFATFY 553
           DVFKRQ+KL++MVDDS VDSKL+GFTFRH+NG  G SG+LY G E+++PF+TFY
Sbjct: 513 DVFKRQDKLAAMVDDSEVDSKLIGFTFRHKNGNTGSSGVLYKGHENANPFSTFY 566

>Scas_716.33
          Length = 573

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/496 (78%), Positives = 430/496 (86%), Gaps = 1/496 (0%)

Query: 59  DETELKNSPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNY 118
           ++ ++ NSPKKLP  F   A +N T+R+V+VC+MYFLDYYCDMFDYVISRRQRTK VL Y
Sbjct: 78  NDIDITNSPKKLPQGFQTMASNNKTQRLVSVCKMYFLDYYCDMFDYVISRRQRTKKVLEY 137

Query: 119 LERNQN-SLSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARK 177
           LE+ +N ++    LNNEW  Y+Q+EH VLRKRRLKPK+KDFEMIT           LARK
Sbjct: 138 LEQKKNENVDLNSLNNEWNGYIQREHQVLRKRRLKPKHKDFEMITQVGQGGYGQVYLARK 197

Query: 178 RDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEF 237
           +DT EVCA             ETNHVLTERDILTTTRS WLVKLLYAFQDT++LYLAMEF
Sbjct: 198 KDTNEVCALKILNKKLLFKLNETNHVLTERDILTTTRSQWLVKLLYAFQDTQNLYLAMEF 257

Query: 238 VPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKL 297
           VPGGDFRTLLINTRFL++THARFYISEMF AVNALH+LGYTHRDLKPENFLID++GHIKL
Sbjct: 258 VPGGDFRTLLINTRFLKSTHARFYISEMFLAVNALHDLGYTHRDLKPENFLIDAKGHIKL 317

Query: 298 TDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMV 357
           TDFGLAAGTIS +RIQSMK+RLEEVKNLEFP F++KSIEDRR+MY   R+TEVNYANSMV
Sbjct: 318 TDFGLAAGTISNDRIQSMKVRLEEVKNLEFPEFSDKSIEDRRQMYQKYRETEVNYANSMV 377

Query: 358 GSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRR 417
           GSPDYMALEVLEGKKYDFTVDYWSL CMLFESLVGYTPFSGSSTNETYENLRHWKKTLRR
Sbjct: 378 GSPDYMALEVLEGKKYDFTVDYWSLSCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRR 437

Query: 418 PVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQL 477
           P+LDNGRPAFSDRTWD ITRLIADPINRLRSFEH+KRM YF  V+FNTLR  +PPF PQL
Sbjct: 438 PMLDNGRPAFSDRTWDFITRLIADPINRLRSFEHVKRMTYFESVDFNTLRDLSPPFIPQL 497

Query: 478 DSETDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQKGLSG 537
           D+ETDAGYFDDFTNEADMAKYADVFKRQNKLS+MV+D+ +DSKLVGFTFRHR G+ G SG
Sbjct: 498 DNETDAGYFDDFTNEADMAKYADVFKRQNKLSTMVNDADIDSKLVGFTFRHRYGKNGSSG 557

Query: 538 ILYNGSEHSDPFATFY 553
           +LYNG E SDPF+TFY
Sbjct: 558 VLYNGLEQSDPFSTFY 573

>YGR092W (DBF2) [2052] chr7 (668191..669909) Serine/threonine
           protein kinase related to Dbf20p, required for events in
           anaphase/telophase, component of the CCR4-NOT
           transcriptional complex [1719 bp, 572 aa]
          Length = 572

 Score =  815 bits (2104), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/496 (77%), Positives = 435/496 (87%), Gaps = 2/496 (0%)

Query: 60  ETELKNSPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYL 119
           + ++ NSPKKLP  FY++A SN T+R+V+VC+MYFL++YCDMFDYVISRRQRTK VL YL
Sbjct: 77  DMDVSNSPKKLPPKFYERATSNKTQRVVSVCKMYFLEHYCDMFDYVISRRQRTKQVLEYL 136

Query: 120 ERNQNSLSTEE--LNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARK 177
           ++     ++++  LN EW++YLQ+EH VLRKRRLKPKN+DFEMIT           LARK
Sbjct: 137 QQQSQLPNSDQIKLNEEWSSYLQREHQVLRKRRLKPKNRDFEMITQVGQGGYGQVYLARK 196

Query: 178 RDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEF 237
           +DTKEVCA             ET HVLTERDILTTTRS+WLVKLLYAFQD +SLYLAMEF
Sbjct: 197 KDTKEVCALKILNKKLLFKLNETKHVLTERDILTTTRSEWLVKLLYAFQDLQSLYLAMEF 256

Query: 238 VPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKL 297
           VPGGDFRTLLINTR L++ HARFYISEMFCAVNALH+LGYTHRDLKPENFLID++GHIKL
Sbjct: 257 VPGGDFRTLLINTRCLKSGHARFYISEMFCAVNALHDLGYTHRDLKPENFLIDAKGHIKL 316

Query: 298 TDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMV 357
           TDFGLAAGTIS ERI+SMKIRLE++K+LEFPAFTEKSIEDRRKMY  LR+ E+NYANSMV
Sbjct: 317 TDFGLAAGTISNERIESMKIRLEKIKDLEFPAFTEKSIEDRRKMYNQLREKEINYANSMV 376

Query: 358 GSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRR 417
           GSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETY+NLR WK+TLRR
Sbjct: 377 GSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYDNLRRWKQTLRR 436

Query: 418 PVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQL 477
           P   +GR AFSDRTWD+ITRLIADPINRLRSFEH+KRM YFA++NF+TLR   PPFTPQL
Sbjct: 437 PRQSDGRAAFSDRTWDLITRLIADPINRLRSFEHVKRMSYFADINFSTLRSMIPPFTPQL 496

Query: 478 DSETDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQKGLSG 537
           DSETDAGYFDDFT+EADMAKYADVFKRQ+KL++MVDDSAV SKLVGFTFRHRNG++G SG
Sbjct: 497 DSETDAGYFDDFTSEADMAKYADVFKRQDKLTAMVDDSAVSSKLVGFTFRHRNGKQGSSG 556

Query: 538 ILYNGSEHSDPFATFY 553
           IL+NG EHSDPF+TFY
Sbjct: 557 ILFNGLEHSDPFSTFY 572

>CAGL0G03047g 282299..283918 highly similar to sp|P22204
           Saccharomyces cerevisiae YGR092w DBF2 ser/thrprotein
           kinase or sp|P32328 Saccharomyces cerevisiae YPR111w
           DBF20, hypothetical start
          Length = 539

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/494 (76%), Positives = 426/494 (86%), Gaps = 2/494 (0%)

Query: 62  ELKNSPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYL-E 120
           EL +SPKKLP  F  KA +N T+R+V VC+MYFL+YYCDMFDYVISRRQRTK ++ YL +
Sbjct: 46  ELLHSPKKLPAGFRSKASNNKTQRLVGVCKMYFLEYYCDMFDYVISRRQRTKQIMEYLRQ 105

Query: 121 RNQNS-LSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRD 179
            N+N  L     + EW  YL +E+++LRKRRLKPKN DFEM+T           LARKRD
Sbjct: 106 ENENGRLDEHTADTEWRGYLAKENNILRKRRLKPKNNDFEMLTQVGQGGYGQVYLARKRD 165

Query: 180 TKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVP 239
           TKEVCA             ETNHVLTERDILTTTRS+WLVKLLYAFQD+ SLYLAMEFVP
Sbjct: 166 TKEVCALKILNKKLLHRLNETNHVLTERDILTTTRSEWLVKLLYAFQDSSSLYLAMEFVP 225

Query: 240 GGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTD 299
           GGDFRTLLINT++L++THARFYISEMFCAVNALHELGYTHRDLKPENFLID++GHIKLTD
Sbjct: 226 GGDFRTLLINTKYLKSTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDAKGHIKLTD 285

Query: 300 FGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGS 359
           FGLAAGT+S ERI+SMKIRLEEVKNLEFPAFTE+ IEDRRKMY  LR T++NYANSMVGS
Sbjct: 286 FGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERPIEDRRKMYHDLRDTDINYANSMVGS 345

Query: 360 PDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPV 419
           PDYMALEVLEGKKYDFTVDYWSLGCMLFESLV +TPFSG++TNETYENLRHW+KTLRRP 
Sbjct: 346 PDYMALEVLEGKKYDFTVDYWSLGCMLFESLVSFTPFSGATTNETYENLRHWRKTLRRPR 405

Query: 420 LDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDS 479
           L NGR A SDRTW  IT LIADPINRL+SFEH+KRMPYF+E++F+ LR+ +PPF PQLDS
Sbjct: 406 LGNGRYAVSDRTWAFITSLIADPINRLKSFEHVKRMPYFSEIDFSKLREMSPPFIPQLDS 465

Query: 480 ETDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQKGLSGIL 539
           E DAGYFDDFTNEADMAKYADVFKRQNKL++M+DDSAVDSKLVGFTFRHRNG+ G SGIL
Sbjct: 466 EVDAGYFDDFTNEADMAKYADVFKRQNKLNAMIDDSAVDSKLVGFTFRHRNGKHGSSGIL 525

Query: 540 YNGSEHSDPFATFY 553
           YNG+EHSDPFATFY
Sbjct: 526 YNGAEHSDPFATFY 539

>Kwal_23.3992
          Length = 571

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/489 (75%), Positives = 416/489 (85%), Gaps = 1/489 (0%)

Query: 66  SPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLERNQ-N 124
           SPKKLP DF++KA S +TKR+VNVCQMYFLDYYCDMFDYVISRR+RT+ V+ YLE+ +  
Sbjct: 83  SPKKLPLDFHRKASSTNTKRLVNVCQMYFLDYYCDMFDYVISRRERTRQVMKYLEQQRTQ 142

Query: 125 SLSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVC 184
            +  EEL+ EW AYL +E  +LRKRRLKPKNKDFEMIT           LARKRDT+E+C
Sbjct: 143 GIVGEELSKEWQAYLTKETGILRKRRLKPKNKDFEMITQVGQGGYGQVYLARKRDTREIC 202

Query: 185 AXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFR 244
           A             ETNHVLTERDILTTTRS+WLVKLLYAFQD  SLYLAMEFVPGGD+R
Sbjct: 203 ALKILNKKLLIKLNETNHVLTERDILTTTRSEWLVKLLYAFQDPSSLYLAMEFVPGGDYR 262

Query: 245 TLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAA 304
           TLLINTRFL+  HARFYISEMFCAV+ALH+LGYTHRDLKPENFLIDS GHIKLTDFGLAA
Sbjct: 263 TLLINTRFLQAPHARFYISEMFCAVDALHQLGYTHRDLKPENFLIDSRGHIKLTDFGLAA 322

Query: 305 GTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMA 364
           GT+S ERI+SMKIRLEEVKNL+FP F EKS+ DRR+MYT+LR+ +VNYA+S VGSPDYMA
Sbjct: 323 GTVSMERIESMKIRLEEVKNLDFPKFEEKSMNDRREMYTNLRENDVNYASSTVGSPDYMA 382

Query: 365 LEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGR 424
           LEVLE K YDFTVDYWSLGC+LFESLVGYTPFSGSSTNETYENLR WK+ LRRP  DNGR
Sbjct: 383 LEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSTNETYENLRCWKQVLRRPRCDNGR 442

Query: 425 PAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSETDAG 484
            AFSDRTWD+I RLIADPI+RLRSFEH+K+M YFAE++F  LR  +PPF PQLD+ETDAG
Sbjct: 443 YAFSDRTWDLIIRLIADPISRLRSFEHVKKMKYFAEISFENLRNVSPPFIPQLDNETDAG 502

Query: 485 YFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSE 544
           YFDDFT+EADMAKYADVFKRQ+KLS+MVDDS   SKLVGFT+RH+ G+ G SG++Y G E
Sbjct: 503 YFDDFTSEADMAKYADVFKRQDKLSAMVDDSDAVSKLVGFTYRHKKGKNGSSGVIYGGPE 562

Query: 545 HSDPFATFY 553
           H+DPFATFY
Sbjct: 563 HADPFATFY 571

>ADR033W [1774] [Homologous to ScYGR092W (DBF2) - SH; ScYPR111W
           (DBF20) - SH] complement(764718..766451) [1734 bp, 577
           aa]
          Length = 577

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/497 (73%), Positives = 422/497 (84%), Gaps = 2/497 (0%)

Query: 59  DETELKNSPKKLPHDFYKKALSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNY 118
           D+ +L  SPKKLP DF+K+A S  TKR+V+VCQM+FLDYYCDMFDYVISRR+RT+ V+NY
Sbjct: 81  DDIDLSRSPKKLPMDFHKRASSTKTKRLVSVCQMFFLDYYCDMFDYVISRRERTRQVMNY 140

Query: 119 LE--RNQNSLSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLAR 176
           LE  R Q   S +E++ EW  YL +E D+LRKRRLKPKNKDFE+IT           LAR
Sbjct: 141 LEQQRAQGLHSAQEISEEWQNYLYRETDILRKRRLKPKNKDFEIITQVGQGGYGQVYLAR 200

Query: 177 KRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAME 236
           K+DTKE+CA              T+HVLTERDILTTTRS+WLVKLLYAFQD  SLYLAME
Sbjct: 201 KKDTKEICALKILNKNLLAKLNGTDHVLTERDILTTTRSEWLVKLLYAFQDPHSLYLAME 260

Query: 237 FVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIK 296
           FVPGGD+RTLLINTRFL+  HARFYISEMFCAV+ALH+LGYTHRDLKPENFLIDS+GHIK
Sbjct: 261 FVPGGDYRTLLINTRFLQAPHARFYISEMFCAVDALHKLGYTHRDLKPENFLIDSKGHIK 320

Query: 297 LTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSM 356
           LTDFGLA+GT+S ERI+SM+IRLEEVKNLEFP F E S++ RRKMY  +R+ E+NYA+S 
Sbjct: 321 LTDFGLASGTVSMERIESMRIRLEEVKNLEFPEFKETSMDYRRKMYHRVREKELNYASST 380

Query: 357 VGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLR 416
           VGSPDYMALEVLE K YDFTVDYWSLGC+LFESLVGYTPFSGSS+NETYENLR WK+ LR
Sbjct: 381 VGSPDYMALEVLEAKNYDFTVDYWSLGCILFESLVGYTPFSGSSSNETYENLRRWKQVLR 440

Query: 417 RPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQ 476
           RP  +NGRPAFSDRTW++ITRLIADPINRLRSFEH+K+M YFAE++F  LR  +PPF PQ
Sbjct: 441 RPRCENGRPAFSDRTWELITRLIADPINRLRSFEHVKKMKYFAEIDFANLRSMSPPFIPQ 500

Query: 477 LDSETDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTFRHRNGQKGLS 536
           LDSETDAGYFDDFTNEADMAKYADVFKRQ+KL++MV++S+  SKLVGFTFRHR G+ G S
Sbjct: 501 LDSETDAGYFDDFTNEADMAKYADVFKRQDKLNAMVEESSNSSKLVGFTFRHRKGKTGSS 560

Query: 537 GILYNGSEHSDPFATFY 553
           G+L+NGSEH+DPFATFY
Sbjct: 561 GVLHNGSEHADPFATFY 577

>KLLA0D14905g 1256065..1257768 gi|28565036|gb|AAO32601.1
           Kluyveromyces lactis DBF2, start by similarity
          Length = 567

 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/526 (70%), Positives = 427/526 (81%), Gaps = 5/526 (0%)

Query: 30  SVTPTRANKENRXXXXXXXXXNKTKRFTADETELKNSPKKLPHDFYKKALSNDTKRIVNV 89
           S +PTR+  +N          +     TAD T+   SPKKLP DFYKK+    +KR+V+V
Sbjct: 45  SPSPTRSIVKNPENSLMDIDDDTQGDLTADITK---SPKKLPKDFYKKSSKTKSKRLVSV 101

Query: 90  CQMYFLDYYCDMFDYVISRRQRTKSVLNYLE--RNQNSLSTEELNNEWTAYLQQEHDVLR 147
           CQMYFLDYYCDMFDYVISRR+RT+ V+NYLE  R  N + TE++ NEW  YL +E ++LR
Sbjct: 102 CQMYFLDYYCDMFDYVISRRERTRQVINYLEEQRRSNLMGTEQITNEWQGYLTKETNILR 161

Query: 148 KRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTER 207
           KRRLKPK+KDFEMIT           LARK+DTKE+CA              T+HVLTER
Sbjct: 162 KRRLKPKHKDFEMITQVGQGGYGQVYLARKKDTKEICALKILNKKLLMKLEGTDHVLTER 221

Query: 208 DILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFC 267
           DILTTTRS+WLVKLLYAFQD +SLYLAMEFVPGGDFRTLL+NT+FL+  HARFYISEMFC
Sbjct: 222 DILTTTRSEWLVKLLYAFQDPQSLYLAMEFVPGGDFRTLLLNTKFLQAPHARFYISEMFC 281

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
           AVNALH+LGYTHRDLKPENFLIDS+GHIKLTDFGLA+GT+S ERI+SMKIRL+EVKNLEF
Sbjct: 282 AVNALHQLGYTHRDLKPENFLIDSKGHIKLTDFGLASGTVSMERIESMKIRLQEVKNLEF 341

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLF 387
           P F E+S++DRR+MY  LR+ EV YA+S VGSPDYMALEVLE K YDFTVDYWSLGC+LF
Sbjct: 342 PEFRERSMDDRRRMYNKLREEEVRYAHSTVGSPDYMALEVLEAKNYDFTVDYWSLGCILF 401

Query: 388 ESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLR 447
           ESLVGYTPFSG+STNETYENLR+WK  L+RP  DNGR AFSDRTW++ITRLIADPINRL+
Sbjct: 402 ESLVGYTPFSGNSTNETYENLRNWKHVLQRPKCDNGRYAFSDRTWELITRLIADPINRLK 461

Query: 448 SFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNK 507
           SFEH+KRM YF+E++FNTLR   PPF PQLD+E D GYFDDFTNE  MA+Y DVFKRQ++
Sbjct: 462 SFEHVKRMRYFSEIDFNTLRTIHPPFIPQLDNEEDVGYFDDFTNEEHMARYVDVFKRQDR 521

Query: 508 LSSMVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEHSDPFATFY 553
           L++MVDDS  DSKLVGFTFRHRNG+ G SG+LY G E SDPFATFY
Sbjct: 522 LTAMVDDSLSDSKLVGFTFRHRNGKDGSSGVLYGGLEQSDPFATFY 567

>AFR035W [3227] [Homologous to ScYNL161W (CBK1) - SH]
           complement(498529..500688) [2160 bp, 719 aa]
          Length = 719

 Score =  218 bits (555), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 146/482 (30%), Positives = 236/482 (48%), Gaps = 41/482 (8%)

Query: 79  LSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLERNQNSLSTEELNNEWTAY 138
           LS  T+      ++   ++Y    ++ I R QR   + + L  +    S E  N + ++ 
Sbjct: 233 LSKSTQEKAAAVKLKVENFYQSSVNHAIERNQRRVELESQLLSH--GWSEERKNRQLSSL 290

Query: 139 LQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXX 198
            ++E   LR RR +   +DF  +            L +K+DT ++ A             
Sbjct: 291 GKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD 350

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  HV  ERD+L  + S W+V L Y+FQD + LYL MEF+PGGD  T+LI  +       
Sbjct: 351 QLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQIFTEDVT 410

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           RFY++E   A+ A+H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G   T      K  
Sbjct: 411 RFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKL 470

Query: 319 LEEVKNLE-------FPAFTEK-----------------SIEDRRKMYTHLRQTEVNYAN 354
           L+E +  +       +PA                     ++ +R++M T  R++    A 
Sbjct: 471 LQEDEQQQNGGNMGKYPASGGGGNGGGNRNTMLVDAIHLTMTNRQQMQT-WRKSRRLMAY 529

Query: 355 SMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKT 414
           S VG+PDY+A E+   + Y    D+WSLG +++E L+G+ PF   +  ETY  + ++++T
Sbjct: 530 STVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQT 589

Query: 415 LRRPVLDNGRPAFSDRTWDIITRLIADPINRL--RSFEHIKRMPYFAEVNFNTLRQSAPP 472
           L  P  D+   ++     D+I RL++    RL       IK  P+F  V++ T+RQ   P
Sbjct: 590 LVFP--DDIHISYEAE--DLIRRLLSHADERLGRHGANEIKNHPFFRGVDWETIRQVGAP 645

Query: 473 FTPQLDSETDAGYF--DDFTNEADMAKYADVFKRQNKLSSMVDDSA------VDSKLVGF 524
           + P+L S TD  +F  D+  N  D    A   K++ ++      +A       D   +G+
Sbjct: 646 YIPKLSSVTDTRFFPTDELENVPDSPAMAQAAKQREQMLKQGGSAANTAQAKEDLPFIGY 705

Query: 525 TF 526
           T+
Sbjct: 706 TY 707

>Kwal_33.14554
          Length = 714

 Score =  217 bits (552), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 148/484 (30%), Positives = 238/484 (49%), Gaps = 43/484 (8%)

Query: 79  LSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLERNQNSLSTEELNNEWTAY 138
           LS  T+      ++   ++Y    +Y I R QR   + + L       S E  + + +  
Sbjct: 226 LSKSTQDKAATVKLKIENFYQSSVNYAIERNQRRVELESQLV--SQDWSDERKSRQLSTL 283

Query: 139 LQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXX 198
            ++E   LR RR +   +DF+ +            L +K+DT ++ A             
Sbjct: 284 GRKESQFLRLRRTRLSLEDFQTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD 343

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  HV  ERD+L  + S W+V L Y+FQDT+ LYL MEF+PGGD  T+LI  +       
Sbjct: 344 QLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQIFTEDVT 403

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           RFY++E   A+ A+H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G   T      K  
Sbjct: 404 RFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKL 463

Query: 319 LEE------VKNLEFPAF----------------------TEKSIEDRRKMYTHLRQTEV 350
           L++        +L+ P                           ++ +R+++ T  R++  
Sbjct: 464 LQQDEVNAAAGSLQKPQMGIVAGNNGGGSGNNRNTMFVDAIHLTMTNRQQIQT-WRKSRR 522

Query: 351 NYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
             A S VG+PDY+A E+   + Y    D+WSLG +++E L+G+ PF   +  ETY  + +
Sbjct: 523 LMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMN 582

Query: 411 WKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRL---RSFEHIKRMPYFAEVNFNTLR 467
           +++TL+ P  D+   ++     D+I RL+     RL      + IK  P+F  V++NT+R
Sbjct: 583 FEQTLQFP--DDIHISYEAE--DLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIR 638

Query: 468 QSAPPFTPQLDSETDAGYF--DDFTNEAD---MAKYADVFKRQNKLSSMVDDSAVDSKLV 522
           Q   P+ P+L S TD  +F  D+  N  D   MA+ A   ++  K  +    S  D   +
Sbjct: 639 QVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAARQREQMMKQGAANPSSKEDLPFI 698

Query: 523 GFTF 526
           G+T+
Sbjct: 699 GYTY 702

>YNL161W (CBK1) [4436] chr14 (332597..334867) Serine/threonine
           protein kinase required for sporulation and production
           of daughter specific proteins [2271 bp, 756 aa]
          Length = 756

 Score =  216 bits (549), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 143/476 (30%), Positives = 232/476 (48%), Gaps = 34/476 (7%)

Query: 79  LSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLERNQNSLSTEELNNEWTAY 138
           L+  T+      ++   ++Y     Y I R +R   +    E   ++ S E  + + ++ 
Sbjct: 275 LTKGTQDKAAAVKLKIENFYQSSVKYAIERNERRVELET--ELTSHNWSEERKSRQLSSL 332

Query: 139 LQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXX 198
            ++E   LR RR +   +DF  +            L +K+DT ++ A             
Sbjct: 333 GKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKKD 392

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  HV  ERD+L  + S W+V L Y+FQD + LYL MEF+PGGD  T+LI  +       
Sbjct: 393 QLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDVT 452

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           RFY++E   A+  +H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G   T      K  
Sbjct: 453 RFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKL 512

Query: 319 LEE-------VKNLEFPAFTEKSIEDRRKMYTH--------------LRQTEVNYANSMV 357
           L++        K   + A T  +   R+ M                  R++    A S V
Sbjct: 513 LQQDEATNGISKPGTYNANTTDTANKRQTMVVDSISLTMSNRQQIQTWRKSRRLMAYSTV 572

Query: 358 GSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRR 417
           G+PDY+A E+   + Y    D+WSLG +++E L+G+ PF   +  ETY  + ++++TL+ 
Sbjct: 573 GTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQF 632

Query: 418 PVLDNGRPAFSDRTWDIITRLIADPINRL---RSFEHIKRMPYFAEVNFNTLRQSAPPFT 474
           P  D+   ++     D+I RL+     RL      + IK  P+F  V++NT+RQ   P+ 
Sbjct: 633 P--DDIHISYEAE--DLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWNTIRQVEAPYI 688

Query: 475 PQLDSETDAGYF--DDFTNEADMAKYADVFKRQNKLSSMVDDSAV--DSKLVGFTF 526
           P+L S TD  +F  D+  N  D    A   K++ +++     + V  D   +G+T+
Sbjct: 689 PKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMTKQGGSAPVKEDLPFIGYTY 744

>KLLA0D07810g complement(669095..671251)
           gi|401646|sp|P31034|YL44_KLULA Kluyveromyces lactis
           Hypothetical 31.8 kDa protein in L44/L41 3 region, start
           by similarity
          Length = 718

 Score =  214 bits (544), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 146/490 (29%), Positives = 233/490 (47%), Gaps = 51/490 (10%)

Query: 79  LSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLERNQNSLSTEELNNEWTAY 138
           L+  T+      ++   ++Y     Y I R QR   + + L       S E  N +  + 
Sbjct: 226 LTKTTQDKAAAVKLKIENFYQSSVGYAIERNQRRLELESELASQ--DWSEERKNRQLASL 283

Query: 139 LQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXX 198
            ++E   LR RR +    DF  +            L +K+DT ++ A             
Sbjct: 284 GKKESQFLRLRRTRLSLDDFNSVKVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYNKD 343

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  HV  ERD+L  + S W+V L Y+FQD++ LYL MEF+PGGD  T+LI  +       
Sbjct: 344 QLAHVKAERDVLAGSDSPWVVSLYYSFQDSQYLYLIMEFLPGGDLMTMLIRWQIFTEDVT 403

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           RFY++E   A+  +H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G   T      K  
Sbjct: 404 RFYMAECILAIEVIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSSYYKKL 463

Query: 319 LEE------------------------------VKNLEFPAFTEKSIEDRRKMYTHLRQT 348
           L+E                               +N         ++ +R++M T  R++
Sbjct: 464 LQEDEAKKQQQQQQQQQQLNLQKPQLPNETNNGNRNTMLVDAIHLTMTNRQQMQT-WRKS 522

Query: 349 EVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENL 408
               A S VG+PDY+A E+   + Y    D+WSLG +++E L+G+ PF   +  ETY  +
Sbjct: 523 RRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRKI 582

Query: 409 RHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRL---RSFEHIKRMPYFAEVNFNT 465
            ++++TL+ P  D+   ++     D+I RL+    NRL      + IK  P+F+ V++NT
Sbjct: 583 MNFEQTLQFP--DDIHISYEAE--DLIRRLLTHSENRLGRHGGADEIKAHPFFSGVDWNT 638

Query: 466 LRQSAPPFTPQLDSETDAGYF--DDFTNEADMAKYADVFKRQNKLSSMVDDSAV------ 517
           +RQ   P+ P+L S TD  +F  D+  N  D    A   +++ ++  M     V      
Sbjct: 639 IRQVEAPYIPKLSSVTDTRFFPTDELENVPDSPAMAQAARQREQM--MTQQQGVPQSNAK 696

Query: 518 -DSKLVGFTF 526
            D   +G+T+
Sbjct: 697 EDLPFIGYTY 706

>CAGL0J06072g complement(572377..574698) similar to sp|P53894
           Saccharomyces cerevisiae YNL161w CBK1, hypothetical
           start
          Length = 773

 Score =  212 bits (540), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 150/477 (31%), Positives = 230/477 (48%), Gaps = 37/477 (7%)

Query: 79  LSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLERNQNSLSTEELNNEWTAY 138
           LS  T+      ++   +YY     Y I R +R   +   L  +  S   EE N    A 
Sbjct: 293 LSKSTQDKAAAVKLKVENYYQQSVKYAIERNERRVELETELGSHNWS---EERNARQLAS 349

Query: 139 L-QQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXX 197
           L ++E   LR RR +   +DF  +            L +K+DT ++ A            
Sbjct: 350 LGKKESQFLRLRRTRLSLEDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMKTLLKSEMYKK 409

Query: 198 XETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTH 257
            +  HV  ERD+L  T S W+V L Y+FQD + LYL MEF+PGGD  T+LI  +      
Sbjct: 410 DQLAHVKAERDVLAGTDSPWIVSLYYSFQDAQYLYLIMEFLPGGDLMTMLIRWQLFTEDV 469

Query: 258 ARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKI 317
            RFY++E   A+  +H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G   T      K 
Sbjct: 470 TRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKK 529

Query: 318 RLEE----VKNLEFPAFTEKS--------------IEDRRKMYTHLRQTEVNYANSMVGS 359
            L++     KN       + S              + +R+++ T  R++    A S VG+
Sbjct: 530 LLQQDEATTKNGAPNDAGDGSNNRQTMIVDSINLTMSNRQQIQT-WRKSRRLMAYSTVGT 588

Query: 360 PDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPV 419
           PDY+A E+   + Y    D+WSLG +++E L+G+ PF   +  ETY  + ++++TL+ P 
Sbjct: 589 PDYIAPEIFLYQGYGQDCDWWSLGAIMYECLIGWPPFCSETPQETYRKIMNFEQTLQFPE 648

Query: 420 LDNGRPAFSDRTWDIITRLIADPINRL---RSFEHIKRMPYFAEVNFNTLRQSAPPFTPQ 476
                   S    D+I RL+     RL      + IK  P+F  V++NT+RQ   P+ P+
Sbjct: 649 ----DVHISYEAEDLIRRLLTHSNQRLGRQGGADEIKSHPFFRGVDWNTIRQVEAPYIPK 704

Query: 477 LDSETDAGYF--DDFTNEADMAKYADVFKR-----QNKLSSMVDDSAVDSKLVGFTF 526
           L S TD  +F  D+  N  D    A   K+     +N ++   +    D   +G+T+
Sbjct: 705 LSSITDTRFFPTDELENVPDSPAMAQAAKQREQMMKNGVNPNQNQVKEDLPFIGYTY 761

>Scas_654.12
          Length = 737

 Score =  208 bits (529), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 147/491 (29%), Positives = 234/491 (47%), Gaps = 50/491 (10%)

Query: 79  LSNDTKRIVNVCQMYFLDYYCDMFDYVISRRQRTKSVLNYLERNQNSLSTEELNNEWTAY 138
           L+  T+      ++   ++Y     Y I R +R   +   L  +    S E  N +  + 
Sbjct: 242 LTKSTQDKAAAIKLKIENFYQSSVKYAIERNERRVELETELASH--DWSEERRNRQLASL 299

Query: 139 LQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXX 198
            ++E   LR RR +   +DF  +            L +K DT ++ A             
Sbjct: 300 GKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKIDTGKIYAMKTLLKSEMYKKD 359

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  HV  ERD+L  + S W+V L Y+FQDT+ LYL MEF+PGGD  T+LI  +       
Sbjct: 360 QLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTMLIRWQLFTEDVT 419

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           RFY++E   A+  +H+LG+ HRD+KP+N LID  GHIKL+DFGL+ G   T      K  
Sbjct: 420 RFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTGFHKTHDSNYYKKL 479

Query: 319 LEE----VKNLEFPAFTEK---------------------------SIEDRRKMYTHLRQ 347
           L+E       L  P                                ++ +R+++ T  R+
Sbjct: 480 LQEDEANTTGLSKPGQPGNINNDGSSNADGSNKENRQSMMVDSINLTMSNRQQIQT-WRK 538

Query: 348 TEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYEN 407
           +    A S VG+PDY+A E+   + Y    D+WSLG +++E L+G+ PF   +  ETY  
Sbjct: 539 SRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSETPQETYRK 598

Query: 408 LRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRL---RSFEHIKRMPYFAEVNFN 464
           + ++++TL+ P  D+   ++     D+I RL+     RL      + IK  P+F  V++N
Sbjct: 599 IMNFEQTLQFP--DDIHISYEAE--DLIRRLLTHADQRLGRHGGADEIKSHPFFRGVDWN 654

Query: 465 TLRQSAPPFTPQLDSETDAGYF--DDFTNEAD---MAKYADVFKRQNKLSSMVDDSAVDS 519
           T+RQ   P+ P+L S TD  +F  D+  N  D   MA+ A   ++  K    V+ +   +
Sbjct: 655 TIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMMKQGGPVNGNNTPT 714

Query: 520 K----LVGFTF 526
           K     +G+T+
Sbjct: 715 KEDLPFIGYTY 725

>YMR104C (YPK2) [4061] chr13 complement(473419..475452)
           Serine/threonine protein kinase with similarity to
           Ypk1p, involved in the cell integrity signaling pathway
           [2034 bp, 677 aa]
          Length = 677

 Score =  160 bits (405), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 102/353 (28%), Positives = 163/353 (46%), Gaps = 56/353 (15%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DF+++              RK+DT+++ A             E  H L ER +L      
Sbjct: 343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLARVDCP 402

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           ++V L ++FQ  E LYL + F+ GG+    L +        +RFYI+E+ CA+++LH+L 
Sbjct: 403 FIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLD 462

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 463 VIYRDLKPENILLDYQGHIALCDFGLCK-------------------------------- 490

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
                   L   + +  ++  G+P+Y+A E+L G+ Y  TVD+W+LG +L+E + G  P+
Sbjct: 491 --------LNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPY 542

Query: 397 SGSSTNETYENLRHWKKTLRRPVL--DNGRPAFSDRTWDIITRLIADPINRL--RSFEHI 452
              +    Y      KK L++P+L  D   PA  D    +++R   DP  RL     + I
Sbjct: 543 YDENVPVMY------KKILQQPLLFPDGFDPAAKDLLIGLLSR---DPSRRLGVNGTDEI 593

Query: 453 KRMPYFAEVNFNT--LRQSAPPFTPQLDSETDAGYFD-DFTNEADMAKYADVF 502
           +  P+F ++++    L+   PP+ P + SE D   FD +FT E  +    D +
Sbjct: 594 RNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEY 646

>CAGL0C03509g complement(350846..353533) similar to sp|P53739
           Saccharomyces cerevisiae YNR047w or sp|P25341
           Saccharomyces cerevisiae YCR091w KIN82, hypothetical
           start
          Length = 895

 Score =  161 bits (407), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 157/294 (53%), Gaps = 36/294 (12%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDF-RTLLI-NTRFLRNTHARF 260
           +L E++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    ++ +    A+F
Sbjct: 542 ILAEQEILATSNHPFVVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKF 601

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
           Y SE+  A+  LH LG+ +RDLKPEN L+   GHI L+DF L+        IQ+   ++ 
Sbjct: 602 YASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLS--------IQAKDAKVP 653

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYW 380
            VK        + ++ D +      R       NS VG+ +Y+A EV+ G  +   VD+W
Sbjct: 654 VVK-----GNAQSTVVDTKICSDGFR------TNSFVGTEEYIAPEVIRGNGHTAAVDWW 702

Query: 381 SLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LI 439
           +LG +++E L G+TPF G +TNET+ N+      L++ V        S    D+I + LI
Sbjct: 703 TLGILIYEMLFGFTPFKGENTNETFSNI------LKKDVTFPNNNEVSRNCKDLIKKLLI 756

Query: 440 ADPINRLRS---FEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSETDAGYFDDFT 490
            +   RL S      IK+ P+F +VN+  LR   PP  P L   T+ GY  DFT
Sbjct: 757 KNESKRLGSKMGAADIKKHPFFKKVNWTLLRNQEPPLIPVL---TENGY--DFT 805

>YNR047W (YNR047W) [4630] chr14 (708522..711203) Serine/threonine
           protein kinase of unknown function [2682 bp, 893 aa]
          Length = 893

 Score =  159 bits (401), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 119/377 (31%), Positives = 179/377 (47%), Gaps = 54/377 (14%)

Query: 147 RKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXX 194
           R RRL+ K+            + FE I            L R++ T  V A         
Sbjct: 473 RSRRLRTKSFSNKFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKKTNRVYALKVLSKDEM 532

Query: 195 XXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDF-RTLLI-NTRF 252
               +   VLTE++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    T+ 
Sbjct: 533 IKRNKIKRVLTEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKC 592

Query: 253 LRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERI 312
           +    ARFY SE+  A+  LH LG+ +RDLKPEN L+   GHI L+DF L+        I
Sbjct: 593 ICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFDLS--------I 644

Query: 313 QSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK 372
           Q+   ++  VK        + ++ D +      R       NS VG+ +Y+A EV+ G  
Sbjct: 645 QAKDSKVPVVK-----GSAQSTLVDTKICSDGFR------TNSFVGTEEYIAPEVIRGNG 693

Query: 373 YDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTW 432
           +   VD+W+LG +++E L G+TPF G +TNET+ N+      L+  V        S    
Sbjct: 694 HTAAVDWWTLGILIYEMLFGFTPFKGDNTNETFTNI------LKNEVSFPNNNEISRTCK 747

Query: 433 DIITRLIA-DPINRL---RSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSETDAGYFDD 488
           D+I +L+  +   RL        +K+ P+F +V ++ LR   PP  P L   ++ GY   
Sbjct: 748 DLIKKLLTKNESKRLGCKMGAADVKKHPFFKKVQWSLLRNQEPPLIPVL---SEDGY--- 801

Query: 489 FTNEADMAKYADVFKRQ 505
                D AK +   KRQ
Sbjct: 802 -----DFAKLSSNKKRQ 813

>YCR091W (KIN82) [614] chr3 (274400..276562) Serine/threonine
           protein kinase with unknown role [2163 bp, 720 aa]
          Length = 720

 Score =  157 bits (397), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 165/350 (47%), Gaps = 46/350 (13%)

Query: 147 RKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXX 194
           R RRL+ K+            + FE I            L R+RDT ++ A         
Sbjct: 301 RSRRLRTKSFGNKFQDITVEPQSFEKIRLLGQGDVGKVYLMRERDTNQIFALKVLNKHEM 360

Query: 195 XXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDF-RTLLI-NTRF 252
               +   VLTE++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    ++ 
Sbjct: 361 IKRKKIKRVLTEQEILATSDHPFIVTLYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKC 420

Query: 253 LRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERI 312
           +    A+FY SE+  A+  LH LG+ +RDLKPEN L+   GH+ L+DF L+     +++ 
Sbjct: 421 IAEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQATGSKK- 479

Query: 313 QSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK 372
                          P   + +  D +      R       NS VG+ +Y+A EV+ G  
Sbjct: 480 ---------------PTMKDSTYLDTKICSDGFR------TNSFVGTEEYLAPEVIRGNG 518

Query: 373 YDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTW 432
           +   VD+W+LG +++E L G TPF G ++NET+ N+      L + V        S    
Sbjct: 519 HTAAVDWWTLGILIYEMLFGCTPFKGDNSNETFSNI------LTKDVKFPHDKEVSKNCK 572

Query: 433 DIITRLI----ADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLD 478
           D+I +L+    A  +        IKR P+F +V ++ LR   PP  P L+
Sbjct: 573 DLIKKLLNKNEAKRLGSKSGAADIKRHPFFKKVQWSFLRNQDPPLIPALN 622

>Scas_720.103
          Length = 804

 Score =  156 bits (395), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 150/284 (52%), Gaps = 25/284 (8%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDF-RTLLI-NTRFLRNTHARF 260
           V+TE++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L   +++ +    ARF
Sbjct: 450 VITEQEILATSNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRDSKCICEDDARF 509

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
           Y SE+  A+  LH LG+ +RDLKPEN L+   GHI L+DF L+     ++    MK  + 
Sbjct: 510 YASEVLAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVHAKDSKNPIFMKDGI- 568

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYW 380
                  P      I D +      R       NS VG+ +Y+A EV+ G  +   VD+W
Sbjct: 569 ------LPTTNSNLIVDTKICSEGFR------TNSFVGTEEYIAPEVIRGNGHTVAVDWW 616

Query: 381 SLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA 440
           +LG ++FE L G TPF G +TNET+ N+    K    P  ++     +    ++I +L+ 
Sbjct: 617 TLGILIFEMLFGKTPFKGDTTNETFANI--LSKDFEFPNSND----ITRNCKNLIKKLLT 670

Query: 441 -DPINRLRS---FEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSE 480
            +   RL S      IK+  +F  VN+N LR   PP  P+L S+
Sbjct: 671 KNETKRLGSKMGAAEIKKHSFFKNVNWNMLRNEEPPLIPELSSD 714

>Scas_629.16
          Length = 918

 Score =  155 bits (393), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 170/354 (48%), Gaps = 43/354 (12%)

Query: 142 EHDVLRKRRLKPKN------------KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXX 189
           E +  R RRL+ K+            + FE I            L R++ T  + A    
Sbjct: 491 EEEPKRSRRLRNKSFSNKFKDITVGPQSFEKIKLLGQGDVGKVYLVREKKTNRLYALKIF 550

Query: 190 XXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDF-RTLLI 248
                    +   +L E++IL T+   ++V L ++FQ  + LY  ME+  GG+F R L  
Sbjct: 551 SKSEMIKRKKIKRILAEQEILATSNHPFVVTLYHSFQSEDYLYFCMEYCMGGEFFRALQT 610

Query: 249 N-TRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTI 307
             T+ +    ARFY SE+  A+  LH LG+ +RDLKPEN L+   GHI L+DF L+    
Sbjct: 611 RRTKCISEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLS---- 666

Query: 308 STERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEV 367
               +Q+   ++  +K        E ++ D +      R       NS VG+ +Y+A EV
Sbjct: 667 ----VQAKDAKVPVMK-----GSAESTVVDTKICSDGFR------TNSFVGTEEYIAPEV 711

Query: 368 LEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAF 427
           + G  +   VD+W+LG +++E L G+TPF GSS+NET+ N+      L+  V        
Sbjct: 712 IRGNGHTAAVDWWTLGILIYEMLFGFTPFKGSSSNETFSNI------LKNDVSFPNNNDI 765

Query: 428 SDRTWDIITRLIA-DPINRLRS---FEHIKRMPYFAEVNFNTLRQSAPPFTPQL 477
           S    D+I +L+  +   RL S      +KR P+F +V ++ LR   PP  P L
Sbjct: 766 SRNCKDLIKKLLCKNEAKRLGSKMGAADVKRHPFFKKVQWSFLRNQEPPLIPIL 819

>KLLA0C18568g 1639958..1642282 gi|6967028|emb|CAB72435.1
           Kluyveromyces lactis MUP1 protein, hypothetical start
          Length = 774

 Score =  155 bits (391), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 103/328 (31%), Positives = 160/328 (48%), Gaps = 31/328 (9%)

Query: 156 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRS 215
           + FE I            L R++ T  + A             +   +LTE++IL T+  
Sbjct: 377 QSFEKIRLLGQGDVGRVYLVREKQTNRLYALKIFSKPEMIKRKKIKRILTEQEILATSNH 436

Query: 216 DWLVKLLYAFQDTESLYLAMEFVPGGDF-RTLLI-NTRFLRNTHARFYISEMFCAVNALH 273
            ++V L ++FQ  + LYL ME+  GG+F R L    T+ +    ARFY SE+  A+  LH
Sbjct: 437 PFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARFYSSEVTAALEYLH 496

Query: 274 ELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEK 333
            +G+ +RDLKPEN L+   GHI L+DF L+             ++ ++ KN +       
Sbjct: 497 LMGFIYRDLKPENILLHQSGHIMLSDFDLS-------------VQAKDTKNPQVKGNASH 543

Query: 334 SIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGY 393
           S+ D +      R       NS VG+ +Y+A EV+ G  +   VD+W+LG +++E L G+
Sbjct: 544 SLVDTKICSDGFR------TNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGF 597

Query: 394 TPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRLRS---F 449
           TPF G +TN+T+ N+      L+  V+       S    D+I + LI +   RL S    
Sbjct: 598 TPFKGDNTNQTFSNI------LKNEVVIPNNNETSRACKDLIRKLLIKNENKRLGSKLGA 651

Query: 450 EHIKRMPYFAEVNFNTLRQSAPPFTPQL 477
             IK+ P+F    ++ LR   PP  P L
Sbjct: 652 SDIKKHPFFKNDQWSLLRNQEPPLIPVL 679

>Kwal_23.6458
          Length = 868

 Score =  155 bits (392), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 160/308 (51%), Gaps = 36/308 (11%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDF-RTLLI-NTRFLRNTHARF 260
           +L E++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    T+ +    ARF
Sbjct: 509 ILAEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCIDEDDARF 568

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
           Y SE+  A+  LH +G+ +RDLKPEN L+   GHI L+DF L+             ++ +
Sbjct: 569 YSSEVVAAIEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLS-------------VQAK 615

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYW 380
           + KN       + S+ D +      R       NS VG+ +Y+A EV+ G  +   VD+W
Sbjct: 616 DTKNPVVKGSAQSSLLDTKICSDGFR------TNSFVGTEEYIAPEVIRGNGHTAAVDWW 669

Query: 381 SLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LI 439
           +LG +++E L G+TP+ G +TN+T+ N+      L+  V        S    D+I + LI
Sbjct: 670 TLGILIYEMLFGFTPYKGDNTNKTFSNV------LKNEVSFPNNNEVSRNCKDLIRKLLI 723

Query: 440 ADPINRLRS---FEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSETDAGYFDDFTNEADMA 496
                RL S      IK+ P+F +V ++ LR   PP  P L   T+ GY  DFT  ++  
Sbjct: 724 KSETRRLGSKFGASDIKKHPFFKKVQWSLLRNQEPPLIPVL---TENGY--DFTRLSNNV 778

Query: 497 KYADVFKR 504
              ++ K+
Sbjct: 779 NKGNIRKQ 786

>ADR167W [1909] [Homologous to ScYNR047W - SH; ScYCR091W (KIN82) -
           SH] complement(994583..997204) [2622 bp, 873 aa]
          Length = 873

 Score =  154 bits (388), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 102/302 (33%), Positives = 157/302 (51%), Gaps = 35/302 (11%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDF-RTLLI-NTRFLRNTHARF 260
           +L E++IL T+   ++V L ++FQ  + LYL ME+  GG+F R L    T+ +    ARF
Sbjct: 506 ILAEQEILATSNHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKTKCISEDDARF 565

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
           Y SE+  A+  LH +G+ +RDLKPEN L+   GH+ L+DF L+        +Q+   R  
Sbjct: 566 YASEVTAALEYLHLMGFIYRDLKPENILLHQSGHVMLSDFDLS--------VQAKGTRNP 617

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYW 380
           +VK        + S+ D +      R       NS VG+ +Y+A EV+ G  +  +VD+W
Sbjct: 618 QVK-----GNAQSSLVDTKVCSDGFR------TNSFVGTEEYIAPEVIRGNGHTASVDWW 666

Query: 381 SLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LI 439
           +LG + +E L G+TPF G +TN+T+ N+      L+  V        S    D+I + L+
Sbjct: 667 TLGILTYEMLFGFTPFKGDNTNQTFSNI------LKNDVYFPNNNDISRTCKDLIKKLLV 720

Query: 440 ADPINRLRS---FEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSETDAGY-FDDFTNEADM 495
                RL S      IK+ P+F  V +  LR   PP  P L   T+ GY F   +++ D+
Sbjct: 721 KKESKRLGSKFGASEIKKHPFFKTVQWALLRNQEPPLIPVL---TEDGYDFAKLSHKKDV 777

Query: 496 AK 497
            K
Sbjct: 778 KK 779

>Kwal_47.16761
          Length = 744

 Score =  152 bits (385), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 112/381 (29%), Positives = 173/381 (45%), Gaps = 64/381 (16%)

Query: 156 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRS 215
           +DFE++              RK+DTK + A             E  H + ER+IL  T S
Sbjct: 332 QDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTAS 391

Query: 216 D---WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNA 271
               ++V L ++FQ    LYL  +F+ GG+ F  L    RF  +  ARFYI+E+  A+  
Sbjct: 392 KSCPFIVGLKFSFQTPADLYLVTDFMSGGELFWHLQKEGRFAED-RARFYIAELVLALEY 450

Query: 272 LHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFT 331
           LHE    +RDLKPEN L+D+ G+I L DFGL                            +
Sbjct: 451 LHENDIVYRDLKPENILLDANGNIALCDFGL----------------------------S 482

Query: 332 EKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKYDFTVDYWSLGCMLFESL 390
           +  ++DR               N+  G+ +Y+A E +L+   Y   VD+WSLG ++FE  
Sbjct: 483 KADLKDR--------------TNTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMC 528

Query: 391 VGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFE 450
            G++PF      + Y+ +   K    R VL     +F      +   L  +P +RL + +
Sbjct: 529 CGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSF------VKGLLNRNPRHRLGAID 582

Query: 451 ---HIKRMPYFAEVNFNTLRQS--APPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQ 505
               ++  P+FAE+++  LRQ    PPF P L  ETD   FD      +  + +  F  +
Sbjct: 583 DGRELRAHPFFAEIDWEALRQKKIPPPFKPHLTGETDTSNFD-----PEFTQTSTSFMNK 637

Query: 506 NKLSSMVDDSAVDSKLVGFTF 526
             +++     A+ +K VGFTF
Sbjct: 638 QGIAATPLSPAMQAKFVGFTF 658

>CAGL0K07458g complement(736336..738450) similar to sp|P12688
           Saccharomyces cerevisiae YKL126w or sp|P18961
           Saccharomyces cerevisiae YMR104c ser/thr-specific
           protein kinases, start by similarity
          Length = 704

 Score =  151 bits (382), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 109/379 (28%), Positives = 174/379 (45%), Gaps = 70/379 (18%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DFE++T             RK+DT+++ A             E  H L ER IL      
Sbjct: 376 DFELLTVLGKGSYGKVMQVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECP 435

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           ++V L + FQ  E LYL +  + GG+    L        + ARFY SE+  A+++LH++ 
Sbjct: 436 FIVPLKFTFQTPEKLYLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMD 495

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
             +RDLKPEN L+DS+GHI L DFGL                             + +++
Sbjct: 496 VVYRDLKPENILLDSQGHIALCDFGLC----------------------------KLNMK 527

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
           D  K  T              G+P+Y+A EVL GK Y   VD+W+LG +L+E L G  P+
Sbjct: 528 DNEKTST------------FCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPY 575

Query: 397 SGSSTNETYENLRHWKKTLRRPVL--DNGRPAFSDRTWDIITRLIADPINRLRS--FEHI 452
              + +E Y      KK L+ P++  D   P   D    ++ R   DP  RL +   + I
Sbjct: 576 YDENVSEMY------KKILKSPLIFPDGMDPDAKDLLKRLLNR---DPNRRLGANGADEI 626

Query: 453 KRMPYFAEVNFNTL--RQSAPPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLSS 510
           K   +F ++ ++++  ++  PPF P + +  D   FD   NE         F +Q  + S
Sbjct: 627 KNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFD---NE---------FTKQKPVDS 674

Query: 511 MVDD---SAVDSKLVGFTF 526
           ++D+    +V ++  G+++
Sbjct: 675 VIDEYLSESVQNQFKGWSY 693

>ABL028W [564] [Homologous to ScYKL126W (YPK1) - SH; ScYMR104C
           (YPK2) - SH] complement(345955..348123) [2169 bp, 722
           aa]
          Length = 722

 Score =  151 bits (382), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 108/395 (27%), Positives = 168/395 (42%), Gaps = 78/395 (19%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DF+++              +K+DT ++ A             E  H L ER +L    + 
Sbjct: 388 DFDLLKVIGKGSFGKVMQVKKKDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 447

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           ++V L ++FQ  E LYL + F+ GG+    L        + ARFY +E+ CA+  LH L 
Sbjct: 448 FIVPLKFSFQSPEKLYLVLAFINGGELFFHLQKEGRFDLSRARFYTAELLCALETLHSLN 507

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
             +RDLKPEN L+D +GHI L DFGL                                  
Sbjct: 508 VIYRDLKPENILLDYQGHIALCDFGLC--------------------------------- 534

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
                   L   + +  N+  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P+
Sbjct: 535 -------KLNMKDQDKTNTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPY 587

Query: 397 SGSSTNETYENLRHWKKTLRRPV-LDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEHI 452
                 + Y      KK L+ P+   +G   F     +++  L+  DP  RL     + I
Sbjct: 588 YDEDVPKMY------KKILQEPLRFPDG---FDREAKNLLIELLCRDPKRRLGYNGADEI 638

Query: 453 KRMPYFAEVNFNTL--RQSAPPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLSS 510
           KR P+F+++++  L  +   PP+ P + S  D   FD              F R+  + S
Sbjct: 639 KRHPFFSQLSWKRLWMKGYIPPYKPPVMSALDTSNFD------------QEFTREKPVDS 686

Query: 511 MVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEH 545
           +V+D           F   + Q+   G  Y GSE 
Sbjct: 687 VVND-----------FLSESVQQQFGGWTYVGSEQ 710

>KLLA0B07205g complement(624606..625973) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3
           cAMP-dependent protein kinase 3, catalytic chain,
           hypothetical start
          Length = 455

 Score =  148 bits (373), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 101/344 (29%), Positives = 160/344 (46%), Gaps = 59/344 (17%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DF+++            L R        A             +  H   ER++L+     
Sbjct: 144 DFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTNDERNMLSIVSHP 203

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           +++++   FQD++ L++ M+++ GG+  +LL  ++   N  A+FY +E+  A+  LH  G
Sbjct: 204 FIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKG 263

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
             +RDLKPEN L+D  GHIKLTDFG A                             K + 
Sbjct: 264 IIYRDLKPENILLDKNGHIKLTDFGFA-----------------------------KYVP 294

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
           D            V Y  ++ G+PDY+A EV+  K Y+ +VD+WS G +++E L GYTPF
Sbjct: 295 D------------VTY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPF 340

Query: 397 SGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA-DPINRLRSF----EH 451
             S+T +TYEN+      L  PV     P F     D+I++LI  D   RL +     E 
Sbjct: 341 YDSNTIKTYENI------LNAPV--RFPPFFHSDAQDLISKLITRDLSQRLGNLQNGSED 392

Query: 452 IKRMPYFAEVNFNTL--RQSAPPFTPQLDS-ETDAGYFDDFTNE 492
           +K  P+F+EV +  L  +    P+ P + + + D   +D +  E
Sbjct: 393 VKNHPWFSEVVWEKLLCKNIETPYEPPIQAGQGDTSQYDRYPEE 436

>Scas_651.18
          Length = 371

 Score =  145 bits (367), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 95/302 (31%), Positives = 150/302 (49%), Gaps = 59/302 (19%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  H   ER +L+     +LV++   FQD E +++ M+++ GG+  +LL  ++   N  A
Sbjct: 100 QVEHTNDERLMLSVVSHPFLVRMWGTFQDFEQVFMIMDYIEGGELFSLLRKSQRFPNPVA 159

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           +FY +E+  A+  LH +   +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 160 KFYAAEVCLALEYLHSMDIIYRDLKPENILLDKNGHIKITDFGFA--------------- 204

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378
                         K + D            + Y  ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 205 --------------KYVPD------------ITY--TLCGTPDYIAPEVVSTKPYNKSVD 236

Query: 379 YWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRL 438
           +WS G +++E L GYTPF  S+T +TYEN+ + K  L+ P        F D   D++++L
Sbjct: 237 WWSFGILIYEMLAGYTPFYDSNTMKTYENILNCK--LKFPNF------FHDDVKDLLSKL 288

Query: 439 IADPI-----NRLRSFEHIKRMPYFAEVNFNTL--RQSAPPFTPQL-DSETDAGYFDDFT 490
           I   +     N     E +KR P+F+EV +  L  R    P+ P +   + D   FD + 
Sbjct: 289 ITKNLTERLGNLQNGSEDVKRHPWFSEVIWEKLLSRNIETPYEPPIQQGQGDTSQFDRYP 348

Query: 491 NE 492
            E
Sbjct: 349 EE 350

>CAGL0K03399g complement(310487..312598) highly similar to sp|P12688
           Saccharomyces cerevisiae YKL126w
           Serine/threonine-protein kinase, start by similarity
          Length = 703

 Score =  150 bits (380), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 113/396 (28%), Positives = 178/396 (44%), Gaps = 80/396 (20%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DF+++              RK+DTK++ A             E  H L ER +L      
Sbjct: 369 DFDLLKVIGKGSFGKVMQVRKKDTKKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCP 428

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275
           ++V L ++FQ  E LYL +  + GG+ F  L    RF   + +RFY +E+ CA++ LH++
Sbjct: 429 FIVPLKFSFQSQEKLYLVLACINGGELFYHLQREGRF-DLSRSRFYAAELLCALDTLHKM 487

Query: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335
              +RDLKPEN L+D +GHI L DFGL             K+ +++              
Sbjct: 488 DVIYRDLKPENILLDYQGHIALCDFGLC------------KLNMKD-------------- 521

Query: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395
           ED+               ++  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P
Sbjct: 522 EDK--------------TDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPP 567

Query: 396 FSGSSTNETYENLRHWKKTLRRP-VLDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEH 451
           +   +  + Y      KK L+ P V  +G   F     D++  L++ DP  RL     + 
Sbjct: 568 YYDENVPKMY------KKILQDPLVFPDG---FDRDAKDLLIGLLSRDPQRRLGYNGADE 618

Query: 452 IKRMPYFAEVNFNTLRQSA--PPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLS 509
           IK  P+F+++++  L      PP+ P + S TD   FD              F R+  + 
Sbjct: 619 IKNHPFFSQLSWKRLLMKGYIPPYKPPVTSATDTSNFD------------QEFTREKPID 666

Query: 510 SMVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEH 545
           S+VD+           +   + QK   G  Y GSE 
Sbjct: 667 SVVDE-----------YLSESVQKQFGGWTYVGSEQ 691

>YJL164C (TPK1) [2757] chr10 complement(109959..111152) Catalytic
           subunit of cAMP-dependent protein kinase 1, protein
           kinase A or PKA [1194 bp, 397 aa]
          Length = 397

 Score =  144 bits (364), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 103/362 (28%), Positives = 165/362 (45%), Gaps = 65/362 (17%)

Query: 156 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRS 215
           K+F+++            L R R      A             +  H   ER +L+    
Sbjct: 85  KNFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTH 144

Query: 216 DWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275
            +++++   FQD + +++ M+++ GG+  +LL  ++   N  A+FY +E+  A+  LH  
Sbjct: 145 PFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSK 204

Query: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335
              +RDLKPEN L+D  GHIK+TDFG A                             K +
Sbjct: 205 DIIYRDLKPENILLDKNGHIKITDFGFA-----------------------------KYV 235

Query: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395
            D            V Y  ++ G+PDY+A EV+  K Y+ ++D+WS G +++E L GYTP
Sbjct: 236 PD------------VTY--TLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTP 281

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA-DPINRLRSF----E 450
           F  S+T +TYE + +    LR P      P F++   D+++RLI  D   RL +     E
Sbjct: 282 FYDSNTMKTYEKILN--AELRFP------PFFNEDVKDLLSRLITRDLSQRLGNLQNGTE 333

Query: 451 HIKRMPYFAEVNFNTL--RQSAPPFTPQL-DSETDAGYFDDFTNE------ADMAKYADV 501
            +K  P+F EV +  L  R    P+ P +   + D   FD +  E           YAD+
Sbjct: 334 DVKNHPWFKEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDKYPEEDINYGVQGEDPYADL 393

Query: 502 FK 503
           F+
Sbjct: 394 FR 395

>Scas_689.25*
          Length = 409

 Score =  144 bits (362), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 152/302 (50%), Gaps = 59/302 (19%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  H   ER +L+ +   ++V+L   FQD+E L++ M++V GG+  +LL  ++   N  A
Sbjct: 140 QVEHTNDERRMLSVSVHAFIVRLWGTFQDSEHLFMIMDYVEGGELFSLLRRSQRFPNPVA 199

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           +FY +E+  A++ LH L   +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 200 KFYAAEVCLALDYLHSLDIIYRDLKPENLLLDRNGHIKVTDFGFA--------------- 244

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378
                         K + D            V Y  ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 245 --------------KYVPD------------VTY--TLCGTPDYIAPEVISAKPYNKSVD 276

Query: 379 YWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRL 438
           +WS G +++E L G+TPF  SST +TYEN+      L+ P        F+    D+++RL
Sbjct: 277 WWSFGILIYEMLSGHTPFYDSSTMKTYENI--LNAPLKFP------KYFTPDAQDLLSRL 328

Query: 439 IA-DPINRLRSF----EHIKRMPYFAEVNFNTL--RQSAPPFTPQL-DSETDAGYFDDFT 490
           I  D   RL +     E IK   +F+EV ++ L  R    P+ P +   + D   FD + 
Sbjct: 329 ITRDLTERLGNLQNGTEDIKNHAWFSEVIWDKLLDRCIETPYEPPIQQGQGDTSQFDRYP 388

Query: 491 NE 492
            E
Sbjct: 389 EE 390

>Scas_703.5
          Length = 749

 Score =  148 bits (374), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 113/399 (28%), Positives = 181/399 (45%), Gaps = 67/399 (16%)

Query: 139 LQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXX 198
           ++ E+   +KR   P   DFE++              +K+DTK + A             
Sbjct: 327 IKWEYSSTKKRHYGPN--DFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKN 384

Query: 199 ETNHVLTERDILTTTR---SDWLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLR 254
           E  H + ER+IL TT    S ++V L ++FQ    LYL  +F+ GG+ F  L    RF  
Sbjct: 385 EVAHTIGERNILVTTATKASPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTE 444

Query: 255 NTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQS 314
              A+FYI+E+  A+  LH+    +RDLKPEN L+D+ G+I L DFGL            
Sbjct: 445 E-RAKFYIAELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGL------------ 491

Query: 315 MKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKY 373
                           ++  ++DR               N+  G+ +Y+A E +L+   Y
Sbjct: 492 ----------------SKADLKDR--------------TNTFCGTTEYLAPELLLDEAGY 521

Query: 374 DFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWD 433
              VD+WSLG ++FE   G++PF      + Y+ +   K    R VL     +F      
Sbjct: 522 TKMVDFWSLGVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSF------ 575

Query: 434 IITRLIADPINRLRSFE---HIKRMPYFAEVNFNTLRQS--APPFTPQLDSETDAGYFD- 487
           +   L  +P +RL + +    ++  P+FA+++++ LR+    PPF P L SETD   FD 
Sbjct: 576 VKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWDALREKKIPPPFKPHLVSETDTSNFDP 635

Query: 488 DFTNEADMAKYADVFKRQNKLSSMVDDSAVDSKLVGFTF 526
           +FT  +          +   +++     A+ +K  GFTF
Sbjct: 636 EFTQTS-----TSYMNKHQPIAATPLSPAMQAKFAGFTF 669

>YHR205W (SCH9) [2490] chr8 (509361..511835) Serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway that is probably
           parallel to cAMP pathway, affects life span [2475 bp,
           824 aa]
          Length = 824

 Score =  148 bits (373), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 112/390 (28%), Positives = 180/390 (46%), Gaps = 64/390 (16%)

Query: 147 RKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTE 206
           +KR   P+  DFE++              +K+DT+ + A             E  H + E
Sbjct: 403 KKRHYGPQ--DFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGE 460

Query: 207 RDILTTT---RSDWLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYI 262
           R+IL TT    S ++V L ++FQ    LYL  +++ GG+ F  L    RF  +  A+FYI
Sbjct: 461 RNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSED-RAKFYI 519

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
           +E+  A+  LH+    +RDLKPEN L+D+ G+I L DFGL                    
Sbjct: 520 AELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGL-------------------- 559

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKYDFTVDYWS 381
                   ++  ++DR               N+  G+ +Y+A E +L+   Y   VD+WS
Sbjct: 560 --------SKADLKDR--------------TNTFCGTTEYLAPELLLDETGYTKMVDFWS 597

Query: 382 LGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIAD 441
           LG ++FE   G++PF   +  + Y+ +   K    R VL     +F      +   L  +
Sbjct: 598 LGVLIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSF------VKGLLNRN 651

Query: 442 PINRLRSFE---HIKRMPYFAEVNFNTLRQS--APPFTPQLDSETDAGYFDDFTNEADMA 496
           P +RL + +    ++  P+FA++++  L+Q    PPF P L SETD   FD    E   A
Sbjct: 652 PKHRLGAIDDGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDP---EFTTA 708

Query: 497 KYADVFKRQNKLSSMVDDSAVDSKLVGFTF 526
             + + K Q  +++     A+ +K  GFTF
Sbjct: 709 STSYMNKHQPMMTATPLSPAMQAKFAGFTF 738

>KLLA0B03586g complement(326871..329075) similar to sp|P11792
           Saccharomyces cerevisiae YHR205w SCH9 serine/threonine
           protein kinase involved in stress response and
           nutrient-sensing signaling pathway, start by similarity
          Length = 734

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 119/439 (27%), Positives = 193/439 (43%), Gaps = 68/439 (15%)

Query: 100 DMFDYVISRRQRTKSVLNYLERNQNSLSTEELNNEWTA--YLQQEHDVLRKRRLKPKNKD 157
           DMF   +       +V   +    + L +  L    T    +  E+   +KR+  P+  D
Sbjct: 267 DMFLGQVRLHPNMNAVTPGVHSEWHKLKSRALGEHVTGDILIHWEYTSTKKRQYGPQ--D 324

Query: 158 FEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTT---R 214
           FE++              RK+DT  + A             E  H + ER+IL  T    
Sbjct: 325 FEVLRLLGKGTFGQVYQVRKKDTMRIYAMKVLSKKVIVKKNEIAHTIGERNILVRTASKS 384

Query: 215 SDWLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALH 273
           S ++V L ++FQ    LYL  +F+ GG+ F  L    RF  +  A+FYI+E+  A+  LH
Sbjct: 385 SPFIVGLKFSFQTPTDLYLVTDFMSGGELFWHLQKEGRFTED-RAKFYIAELVLALEYLH 443

Query: 274 ELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEK 333
           +    +RDLKPEN L+D+ G+I L DFGL                            ++ 
Sbjct: 444 DNDIVYRDLKPENILLDANGNIALCDFGL----------------------------SKA 475

Query: 334 SIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVL-EGKKYDFTVDYWSLGCMLFESLVG 392
            ++DR               N+  G+ +Y+A E+L +   Y   VD+WSLG ++FE   G
Sbjct: 476 DLKDR--------------TNTFCGTTEYLAPELLMDETGYTKMVDFWSLGVLIFEMCCG 521

Query: 393 YTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFE-- 450
           ++PF  S   + Y+ +   K    R VL     +F      +   L  +P +RL + +  
Sbjct: 522 WSPFFASDNQKMYQKIAFGKVKFPRDVLSPEGRSF------VKGLLNRNPKHRLGAIDDG 575

Query: 451 -HIKRMPYFAEVNFNTLRQS--APPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNK 507
             ++  P+F ++++  +RQ    PPF P L SETD   FD      +  + +  F  +  
Sbjct: 576 RELRAHPFFNDIDWEAVRQKKIPPPFKPHLISETDTSNFD-----PEFTQTSTSFMNKQP 630

Query: 508 LSSMVDDSAVDSKLVGFTF 526
           +++     A+ +K VGFTF
Sbjct: 631 IAATPLSPAMQAKFVGFTF 649

>YKL126W (YPK1) [3140] chr11 (205353..207395) Serine/threonine
           protein kinase involved in the cell integrity signaling
           pathway and required for endocytosis, possibly involved
           in a sphingolipid-mediated signaling pathway, has
           similarity to protein kinase C [2043 bp, 680 aa]
          Length = 680

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 106/380 (27%), Positives = 169/380 (44%), Gaps = 72/380 (18%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DF+++              RK+DT++V A             E  H L ER +L      
Sbjct: 346 DFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLARVDCP 405

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275
           ++V L ++FQ  E LY  + F+ GG+ F  L    RF   + ARFY +E+ CA++ LH+L
Sbjct: 406 FIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRF-DLSRARFYTAELLCALDNLHKL 464

Query: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335
              +RDLKPEN L+D +GHI L DFGL                                 
Sbjct: 465 DVVYRDLKPENILLDYQGHIALCDFGLC-------------------------------- 492

Query: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395
                    L   + +  ++  G+P+Y+A E+L G  Y   VD+W+LG +L+E L G  P
Sbjct: 493 --------KLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPP 544

Query: 396 FSGSSTNETYENLRHWKKTLRRP-VLDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEH 451
           +      + Y      KK L+ P V  +G   F     D++  L++ DP  RL     + 
Sbjct: 545 YYDEDVPKMY------KKILQEPLVFPDG---FDRDAKDLLIGLLSRDPTRRLGYNGADE 595

Query: 452 IKRMPYFAEVNFNTLRQSA--PPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLS 509
           I+  P+F+++++  L      PP+ P + +  D   FD            + F R+  + 
Sbjct: 596 IRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFD------------EEFTREKPID 643

Query: 510 SMVDD---SAVDSKLVGFTF 526
           S+VD+    +V  +  G+T+
Sbjct: 644 SVVDEYLSESVQKQFGGWTY 663

>AEL115C [2391] [Homologous to ScYKL166C (TPK3) - SH; ScYJL164C
           (TPK1) - SH] (405062..406222) [1161 bp, 386 aa]
          Length = 386

 Score =  142 bits (359), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 108/402 (26%), Positives = 179/402 (44%), Gaps = 69/402 (17%)

Query: 106 ISRRQRTKSVLNYLERNQNSLSTEELNNEWTAYLQQEHDVLRKRRLKPKNK-------DF 158
           I  +Q   S +  L     SL    +  EW    Q+    LR R+L+ +         DF
Sbjct: 20  IVPQQDASSTMPGLSMESRSLCKNIMRAEWA---QESGRQLRGRKLEGRTTKGKYTLYDF 76

Query: 159 EMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWL 218
           +++            L R        A             +  H   ER +L+     ++
Sbjct: 77  QILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKHVVVKLKQVEHTNDERKMLSVVSHPFI 136

Query: 219 VKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYT 278
           +++   FQD   +++ M+++ GG+  +LL  ++   N  A+FY +E+  A+  LH     
Sbjct: 137 IRMWGTFQDAHQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDII 196

Query: 279 HRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDR 338
           +RDLKPEN L+D  GHIKLTDFG A                             K + D 
Sbjct: 197 YRDLKPENILLDKNGHIKLTDFGFA-----------------------------KYVPD- 226

Query: 339 RKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSG 398
                      V Y  ++ G+PDY+A EV+  K Y+ +VD+WS G +++E L GYTPF  
Sbjct: 227 -----------VTY--TLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEMLAGYTPFYD 273

Query: 399 SSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA-DPINRLRSFEH----IK 453
            +T  TYEN+ +    ++ P      P F+ +  D++++LI  D   RL + ++    +K
Sbjct: 274 QNTMGTYENILN--AEVKFP------PFFNAKVRDLLSQLITRDLSKRLGNLQNGSQDVK 325

Query: 454 RMPYFAEVNFNTL--RQSAPPFTPQLDS-ETDAGYFDDFTNE 492
             P+F+EV ++ L  R    P+ P + + + D   +D +  E
Sbjct: 326 AHPWFSEVIWDKLLCRNIETPYEPPIHAGQGDTSQYDRYPEE 367

>KLLA0B12716g 1109939..1112089 similar to sp|P12688 Saccharomyces
           cerevisiae YKL126w YPK1 ser/thr-specific protein kinase,
           start by similarity
          Length = 716

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 111/395 (28%), Positives = 171/395 (43%), Gaps = 78/395 (19%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DF+++              RKRDT ++ A             E  H L ER +L    + 
Sbjct: 381 DFDLLKVIGKGSFGKVMQVRKRDTNKIYALKAIRKSYIVSKSEVTHTLAERTVLARVDNP 440

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275
           ++V L ++FQ +E LYL + F+ GG+ F  L    RF   + +RFY +E+ CA+ ALH+ 
Sbjct: 441 FIVPLKFSFQSSEKLYLVLAFINGGELFYHLQREGRF-DLSRSRFYTAELLCALEALHDF 499

Query: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335
              +RDLKPEN L+D +GHI L DFGL                             + ++
Sbjct: 500 DIIYRDLKPENILLDYQGHIALCDFGLC----------------------------KLNM 531

Query: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395
           +D+ K  T              G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P
Sbjct: 532 KDQEKTTT------------FCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPP 579

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEHI 452
           +      + Y      KK L+ P+       F     D++  L+  DP  RL     + I
Sbjct: 580 YYDEDVPKMY------KKILQDPL--RFPDDFDKDAKDLLIGLLCRDPKRRLGYHGSDEI 631

Query: 453 KRMPYFAEVNFNTLRQSA--PPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLSS 510
           K  P+F ++++  L+     PP+ P +    D   FD              F R+  + S
Sbjct: 632 KSHPFFNQLSWKRLKMKGYIPPYKPPVMGAMDTSNFD------------QEFTREQPVDS 679

Query: 511 MVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEH 545
           +V+D           F   + Q+   G  Y GSE 
Sbjct: 680 VVND-----------FLSESVQQQFGGWTYVGSEQ 703

>Scas_721.124
          Length = 684

 Score =  145 bits (367), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 109/396 (27%), Positives = 169/396 (42%), Gaps = 80/396 (20%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DF+++              RK+DT+++ A             E  H L ER +L      
Sbjct: 350 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARIDCP 409

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275
           ++V L ++FQ  + LYL +  + GG+ F  L    RF   + +RFY +E+ CA+  LH L
Sbjct: 410 FIVPLKFSFQSPDKLYLVLACINGGELFYHLQKEGRF-DLSRSRFYAAELLCALETLHNL 468

Query: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335
              +RDLKPEN L+D +GHI L DFGL                                 
Sbjct: 469 NVIYRDLKPENILLDYQGHIALCDFGLC-------------------------------- 496

Query: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395
                    L   + +  ++  G+P+Y+A E+L G+ Y   VD+W+LG +L+E L G  P
Sbjct: 497 --------KLNMKDDDKTDTFCGTPEYLAPELLLGQGYTKVVDWWTLGVLLYEMLTGLPP 548

Query: 396 FSGSSTNETYENLRHWKKTLRRPV-LDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEH 451
           +      + Y      KK L+ P+   +G   F     D++  L++ DP  RL     + 
Sbjct: 549 YYDEDVPKMY------KKILQDPLRFPDG---FDRDAKDLLIGLLSRDPTRRLGCNGADE 599

Query: 452 IKRMPYFAEVNFNTLRQSA--PPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLS 509
           IK  P+F+++++  L      PP+ P + S  D   FD              F R+  + 
Sbjct: 600 IKNHPFFSQLSWKRLLMKGYIPPYKPPVTSAIDTSNFD------------QEFTREKPVD 647

Query: 510 SMVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEH 545
           S+VD+           F   + QK   G  Y GSE 
Sbjct: 648 SVVDE-----------FLSESVQKQFGGWTYVGSEQ 672

>CAGL0F09075g 894761..897001 similar to sp|P11792 Saccharomyces
           cerevisiae YHR205w SCH9 serine/threonine protein kinase,
           start by similarity
          Length = 746

 Score =  145 bits (366), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 116/440 (26%), Positives = 196/440 (44%), Gaps = 69/440 (15%)

Query: 100 DMFDYVISRRQRTKSVLNYLERNQNSLSTEELNNEWTA--YLQQEHDVLRKRRLKPKNKD 157
           DMF   +  R    +  N        L +  ++ + T    ++  + + +KR   P+  D
Sbjct: 282 DMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGEILVKWHYTLTKKRHYGPQ--D 339

Query: 158 FEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD- 216
           FE++              +K+DTK + A             E  H + ER+IL TT S  
Sbjct: 340 FEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTSSKA 399

Query: 217 --WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALH 273
             ++V L ++FQ    LYL  +++ GG+ F  L    RF  +  A+FYI+E+  A+  LH
Sbjct: 400 SPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTED-RAKFYIAELVLALEHLH 458

Query: 274 ELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEK 333
           +    +RDLKPEN L+D+ G+I L DFGL+                            + 
Sbjct: 459 DNDIVYRDLKPENILLDANGNIALCDFGLS----------------------------KA 490

Query: 334 SIEDRRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKYDFTVDYWSLGCMLFESLVG 392
            ++DR               N+  G+ +Y+A E +L+   Y   VD+WSLG ++FE   G
Sbjct: 491 DLKDR--------------TNTFCGTTEYLAPELLLDESGYTKMVDFWSLGVLIFEMCCG 536

Query: 393 YTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFE-- 450
           ++PF      + Y+ +   K    R +L     +F      +   L  +P +RL + +  
Sbjct: 537 WSPFYAEDNQKMYQKIAFGKVKFPRDILSPEGRSF------VKGLLNRNPKHRLGAIDDG 590

Query: 451 -HIKRMPYFAEVNFNTLRQS--APPFTPQLDSETDAGYFD-DFTNEADMAKYADVFKRQN 506
             ++  P+FA++++  L+Q    PPF P L SETD   FD +FT  +          + +
Sbjct: 591 RELRAHPFFADIDWELLKQKKIPPPFKPHLVSETDTSNFDPEFTQTS-----TSYMNKHH 645

Query: 507 KLSSMVDDSAVDSKLVGFTF 526
           ++++      + +K  GFTF
Sbjct: 646 QMAATPLSPGMQAKFAGFTF 665

>CAGL0G09020g 860266..861351 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, hypothetical start
          Length = 361

 Score =  140 bits (352), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 100/364 (27%), Positives = 164/364 (45%), Gaps = 63/364 (17%)

Query: 141 QEHDVLRKRRLKPKNK----DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXX 196
           Q+  +L +R    K K    DF ++            L R        A           
Sbjct: 30  QQSTLLAQRSTVSKGKYSLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVK 89

Query: 197 XXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNT 256
             +  H   ER +L      +L+++   FQD+ +L++ M+++ GG+  TLL  ++   N 
Sbjct: 90  MKQIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNP 149

Query: 257 HARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMK 316
            A+FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A             
Sbjct: 150 VAKFYAAEVTLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFA------------- 196

Query: 317 IRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT 376
              +EV+ + +                           ++ G+PDY+A EV+  K Y+ +
Sbjct: 197 ---KEVETVTW---------------------------TLCGTPDYIAPEVIATKPYNKS 226

Query: 377 VDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIIT 436
           VD+WSLG +++E L GYTPF  ++  +TYE + H K    +         F+    D+++
Sbjct: 227 VDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQ--------FFNSDVIDLLS 278

Query: 437 RLI-ADPINRL----RSFEHIKRMPYFAEVNFNTL--RQSAPPFTPQLDSET-DAGYFDD 488
           +L+ AD   R+    +  + IK  P+FAEV +  L  +    P+ P + +   D   FD 
Sbjct: 279 KLLTADLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTSLFDQ 338

Query: 489 FTNE 492
           +  E
Sbjct: 339 YPEE 342

>Kwal_26.7635
          Length = 691

 Score =  144 bits (363), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 162/375 (43%), Gaps = 64/375 (17%)

Query: 132 NNEWTAYLQQEHDVLRKRRLKPKNK------DFEMITXXXXXXXXXXXLARKRDTKEVCA 185
           N++W    Q    +      KP         DFE++              RK+DT +V A
Sbjct: 326 NHQWIGLAQGNGKLNLSVDYKPATNRALSVDDFELLKVIGKGSFGKVMQVRKKDTNKVYA 385

Query: 186 XXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGD-FR 244
                        E  H L ER +L    + ++V L + FQ  + LY+ + F+ GG+ F 
Sbjct: 386 LKAIRKSYIVSKSEVIHTLAERTVLARVENPFIVPLKFTFQSPDKLYIVLAFINGGELFY 445

Query: 245 TLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAA 304
            L    RF   + AR Y +E+ CA+  LH L   +RDLKPEN L+D +GHI L DFGL  
Sbjct: 446 HLQREGRF-SLSRARLYTAELLCALETLHNLDVIYRDLKPENILLDHQGHIALCDFGLC- 503

Query: 305 GTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMA 364
                                                   L     +  N+  G+P+Y+A
Sbjct: 504 ---------------------------------------KLNMKGQDKTNTFCGTPEYLA 524

Query: 365 LEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPV-LDNG 423
            E+L G+ Y   VD+W+LG +L+E + G  P+      + Y      KK L+ P+   +G
Sbjct: 525 PELLLGQGYSKVVDWWTLGVLLYEMMTGLPPYYDEDVPKMY------KKILQEPLRFPDG 578

Query: 424 RPAFSDRTWDIITRLIA-DPINRL--RSFEHIKRMPYFAEVNFNTL--RQSAPPFTPQLD 478
              F     D++  L++ DP  RL     + IK  P+F+++++  L  +   PP+ P + 
Sbjct: 579 ---FDKDAKDLLIGLLSRDPKRRLGFNGADEIKSHPFFSQLSWKRLWMKGYIPPYKPPVM 635

Query: 479 SETDAGYFD-DFTNE 492
           +  D   FD +FT E
Sbjct: 636 NSLDTSNFDQEFTKE 650

>YKL166C (TPK3) [3104] chr11 complement(134514..135710) Catalytic
           subunit of cAMP-dependent protein kinase 3, protein
           kinase A or PKA [1197 bp, 398 aa]
          Length = 398

 Score =  140 bits (352), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/298 (30%), Positives = 148/298 (49%), Gaps = 51/298 (17%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  H   ER +L+     +++++   FQD++ +++ M+++ GG+  +LL  ++   N  A
Sbjct: 129 QVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVA 188

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           +FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 189 KFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFA--------------- 233

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378
                         K + D            V Y  ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 234 --------------KYVPD------------VTY--TLCGTPDYIAPEVVSTKPYNKSVD 265

Query: 379 YWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRL 438
           +WS G +++E L GYTPF  S+T +TYEN+ +    L+ P      P   D    +ITR 
Sbjct: 266 WWSFGVLIYEMLAGYTPFYNSNTMKTYENILN--AELKFPPF--FHPDAQDLLKKLITRD 321

Query: 439 IADPINRLR-SFEHIKRMPYFAEVNFNTL--RQSAPPFTPQL-DSETDAGYFDDFTNE 492
           +++ +  L+   E +K  P+F EV +  L  R    P+ P +   + D   FD +  E
Sbjct: 322 LSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEE 379

>KLLA0D03190g 267933..269051 highly similar to sp|P06245
           Saccharomyces cerevisiae YPL203w TPK2 cAMP-dependent
           protein kinase 2, catalytic chain, start by similarity
          Length = 372

 Score =  139 bits (350), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 107/376 (28%), Positives = 166/376 (44%), Gaps = 65/376 (17%)

Query: 131 LNNEWTAYL--QQEHDVLRKRRLKPKNK----DFEMITXXXXXXXXXXXLARKRDTKEVC 184
           + ++ T YL  QQ+  +L +R    K K    DF+++            L R        
Sbjct: 29  VGSQSTDYLLAQQKESLLPQRSTVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYY 88

Query: 185 AXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFR 244
           A             +  H   ER +L      +L+++   FQD+ +L++ M+++ GG+  
Sbjct: 89  AIKVLKKHQIIRMKQIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELF 148

Query: 245 TLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAA 304
           +LL  ++   N  A+FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A 
Sbjct: 149 SLLRKSQRFPNPVAKFYAAEVTLALEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFAK 208

Query: 305 GTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMA 364
             I+                                              ++ G+PDY+A
Sbjct: 209 EVITVTW-------------------------------------------TLCGTPDYIA 225

Query: 365 LEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGR 424
            EV+  K Y+ +VD+WSLG ++FE L GYTPF   +  +TYE      K L   V+    
Sbjct: 226 PEVITTKPYNKSVDWWSLGILIFEMLAGYTPFYDVTPMKTYE------KILAGEVVYP-- 277

Query: 425 PAFSDRTWDIITRLI-ADPINRLRSFEH----IKRMPYFAEVNFNTL--RQSAPPFTPQL 477
           P F     D++ +LI AD   RL + +     IK  P+FAEV +  L  +    P+ P +
Sbjct: 278 PFFHPDVVDLLGKLITADLTRRLGNLQSGPDDIKSHPWFAEVIWEKLVAKDIETPYEPPI 337

Query: 478 DSET-DAGYFDDFTNE 492
                D+  FD +  E
Sbjct: 338 AVGVGDSSLFDQYPEE 353

>ADL389W [1352] [Homologous to ScYHR205W (SCH9) - SH]
           complement(27643..29778) [2136 bp, 711 aa]
          Length = 711

 Score =  144 bits (362), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 110/389 (28%), Positives = 173/389 (44%), Gaps = 66/389 (16%)

Query: 148 KRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTER 207
           KR   P+  DFE++              RK+DTK + A             E  H + ER
Sbjct: 296 KRHYGPQ--DFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLSKKVIVKKNEIAHTIGER 353

Query: 208 DILTTTRSD---WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYIS 263
           +IL  T S    ++V L ++FQ    LYL  +F+ GG+ F  L    RF     A+FYI+
Sbjct: 354 NILVRTASKSCPFIVGLKFSFQTPTDLYLVTDFLSGGELFWHLQKEGRFTEE-RAKFYIA 412

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           E+  A+  LH+    +RDLKPEN L+D+ G+I L DFGL                     
Sbjct: 413 ELVLALEYLHDNDIVYRDLKPENILLDANGNIALCDFGL--------------------- 451

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKYDFTVDYWSL 382
                  ++  ++DR               N+  G+ +Y+A E +L+   Y   VD+WSL
Sbjct: 452 -------SKADLKDR--------------TNTFCGTTEYLAPELLLDETGYTKMVDFWSL 490

Query: 383 GCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADP 442
           G ++FE   G++PF      + Y+ +   K    R VL     +F      +   L  +P
Sbjct: 491 GVLIFEMCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSF------VKGLLNRNP 544

Query: 443 INRLRSFE---HIKRMPYFAEVNFNTLR--QSAPPFTPQLDSETDAGYFDDFTNEADMAK 497
            +RL +      ++  P+ +++++  LR  Q  PPF P L SETD   FD      +  +
Sbjct: 545 KHRLGAVNDGAEVRAHPFLSDIDWEALRNKQIPPPFKPHLTSETDTSNFD-----PEFTQ 599

Query: 498 YADVFKRQNKLSSMVDDSAVDSKLVGFTF 526
            +  F  +  +++     A+ +K  GFTF
Sbjct: 600 TSTSFMNKQPIAATPLSPAMQAKFAGFTF 628

>AFL090W [3103] [Homologous to ScYPL203W (TPK2) - SH]
           complement(274336..275376) [1041 bp, 346 aa]
          Length = 346

 Score =  137 bits (344), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 90/302 (29%), Positives = 145/302 (48%), Gaps = 59/302 (19%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  H   ER +L      +L+++   FQD  +L++ M+++ GG+  +LL  ++   N  A
Sbjct: 77  QIEHTNDERRMLKVVEHPFLIRMWGTFQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVA 136

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           +FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 137 KFYAAEVTLALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--------------- 181

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378
            +EV  + +                           ++ G+PDY+A EV+  K Y+ ++D
Sbjct: 182 -KEVDTVTW---------------------------TLCGTPDYIAPEVITTKPYNKSID 213

Query: 379 YWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRL 438
           +WSLG ++FE L GYTPF   +  +TYE +   K            P F     D++ +L
Sbjct: 214 WWSLGILIFEMLAGYTPFYDVTPIKTYEKILAGKVVF--------PPFFHPDAIDLLGKL 265

Query: 439 IADPINR----LRSF-EHIKRMPYFAEVNFNTL--RQSAPPFTPQLDSET-DAGYFDDFT 490
           I D + R    L+S  + IK  P+F+EV +  L  +    P+ P + +   D+  FD + 
Sbjct: 266 ITDDLTRRLGNLQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQYP 325

Query: 491 NE 492
            E
Sbjct: 326 EE 327

>Kwal_56.24059
          Length = 353

 Score =  137 bits (345), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 100/382 (26%), Positives = 168/382 (43%), Gaps = 63/382 (16%)

Query: 123 QNSLSTEELNNEWTAYLQQEHDVLRKRRLKPKNK----DFEMITXXXXXXXXXXXLARKR 178
           QN    + + ++     +++  +L +R    K K    DF+++            L R  
Sbjct: 4   QNQAYGQTMVSDRPGMGERQRSMLPQRSAVSKGKYSLNDFQILRTLGTGSFGRVHLVRSV 63

Query: 179 DTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFV 238
                 A             +  H   ER +L      +L+++   FQD+ +L++ M+++
Sbjct: 64  HNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLVDHPFLIRMWGTFQDSRNLFMVMDYI 123

Query: 239 PGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLT 298
            GG+  +LL  ++   N  A+FY +E+  A+  LH     +RDLKPEN L+D  GHIK+T
Sbjct: 124 EGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHSHDIIYRDLKPENILLDRNGHIKIT 183

Query: 299 DFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVG 358
           DFG A                +EV  + +                           ++ G
Sbjct: 184 DFGFA----------------KEVDTVTW---------------------------TLCG 200

Query: 359 SPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRP 418
           +PDY+A EV+  K Y+ +VD+WSLG ++FE L GYTPF  ++  +TYE +   K      
Sbjct: 201 TPDYIAPEVIATKPYNKSVDWWSLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAY--- 257

Query: 419 VLDNGRPAFSDRTWDIITRLI-ADPINRLRSFEH----IKRMPYFAEVNFNTL--RQSAP 471
                 P F     D++ +LI +D   RL + +     +K  P+F+EV +  L  +    
Sbjct: 258 -----PPFFHPDVVDLLCKLITSDLTRRLGNLQSGPQDVKSHPWFSEVVWEKLLAKDIET 312

Query: 472 PFTPQLDSET-DAGYFDDFTNE 492
           P+ P + +   D   FD +  E
Sbjct: 313 PYEPPITAGVGDTSLFDQYPEE 334

>Kwal_33.13846
          Length = 375

 Score =  137 bits (346), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 92/302 (30%), Positives = 149/302 (49%), Gaps = 59/302 (19%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  H   ER +L+     +++++   FQD E +++ M+++ GG+  +LL  ++   N  A
Sbjct: 106 QVEHTNDERRMLSVVSHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVA 165

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           +FY +E+  A+  LH     +RDLKPEN L+D  GH+K+TDFG A               
Sbjct: 166 KFYAAEVCLALEYLHAQDIIYRDLKPENVLLDKNGHVKITDFGFA--------------- 210

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378
                         K + D            V Y  ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 211 --------------KFVPD------------VTY--TLCGTPDYIAPEVVSTKPYNKSVD 242

Query: 379 YWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRL 438
           +WS G ++FE L GYTPF  S+T +TYEN+ +    L+ P      P F     D++++L
Sbjct: 243 WWSFGILIFEMLAGYTPFYDSNTMKTYENILN--AELQFP------PFFHSDVQDLLSQL 294

Query: 439 IA-DPINRLRSF----EHIKRMPYFAEVNFNTL--RQSAPPFTPQLDS-ETDAGYFDDFT 490
           I  D   RL +     E +K   +F+EV +  L  R    P+ P + + + D   +D + 
Sbjct: 295 ITRDLSKRLGNLKNGSEDVKNHAWFSEVVWEKLLCRNIETPYEPPVQAGQGDTSQYDRYP 354

Query: 491 NE 492
            E
Sbjct: 355 EE 356

>Scas_717.69
          Length = 674

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 110/396 (27%), Positives = 164/396 (41%), Gaps = 80/396 (20%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DF+++              RKRDT+++ A             E  H L ER +L      
Sbjct: 344 DFDLLKVIGKGSFGKVMQVRKRDTQKIYALKAIRKSYIVSKSEVTHTLAERTVLARVNCP 403

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275
           ++V L ++FQ  E LYL +  + GG+ F  L    RF   + ARFY +E+ CA+  LH L
Sbjct: 404 FIVPLKFSFQSPEKLYLVLACINGGELFYHLQKEGRF-ELSRARFYTAELLCALETLHNL 462

Query: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335
              +RDLKPEN L+D +GHI L DFGL                                 
Sbjct: 463 DVIYRDLKPENILLDYQGHIALCDFGLCK------------------------------- 491

Query: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395
                    L   + +  ++  G+P+Y+A E+L  + Y   VD+W+LG +L+E L G  P
Sbjct: 492 ---------LNMKDQDKTDTFCGTPEYLAPELLLNQGYSKVVDWWTLGILLYEMLTGLPP 542

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA-DPINRL--RSFEHI 452
           +      + Y  +   +  LR P        F     D++  L++ DP  RL       I
Sbjct: 543 YYDEDVPKMYRKI--LQDPLRFP------EGFDRDAKDLLIGLLSRDPDRRLGCNGAHEI 594

Query: 453 KRMPYFAEVNFNTL--RQSAPPFTPQLDSETDAGYFD-DFTNEADMAKYADVFKRQNKLS 509
           K  P+F+++++  L  +   PP+ P +    D   FD +FT E  +              
Sbjct: 595 KNHPFFSQLSWKRLWNKGYIPPYKPPVSDAADTRNFDQEFTKEKPI-------------- 640

Query: 510 SMVDDSAVDSKLVGFTFRHRNGQKGLSGILYNGSEH 545
               DS VD  L        + QK   G  Y GSE 
Sbjct: 641 ----DSVVDEYL------SESVQKQFGGWTYVGSEQ 666

>CAGL0M08404g complement(836791..838179) some similarities with
           sp|P05986 Saccharomyces cerevisiae YKL166c TPK3 or
           sp|P06244 Saccharomyces cerevisiae YJL164c SRA3 or
           sp|P06245 Saccharomyces cerevisiae YPL203w TPK2,
           hypothetical start
          Length = 462

 Score =  138 bits (348), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 93/315 (29%), Positives = 154/315 (48%), Gaps = 57/315 (18%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  H   ER +L+     +++++   FQD++ +++ M+++ GG+  +LL  ++   N  A
Sbjct: 193 QVEHTNDERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVA 252

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           +FY +E+  A+  LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 253 KFYAAEVCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFA--------------- 297

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378
                         K + D            V Y  ++ G+PDY+A EV+  K Y+ +VD
Sbjct: 298 --------------KYVPD------------VTY--TLCGTPDYIAPEVVSTKPYNKSVD 329

Query: 379 YWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRL 438
           +WS G +++E L GYTPF  ++T +TYE++      L+ P   +  P   D    +ITR 
Sbjct: 330 WWSFGILIYEMLAGYTPFYDANTMKTYEHI--LNSELKFPSFFH--PDVQDLLSKLITRD 385

Query: 439 IADPINRLR-SFEHIKRMPYFAEVNFNTL--RQSAPPFTPQL-DSETDAGYFDDFTNE-- 492
           ++  +  L+   E +K  P+F+EV +  L  R    P+ P +   + D   FD +  E  
Sbjct: 386 LSKRLGNLQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEI 445

Query: 493 ----ADMAKYADVFK 503
                    YAD+F+
Sbjct: 446 NYGVQGEDPYADLFR 460

>Scas_690.13
          Length = 354

 Score =  131 bits (329), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 89/302 (29%), Positives = 144/302 (47%), Gaps = 59/302 (19%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
           +  H   ER +L      +L+++   FQD+ +L++ M+++ GG+  +LL  ++   N  A
Sbjct: 85  QIEHTNDERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 144

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           +FY +E+   +  LH     +RDLKPEN L+D  GHIK+TDFG A               
Sbjct: 145 KFYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--------------- 189

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378
            +EV  + +                           ++ G PDY+A EV+  K Y+ +VD
Sbjct: 190 -KEVDTVTW---------------------------TLCGPPDYIAPEVIATKPYNKSVD 221

Query: 379 YWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRL 438
           +WSLG ++FE L GYTPF  ++  +TYE +   K  +  P        F     D++ +L
Sbjct: 222 WWSLGVLIFEMLAGYTPFYDTTPMKTYEKILQGK--VVYPTF------FHPDVVDLLGKL 273

Query: 439 I-ADPINRLRSFEH----IKRMPYFAEVNFNTL--RQSAPPFTPQLDSET-DAGYFDDFT 490
           I AD   R+ + +     IK  P+F+EV +  L  +    P+ P + +   D   FD + 
Sbjct: 274 ITADLTRRIGNLQSGSKDIKCHPWFSEVVWEKLLAKDIETPYEPPITTGIGDTSLFDQYP 333

Query: 491 NE 492
            E
Sbjct: 334 EE 335

>CAGL0B04301g 420544..422172 similar to sp|P38070 Saccharomyces
           cerevisiae YBR028c, start by similarity
          Length = 542

 Score =  129 bits (323), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 120/243 (49%), Gaps = 33/243 (13%)

Query: 204 LTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
             ER IL+      +VKL Y+F DT  LYL ++++PGG+    L     L      FY +
Sbjct: 218 FAERTILSQLEHPNIVKLFYSFHDTSKLYLLLQYIPGGELFFHLKEHGTLEEDTVAFYAA 277

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           E+ CA+  LH  G  +RDLKPEN L++  GH+ LTDFGL+  + S    + +    E   
Sbjct: 278 EISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSASNASQEDLGAGNE--- 334

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLG 383
                                    +VN  +S++G+P+Y A E+L G+ Y    D++SLG
Sbjct: 335 -----------------------GEDVNELHSIIGTPEYCAPEILLGQPYTANCDWYSLG 371

Query: 384 CMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLI-ADP 442
           C+L++ L G  P++G++       +++ K+  + P         SD   D++  L+ +DP
Sbjct: 372 CLLYDMLTGKPPYTGANHKVIANKIKNDKQGPKIPYY------LSDGMKDVLGALLKSDP 425

Query: 443 INR 445
             R
Sbjct: 426 KKR 428

>YBR028C (YBR028C) [220] chr2 complement(294387..295964)
           Serine/threonine protein kinase with similarity to
           Ypk2p/Ykr2p and Ypk1p [1578 bp, 525 aa]
          Length = 525

 Score =  128 bits (322), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 109/215 (50%), Gaps = 30/215 (13%)

Query: 204 LTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
             ER IL+      +VKL Y+F D   LYL ++++PGG+    L     L  T   FY +
Sbjct: 200 FAERSILSEIEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGTLDETTVSFYAA 259

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           E+ CA+  LH  G  +RDLKPEN L++  GH+ LTDFGL+                   K
Sbjct: 260 EISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSK------------------K 301

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLG 383
           +    A  E+  E+   +Y            S++G+P+Y A E+L GK Y    D++SLG
Sbjct: 302 SANDSAVDEEDPENVNALY------------SIIGTPEYCAPEILLGKAYSQNCDWYSLG 349

Query: 384 CMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRP 418
           C+L++ LVG  P++GS+       ++  K+  + P
Sbjct: 350 CLLYDMLVGKPPYTGSNHKVIINKIQQNKQGPKIP 384

>Kwal_56.22788
          Length = 515

 Score =  127 bits (320), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 104/196 (53%), Gaps = 25/196 (12%)

Query: 204 LTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
             ER IL+      +VKL Y+F D   LYL ++F+PGG+    L     L      FY +
Sbjct: 185 FAERTILSQLEHPNIVKLFYSFHDHHKLYLILQFIPGGELFYHLKEQGTLDEDTVAFYAA 244

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           E+ CA+  LH+ G  +RDLKPEN L+D  GH+ LTDFGL+  + S +             
Sbjct: 245 EISCALRFLHKRGVVYRDLKPENCLLDERGHLVLTDFGLSKVSASDDS------------ 292

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTE-VNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                        D   + T+  + E V   +S++G+P+Y A E+LEGK Y    D++SL
Sbjct: 293 ------------ADGGDVNTNGHEGESVCTLHSIIGTPEYCAPEILEGKPYTQNCDWYSL 340

Query: 383 GCMLFESLVGYTPFSG 398
           GC++F+ L+G  P++G
Sbjct: 341 GCLIFDMLIGKPPYTG 356

>Scas_593.14d
          Length = 495

 Score =  124 bits (312), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 123/249 (49%), Gaps = 32/249 (12%)

Query: 204 LTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
             E+ IL       +VKL Y+F D   LYL ++++PGG+    L     L      FY +
Sbjct: 196 FAEKSILAELEHPNIVKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGTLDEDTVAFYAA 255

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           E+ CA+  LH+ G  +RDLKPEN L++ +GH+ LTDFGL+  +++            EV 
Sbjct: 256 EISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANP-----SEVT 310

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLG 383
           +L  P+      ED   ++            S++G+P+Y A E+L+G  Y+   D++SLG
Sbjct: 311 SLNEPS------EDLSTLH------------SIIGTPEYCAPEILQGLPYNKNCDWYSLG 352

Query: 384 CMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRP-VLDNGRPAF--------SDRTWDI 434
           C++++ L G  P++G++       ++  K+  + P  L  G              + WD+
Sbjct: 353 CLIYDMLSGKPPYTGANHKVILNKIQKDKQGPKIPYYLSEGMKDMLNWLLKKDQSKRWDV 412

Query: 435 ITRLIADPI 443
                A+PI
Sbjct: 413 DKYWAAEPI 421

>KLLA0F24618g complement(2288943..2290613) similar to sp|P38070
           Saccharomyces cerevisiae YBR028c, start by similarity
          Length = 556

 Score =  125 bits (314), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 108/215 (50%), Gaps = 30/215 (13%)

Query: 204 LTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
             ER IL+      +VKL Y+F D   LYL ++++PGG+    L     L      FY +
Sbjct: 229 FAERTILSQLEHPNIVKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGTLDEGTVAFYAA 288

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           E+ CA+  LH  G  +RDLKPEN L++  GH+ LTDFGL+  ++  +             
Sbjct: 289 ELSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDD------------- 335

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLG 383
                A T +  E+  ++Y            S++G+P+Y A E+L G+ Y    D++SLG
Sbjct: 336 -----AATPEEGENVNQLY------------SIIGTPEYCAPEILAGEPYTQNCDWYSLG 378

Query: 384 CMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRP 418
           C++++ L+G  PF+G +       ++  K   R P
Sbjct: 379 CLVYDMLIGKPPFTGVNHKIILNKIKQEKTGARIP 413

>YOL100W (PKH2) [4721] chr15 (129236..132481) Serine/threonine
           protein kinase with similarity to mammalian
           3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk2p, required for
           endocytosis [3246 bp, 1081 aa]
          Length = 1081

 Score =  126 bits (316), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 91/347 (26%), Positives = 154/347 (44%), Gaps = 39/347 (11%)

Query: 118 YLERNQNSLSTEELNNEWTAYLQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARK 177
           ++E+N+N +  E  ++     + +E    +K  +K   KDF+  +           LA  
Sbjct: 140 HMEKNRNKVKIEH-DSSSQKPIAKESSKAQKNIIKKGIKDFKFGSVIGDGAYSTVMLATS 198

Query: 178 RDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTT-TRSDWLVKLLYAFQDTESLYLAME 236
            DTK+  A             +  +V  E+  L     S  +V+L   FQD  SLY  +E
Sbjct: 199 IDTKKRYAAKVLNKEYLIRQKKVKYVSIEKTALQKLNNSPSVVRLFSTFQDESSLYFLLE 258

Query: 237 FVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIK 296
           + P GDF +L+     L  T AR+Y +++  A++ LH  G  HRD+KPEN L+D E  IK
Sbjct: 259 YAPNGDFLSLMKKYGSLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIK 318

Query: 297 LTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSM 356
           LTDFG A            K+      ++  P +    +  R K              S 
Sbjct: 319 LTDFGTA------------KLLNPTNNSVSKPEY---DLSTRSK--------------SF 349

Query: 357 VGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLR 416
           VG+ +Y++ E+L     D+  D W+ GC+LF+ + G  PF  ++   T++ +   +    
Sbjct: 350 VGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAF- 408

Query: 417 RPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNF 463
                   P F     D++ +++   ++R  +   IK   +F ++NF
Sbjct: 409 -------TPGFPLIIRDLVKKILVKNLDRRLTISQIKEHHFFKDLNF 448

>KLLA0E06413g complement(577669..581154) gi|22858696|gb|AAN05732.1
            Kluyveromyces lactis protein kinase C, start by
            similarity
          Length = 1161

 Score =  124 bits (311), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 146/333 (43%), Gaps = 68/333 (20%)

Query: 174  LARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDIL---TTTRSDWLVKLLYAFQDTES 230
            LAR ++T  +CA             +      E+ +    T T+  +L  L  +FQ    
Sbjct: 850  LARSKNTSNLCAIKVLKKDNIIKNHDIESARAEKKVFLLATETKHPFLTNLYCSFQTENR 909

Query: 231  LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLID 290
            +Y AMEF+ GGD    + N R L    A+FY +E+  ++   H+ G  +RDLK EN L+ 
Sbjct: 910  IYFAMEFIGGGDLMWHVQNRR-LSVRRAKFYAAEVLLSLKYFHDNGVIYRDLKLENILLT 968

Query: 291  SEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEV 350
             EGHIK+ D+GL                                   +  M+        
Sbjct: 969  PEGHIKIADYGLC----------------------------------KDNMWYG------ 988

Query: 351  NYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
            N  ++  G+P++MA E+L+G+ Y   VD+W+ G +L++ L+  +PFSG   +E +  +  
Sbjct: 989  NKTSTFCGTPEFMAPEILKGQAYTKAVDWWTFGVLLYQMLLCQSPFSGEDEDEVFNAIL- 1047

Query: 411  WKKTLRRPVLDNGRPAFS-DRTWDIIT----RLIADPINRL----RSFEHIKRMPYFAEV 461
                          P +  D   DI+      L  DP  RL    +    I   P+F+ +
Sbjct: 1048 -----------TDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPKDALEIMAEPFFSNI 1096

Query: 462  NFNTL--RQSAPPFTPQLDSETDAGYFD-DFTN 491
            NF+ +   +  PPF P++ +  D  YF+ +FT+
Sbjct: 1097 NFDDILNLRVEPPFVPEIKAADDTSYFEKEFTS 1129

>YDR490C (PKH1) [1306] chr4 complement(1431956..1434256)
           Serine/threonine protein kinase, functions similarly to
           mammalian 3-phosphoinositide-dependent protein kinase,
           phosphorylates and activates Ypk1p, required for
           endocytosis [2301 bp, 766 aa]
          Length = 766

 Score =  123 bits (309), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 92/320 (28%), Positives = 142/320 (44%), Gaps = 38/320 (11%)

Query: 146 LRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLT 205
           L K  +K   KDF+              LA  RD+ +  A             +  +V  
Sbjct: 113 LTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKKYAVKVLSKEYLIRQKKVKYVTV 172

Query: 206 ERDILTTTR-SDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISE 264
           E+  L     +  + KL + FQD  SLY  +E+ P GDF  L+     L  T AR+Y S+
Sbjct: 173 EKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGSLNETCARYYASQ 232

Query: 265 MFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKN 324
           +  AV++LH +G  HRD+KPEN L+D    +KLTDFG A            KI  EE  N
Sbjct: 233 IIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTA------------KILPEEPSN 280

Query: 325 LEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGC 384
                       D +  +    +++     S VG+ +Y++ E+L     D   D W+ GC
Sbjct: 281 ----------TADGKPYFDLYAKSK-----SFVGTAEYVSPELLNDNYTDSRCDIWAFGC 325

Query: 385 MLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA-DPI 443
           +L++ L G  PF  ++   T++ +   +              F     D++ +L+  DP 
Sbjct: 326 ILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTA--------GFPQIVKDLVKKLLVRDPN 377

Query: 444 NRLRSFEHIKRMPYFAEVNF 463
           +RL + + IK   +F EVNF
Sbjct: 378 DRL-TIKQIKAHLFFHEVNF 396

>AFR377C [3569] [Homologous to ScYDR466W - SH] (1116595..1118775)
           [2181 bp, 726 aa]
          Length = 726

 Score =  123 bits (308), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 116/247 (46%), Gaps = 42/247 (17%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++KL Y F D E+LY  M+  PGG+   LL   R      AR Y+ ++   V  +H +G 
Sbjct: 73  IIKLYYTFHDQENLYFVMDLAPGGELLQLLRRQRVFSEAWARHYMCQLVDTVEYIHSMGV 132

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLKPEN L+D EG + + DFG AA T+      S                      D
Sbjct: 133 IHRDLKPENVLLDKEGRLMIADFG-AAYTVGQSDAGS----------------------D 169

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFS 397
             K            A S VG+ +Y++ E+L   K  ++ D W+LGCML++ L G  PF 
Sbjct: 170 GDKP-----------ATSFVGTAEYVSPELLLENKSYYSSDVWALGCMLYQFLQGTPPFR 218

Query: 398 GSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPY 457
           G +  ET+E + +   T R P      P  +     I   L+ DP  R  + E IK+  +
Sbjct: 219 GQNEMETFEQIVNLDYTWRIP----ANPLAAGLVSKI---LVLDPSQRY-TLEQIKKHKW 270

Query: 458 FAEVNFN 464
           F+ V++N
Sbjct: 271 FSGVDWN 277

>YDR466W (PKH3) [1284] chr4 (1395109..1397805) Serine/threonine
           protein kinase of unknown function [2697 bp, 898 aa]
          Length = 898

 Score =  123 bits (308), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 129/262 (49%), Gaps = 32/262 (12%)

Query: 208 DILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFC 267
           ++L       ++KL Y F D E+LY  ++F PGG+  +LL       +   R + +++  
Sbjct: 65  NLLAQKHHAGIIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGTFNDIWTRHFTAQLID 124

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
           A+  +H  G  HRDLKPEN L+D +G + +TDFG AA TI                    
Sbjct: 125 ALEFIHSHGIIHRDLKPENVLLDRDGRLMITDFG-AAATID------------------- 164

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNY-ANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCML 386
           P+ +     D  K  +    ++ N    S VG+ +Y++ E+L   +  +  D W+LGCM+
Sbjct: 165 PSLS----GDSAKFNSDSNGSKDNQNCASFVGTAEYVSPELLLYNQCGYGSDIWALGCMI 220

Query: 387 FESLVGYTPFSGSSTNETYENLRH----WKKTLRRPVLDNGRPAFSDRTWDIITRLIADP 442
           ++ + G  PF G +  +T+E +      W    R   ++N     +    +++ +++   
Sbjct: 221 YQFVQGQPPFRGENELKTFEKIVALDYPWGPNNR---INNSTSPINPLVINLVQKILVIE 277

Query: 443 INRLRSFEHIKRMPYFAEVNFN 464
           +N   S E IKR PYF++V++N
Sbjct: 278 VNERISLEQIKRHPYFSKVDWN 299

>Scas_715.34
          Length = 1150

 Score =  123 bits (308), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 88/333 (26%), Positives = 146/333 (43%), Gaps = 68/333 (20%)

Query: 174  LARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDIL---TTTRSDWLVKLLYAFQDTES 230
            L+R ++T  +CA             +      E+ +    T T+  +L  L  +FQ    
Sbjct: 839  LSRSKNTGRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 898

Query: 231  LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLID 290
            +Y AMEF+ GGD    + N R L    A+FY +E+  A+   H+ G  +RDLK EN L+ 
Sbjct: 899  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLT 957

Query: 291  SEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEV 350
             +GHIK+ D+GL                                   + +M+ +      
Sbjct: 958  PQGHIKIADYGLC----------------------------------KDEMWYN------ 977

Query: 351  NYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
            N  ++  G+P++MA E+L+ + Y   VD+W+ G +L++ L+  +PFSG   +E +     
Sbjct: 978  NKTSTFCGTPEFMAPEILKEQGYTRAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFN---- 1033

Query: 411  WKKTLRRPVLDNGRPAFS-DRTWDIIT----RLIADPINRL----RSFEHIKRMPYFAEV 461
                     +    P +  D   DI+      L  DP NRL    R    +   P+F  +
Sbjct: 1034 --------AILTDEPLYPIDMAGDIVQIFQGLLTKDPENRLGAGQRDALEVMEEPFFRNI 1085

Query: 462  NFNTL--RQSAPPFTPQLDSETDAGYFD-DFTN 491
            NF  +   +  PP+ P++ S  D  YF+ +FT+
Sbjct: 1086 NFEDILNLRVQPPYVPEIKSPEDTSYFEHEFTS 1118

>YBL105C (PKC1) [98] chr2 complement(14241..17696) Protein kinase C,
            regulates MAP kinase cascade involved in regulating cell
            wall metabolism [3456 bp, 1151 aa]
          Length = 1151

 Score =  121 bits (303), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/333 (25%), Positives = 147/333 (44%), Gaps = 68/333 (20%)

Query: 174  LARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDIL---TTTRSDWLVKLLYAFQDTES 230
            L++ ++T  +CA             +      E+ +    T T+  +L  L  +FQ    
Sbjct: 840  LSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 899

Query: 231  LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLID 290
            +Y AMEF+ GGD    + N R L    A+FY +E+  A+   H+ G  +RDLK EN L+ 
Sbjct: 900  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLT 958

Query: 291  SEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEV 350
             EGHIK+ D+GL                                   + +M+        
Sbjct: 959  PEGHIKIADYGLC----------------------------------KDEMWYG------ 978

Query: 351  NYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
            N  ++  G+P++MA E+L+ ++Y   VD+W+ G +L++ L+  +PFSG   +E +     
Sbjct: 979  NRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFN---- 1034

Query: 411  WKKTLRRPVLDNGRPAFS-DRTWDIIT----RLIADPINRL----RSFEHIKRMPYFAEV 461
                     +    P +  D   +I+      L  DP  RL    R  + +   P+F  +
Sbjct: 1035 --------AILTDEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNI 1086

Query: 462  NFNTL--RQSAPPFTPQLDSETDAGYFD-DFTN 491
            NF+ +   +  PP+ P++ S  D  YF+ +FT+
Sbjct: 1087 NFDDILNLRVKPPYIPEIKSPEDTSYFEQEFTS 1119

>CAGL0M09361g complement(928484..931918) highly similar to sp|P24583
            Saccharomyces cerevisiae YBL105c PKC1 ser/thr protein
            kinase, start by similarity
          Length = 1144

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 90/333 (27%), Positives = 143/333 (42%), Gaps = 68/333 (20%)

Query: 174  LARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDIL---TTTRSDWLVKLLYAFQDTES 230
            L+R ++T  +CA             +      E+ +    T T+  +L  L  +FQ    
Sbjct: 833  LSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENR 892

Query: 231  LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLID 290
            +Y AMEF+ GGD    + N R L    A+FY +E+  A+   H+ G  +RDLK EN L+ 
Sbjct: 893  IYFAMEFIGGGDLMWHVQNQR-LSVRRAKFYAAEVLLALKFFHDNGVIYRDLKLENILLT 951

Query: 291  SEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEV 350
             EGHIK+ D+GL                                   +  M+        
Sbjct: 952  PEGHIKIADYGLC----------------------------------KDGMWYG------ 971

Query: 351  NYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
            N  ++  G+P++MA E+L  + Y   VD+W+ G +L++ L+  +PFSG   +E +     
Sbjct: 972  NKTSTFCGTPEFMAPELLREQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFN---- 1027

Query: 411  WKKTLRRPVLDNGRPAFS-DRTWDIIT----RLIADPINRL----RSFEHIKRMPYFAEV 461
                     +    P +  D   DI+      L  DP  RL    R    I   P+F  +
Sbjct: 1028 --------AILTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPRDALEIMEEPFFRNI 1079

Query: 462  NFNTL--RQSAPPFTPQLDSETDAGYFD-DFTN 491
            NF+ L   +  PP+ P++ S  D  YF+ +FT+
Sbjct: 1080 NFDDLLNLRIKPPYIPEIKSAEDTSYFEQEFTS 1112

>Scas_660.20
          Length = 957

 Score =  119 bits (299), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 136/297 (45%), Gaps = 49/297 (16%)

Query: 177 KRDTKEVCAXXXXXXXXXXXXXETNHVLTERD---ILTTTRSDWLVKLLYAFQDTESLYL 233
           KR+TK + A             +  +V  E++   +L       +VKL Y F D E+LY 
Sbjct: 31  KRNTKRIFAIKVCSKAHIIKESKVKYVTIEKNTLNLLAKAHHPGIVKLYYTFHDEENLYY 90

Query: 234 AMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEG 293
            ++++PGG+  +LL   +      ++ +  ++   +  +H  G  HRDLKPEN L+D +G
Sbjct: 91  VLDYLPGGELLSLLHKMKTFSEVWSKHFTVQLVDTLEFIHSQGVIHRDLKPENVLLDRDG 150

Query: 294 HIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYA 353
            + +TDFG A  T +                            D  K            +
Sbjct: 151 KLMITDFGAAYTTTAGN-------------------------NDANKS-----------S 174

Query: 354 NSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH--- 410
           +S VG+ +Y++ E+L   +  F+ D W+LGCM+F+ + G  PF G +  +T+E +     
Sbjct: 175 SSFVGTAEYVSPELLLHNQCSFSSDVWALGCMIFQFVTGSPPFRGENELKTFEKIVALDY 234

Query: 411 -WKKT--LRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFN 464
            W  T       L+N  P   +    I   L+ +P +RL S + IK+ P+FA VN+N
Sbjct: 235 PWSSTNIHNNKFLNNINPLIINLVRKI---LVLEPKDRL-SLKKIKQDPWFATVNWN 287

>Kwal_27.10581
          Length = 1154

 Score =  119 bits (297), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 92/372 (24%), Positives = 155/372 (41%), Gaps = 73/372 (19%)

Query: 140  QQEHDVLRKRRLKPKNK-----DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXX 194
            Q  H   R +R  PK +     DF ++            LA  ++ + +CA         
Sbjct: 804  QASHTSTRHKRRTPKRRKISLDDFVLLKVLGKGNFGKVLLAESKNNERLCAIKVLKKDHI 863

Query: 195  XXXXETNHVLTERDIL---TTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTR 251
                +      E+ +    T  +  +L  L  +FQ    +Y AMEF+ GGD    + N R
Sbjct: 864  IKNHDIESARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQR 923

Query: 252  FLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTER 311
             L    A+FY +E+  A+   H+ G  +RDLK EN L+  EGHIK+ D+GL         
Sbjct: 924  -LSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLC-------- 974

Query: 312  IQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGK 371
                                      + +M+        N  ++  G+P++MA E+L+ +
Sbjct: 975  --------------------------KDEMWYG------NKTSTFCGTPEFMAPEILKEQ 1002

Query: 372  KYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFS-DR 430
            +Y   VD+W+ G +L++ L+  +PFSG   +E +              +    P +  D 
Sbjct: 1003 EYTKAVDWWAFGVLLYQMLLCQSPFSGEDEDEVFN------------AILTDEPLYPIDM 1050

Query: 431  TWDIIT----RLIADPINRL----RSFEHIKRMPYFAEVNFNTL--RQSAPPFTPQLDSE 480
              DI+      L  DP  RL    R    +   P+F  + F+ +   +  PP+ P++ + 
Sbjct: 1051 AGDIVQIFQGLLTKDPERRLGAGPRDAAEVMAEPFFRNIVFDDILNLRVQPPYIPEIKAA 1110

Query: 481  TDAGYFD-DFTN 491
             D  YF+ +FT+
Sbjct: 1111 DDTSYFEKEFTS 1122

>ACR191C [1238] [Homologous to ScYBL105C (PKC1) - SH] (680398..683847)
            [3450 bp, 1149 aa]
          Length = 1149

 Score =  118 bits (295), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 93/364 (25%), Positives = 151/364 (41%), Gaps = 73/364 (20%)

Query: 147  RKRRLKPKNK-----DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETN 201
            R +R  PK +     DF ++            LAR ++T  +CA             +  
Sbjct: 806  RHKRKTPKRRKVSLDDFILLKVLGKGNFGKVLLARSKNTDRLCAIKVLKKDHIIQNHDIE 865

Query: 202  HVLTERDIL---TTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHA 258
                E+ +    T  +  +L  L  +FQ    +Y AMEF+ GGD    + N R L    A
Sbjct: 866  SARAEKKVFLLATKAKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQR-LSVRRA 924

Query: 259  RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
            +FY +E+  A+   H+ G  +RDLK EN L+  EGHIK+ D+GL                
Sbjct: 925  KFYAAEVLLALKYFHDNGIIYRDLKLENILLTLEGHIKIADYGLC--------------- 969

Query: 319  LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378
                               + +M+        N  ++  G+P++MA E+L  + Y   VD
Sbjct: 970  -------------------KDEMWFG------NRTSTFCGTPEFMAPEILREQAYTKAVD 1004

Query: 379  YWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFS-DRTWDIIT- 436
            +W+ G +L++ L+  +PFSG   +E +  +                P +  D   DI+  
Sbjct: 1005 WWAFGVLLYQMLLCQSPFSGDDEDEVFNAIL------------TDEPLYPIDMAGDIVQI 1052

Query: 437  ---RLIADPINRL----RSFEHIKRMPYFAEVNFNTL--RQSAPPFTPQLDSETDAGYFD 487
                L  DP  RL    R    +   P+F  +NF+ +   +  PP+ P + +  D  YF+
Sbjct: 1053 FQGLLTKDPEKRLGAGSRDALEVMEEPFFRNINFDDILNLRVEPPYIPTIKAADDTSYFE 1112

Query: 488  -DFT 490
             +FT
Sbjct: 1113 KEFT 1116

>AEL083W [2423] [Homologous to ScYBR028C - SH]
           complement(470964..472574) [1611 bp, 536 aa]
          Length = 536

 Score =  116 bits (291), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/197 (31%), Positives = 99/197 (50%), Gaps = 31/197 (15%)

Query: 204 LTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
             ER IL+      +VKL Y+F D   LYL ++++PGG+    L     L      FY +
Sbjct: 212 FAERTILSQLEHPNIVKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGTLDEVTVSFYAA 271

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           E+ CA+  LH  G  +RDLKPEN L+D +GH+ LTDFGL+   ++               
Sbjct: 272 EISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVN--------------- 316

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLG 383
                           +  + L   +V    S++G+P+Y A E+L G+ Y    D++SLG
Sbjct: 317 ----------------QADSPLGGEQVEELYSIIGTPEYCAPEILCGQPYTQNCDWYSLG 360

Query: 384 CMLFESLVGYTPFSGSS 400
            + ++ L+G  PF+G++
Sbjct: 361 SLTYDMLIGKPPFTGAN 377

>Kwal_56.22693
          Length = 984

 Score =  115 bits (289), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 90/338 (26%), Positives = 144/338 (42%), Gaps = 45/338 (13%)

Query: 139 LQQEHDVLRKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXX 198
           L  E  V+ +  +K   KDF               LAR  D+ +  A             
Sbjct: 139 LNPETGVMARHVIKKGIKDFRFGEVLGDGSYSTVMLARSNDSGKKYAVKVLNKEYLIRQK 198

Query: 199 ETNHVLTERDILTTTRSD-WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTH 257
           +  +V  E++ L        ++KL + FQD  SLY  +E+ P GDF +++     L    
Sbjct: 199 KVKYVNIEKNTLQRLNDGRGVIKLYFTFQDEASLYFLLEYAPNGDFLSVIKKFGSLSQEC 258

Query: 258 ARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKI 317
           A +Y +++  A++ LH  G  HRD+KPEN L+D +  +KLTDFG A      E  Q+  +
Sbjct: 259 AVYYSAQILDAIDYLHHKGIVHRDIKPENILLDKDMKVKLTDFGTARILEKDETTQTFNL 318

Query: 318 RLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTV 377
            LE  K                               S VG+ +Y++ E+L     D+  
Sbjct: 319 -LERSK-------------------------------SFVGTAEYVSPELLNDNYVDYKC 346

Query: 378 DYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR 437
           D W+ GC+LF+ + G  PF  ++   T++ +   +              F     D+I +
Sbjct: 347 DIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTA--------GFPLVIRDLIKK 398

Query: 438 -LIADPINRLRSFEHIKRMPYFAEVNFN--TLRQSAPP 472
            L+  P  RL +   IK+  +F +VNFN  ++  S PP
Sbjct: 399 ILVKSPEQRLDA-SQIKKHHFFKDVNFNDGSVWDSDPP 435

>YMR001C (CDC5) [3966] chr13 complement(269019..271136)
           Serine/threonine protein kinase required for exit from
           mitosis and for inactivation of the Rad53p checkpoint
           kinase during adaptation to unrepaired DNA damage,
           member of the polo family of protein kinases [2118 bp,
           705 aa]
          Length = 705

 Score =  111 bits (278), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 91/343 (26%), Positives = 138/343 (40%), Gaps = 63/343 (18%)

Query: 177 KRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAME 236
           K D+ E+ A                 +L+E  I  +     +V+ +  F+D  ++Y+ +E
Sbjct: 100 KDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLE 159

Query: 237 FVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIK 296
             P G    LL   + L     RF+ +++  A+  +H     HRDLK  N   DS  ++K
Sbjct: 160 ICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLK 219

Query: 297 LTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSM 356
           + DFGLAA   +                           E  RK YT            +
Sbjct: 220 IGDFGLAAVLAN---------------------------ESERK-YT------------I 239

Query: 357 VGSPDYMALEVLEGKK--YDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENL--RHWK 412
            G+P+Y+A EVL GK   + F VD WSLG ML+  L+G  PF     N  YE +  R + 
Sbjct: 240 CGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFS 299

Query: 413 KTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEV-NFNTLRQSAP 471
               +P+ D G+    D        L  DPI R          P   E+ ++   R + P
Sbjct: 300 FPRDKPISDEGKILIRD-------ILSLDPIER----------PSLTEIMDYVWFRGTFP 342

Query: 472 PFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQNKLSSMVDD 514
           P  P     ++A  F+D   E  +  + D  ++   L SM  D
Sbjct: 343 PSIPS-TVMSEAPNFEDIPEEQSLVNFKDCMEKSLLLESMSSD 384

>CAGL0K06479g 636296..639271 some similarities with tr|Q03306
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 991

 Score =  110 bits (276), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 121/246 (49%), Gaps = 17/246 (6%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +VKL Y F D E+LY  +++  GG+  +LL       ++ A+ + +++   +  +H  G 
Sbjct: 75  IVKLYYTFHDEENLYFVLDYASGGELLSLLHKMGTFTDSWAKHFAAQLVDTLEFMHARGV 134

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLKPEN L+  EG + +TDFG AA    T+   S K       N   P     S  D
Sbjct: 135 IHRDLKPENVLLSKEGILMITDFGAAA----TQNNFSDKDNTRSNANEGIPKDDVPSSGD 190

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFS 397
           + +             +S VG+ +Y++ E+L   K  F  D W+LGCM+++ + G+ PF 
Sbjct: 191 KTE------------CSSFVGTAEYVSPELLLYNKCSFGSDIWALGCMVYQFIQGFPPFR 238

Query: 398 GSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPY 457
           G +  +T+E +     +   P         + +  +++ R++     +  + + IKR P+
Sbjct: 239 GENELKTFEKIVSLDYSW-NPERQTNFGTINIQVVNLVRRMLTIDTTQRATIDQIKRDPW 297

Query: 458 FAEVNF 463
           FA V++
Sbjct: 298 FANVDW 303

>KLLA0C12485g 1060167..1062944 weakly similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, start by
           similarity
          Length = 925

 Score =  108 bits (270), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 113/247 (45%), Gaps = 41/247 (16%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++ L + FQD  SLY  +E+ P GD  +L+     +     ++Y +++  A+  +H+ G 
Sbjct: 216 IISLYFTFQDESSLYFLLEYAPNGDLLSLMRKHGSVNEKCTQYYAAQIIDALGFMHDKGV 275

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLKPEN L+D +  +KLTDFG A    ST                          ED
Sbjct: 276 IHRDLKPENILLDVDMKVKLTDFGTARLLDSTS-------------------------ED 310

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFS 397
                  L+   +  +NS VG+ +Y++ E+L     DF  D W+ GC+LF+ + G  PF 
Sbjct: 311 ------DLKYDLLTRSNSFVGTAEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKPPFK 364

Query: 398 GSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRLRSFEHIKRMP 456
            ++   T++ +   +              F     D++   LI +P  RL     IK   
Sbjct: 365 ANNEYLTFQKVMKVQFAFTA--------GFPMTVRDLVKNILIKNPERRLL-INQIKAHQ 415

Query: 457 YFAEVNF 463
           +FA+VNF
Sbjct: 416 FFADVNF 422

>CAGL0I07513g 721775..725005 similar to sp|Q12236 Saccharomyces
           cerevisiae YOL100w PKH2, start by similarity
          Length = 1076

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 95/194 (48%), Gaps = 29/194 (14%)

Query: 215 SDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHE 274
           S  +VKL + FQD  SLY  +E+ P GDF +++     L     R+Y +++   +  LH 
Sbjct: 240 SRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDCTRYYSAQIIDGIKYLHS 299

Query: 275 LGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKS 334
            G  HRD+KPEN L+D +  +K+TDFG A         + ++ + E+  N EF   T   
Sbjct: 300 KGIIHRDIKPENILLDKDMKVKITDFGTA---------KILEPKNEDEDNPEFNLLTR-- 348

Query: 335 IEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYT 394
                             + S VG+ +Y++ E+L     D   D W+ GCM+F+ + G  
Sbjct: 349 ------------------SKSFVGTAEYVSPELLNDSYVDARCDIWAFGCMVFQMIAGKP 390

Query: 395 PFSGSSTNETYENL 408
           PF  ++   T++ +
Sbjct: 391 PFKATNEYLTFQKV 404

>YFL033C (RIM15) [1651] chr6 complement(69113..74425)
           Serine/threonine protein kinase, positive regulator of
           IME2 expression and of sporulation [5313 bp, 1770 aa]
          Length = 1770

 Score =  108 bits (269), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/158 (36%), Positives = 91/158 (57%), Gaps = 4/158 (2%)

Query: 153 PKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTT 212
           P  KD++++            LARK+ T +  A             +  +V +ER I+  
Sbjct: 789 PSIKDYDILKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERAIMMV 848

Query: 213 TRSD--WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVN 270
            +SD  ++ +L  +FQ+ ++L+L ME++PGGD  TL+    +L +  A+ Y++E+   VN
Sbjct: 849 -QSDKPYVARLFASFQNKDNLFLVMEYLPGGDLATLIKMMGYLPDQWAKQYLTEIVVGVN 907

Query: 271 ALHELGYTHRDLKPENFLIDSEGHIKLTDFGLA-AGTI 307
            +H+ G  H DLKPEN LID+ GH+KLTDFGL+ AG I
Sbjct: 908 DMHQNGIIHHDLKPENLLIDNAGHVKLTDFGLSRAGLI 945

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 77/156 (49%), Gaps = 11/156 (7%)

Query: 358  GSPDYMALEVLEGKKYDF-TVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLR 416
            G+PDY+A E +EGK  D    D+WS+GC+ FE L+GY PF   + +  ++ +      ++
Sbjct: 1149 GTPDYLAPETIEGKGEDNKQCDWWSVGCIFFELLLGYPPFHAETPDAVFKKI--LSGVIQ 1206

Query: 417  RPVLDNGRPA---FSDRTWDIITR-LIADPINRL--RSFEHIKRMPYFAEVNFNTLRQSA 470
             P   N        +    D+I + L+ DP  RL  +  + IK  PYF  V+++ +    
Sbjct: 1207 WPEFKNEEEEREFLTPEAKDLIEKLLVVDPAKRLGAKGIQEIKDHPYFKNVDWDHVYDEE 1266

Query: 471  PPFTPQLDSETDAGYFDDFTNEADMAKYADVFKRQN 506
              F P +D+  D  YFD     A++  + D  +  N
Sbjct: 1267 ASFVPTIDNPEDTDYFD--LRGAELQDFGDDIENDN 1300

>KLLA0E03487g complement(323764..325707) similar to sgd|S0002874
           Saccharomyces cerevisiae YDR466w, start by similarity
          Length = 647

 Score =  106 bits (265), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 113/251 (45%), Gaps = 56/251 (22%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++KL Y F D+E+LY  ++F PGG+   LL           + ++ ++  A+  +H    
Sbjct: 73  IIKLYYTFHDSENLYFVLDFAPGGELLQLLQTQGRFNEAWTKHFMCQLIDALEYIHGCKV 132

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLKPEN L+ SEG + +TDFG+A+   +T+ + S                       
Sbjct: 133 VHRDLKPENLLLSSEGKLMITDFGVASNLAATDNLSS----------------------- 169

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFS 397
                           +S VG+ +Y++ E+L   K +F  D W++GCML++   G  PF 
Sbjct: 170 ---------------TSSFVGTAEYVSPELLLQNKSNFCSDIWAVGCMLYQFTQGTPPFR 214

Query: 398 GSSTNETYENLR----HWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRLRSFEHI 452
           G +    +E +     HW   +            S    D++++ L+ DP +R  +   I
Sbjct: 215 GENELAAFEKIVNLDYHWIYMV------------SQHITDLVSKILVLDPDSRY-TLPQI 261

Query: 453 KRMPYFAEVNF 463
           K   +F  +++
Sbjct: 262 KNHAWFQGIDW 272

>CAGL0K12562g 1234866..1239914 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 1682

 Score =  105 bits (261), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 85/165 (51%), Gaps = 2/165 (1%)

Query: 149 RRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERD 208
           + L P  KD+++I            LARK+ T +  A             +  +V +ER 
Sbjct: 773 KPLTPSIKDYDIIKPISKGAYGSVYLARKKLTGDYFAIKVLRKSDMIAKNQVTNVKSERA 832

Query: 209 ILTTTRSDWLVKLLYA-FQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFC 267
           I+        V  LYA FQ+ ++L+L ME++PGGD  TLL     L +   + Y+SE+  
Sbjct: 833 IMMVQSDKPYVARLYATFQNKDNLFLVMEYLPGGDLATLLKMMGCLPDEWVKQYLSEIII 892

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLA-AGTISTER 311
            V  +H  G  H DLKPEN LID  GH+KLTDFGL+ AG +   R
Sbjct: 893 GVEDMHNNGIIHHDLKPENLLIDVSGHLKLTDFGLSRAGLVKRHR 937

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 83/173 (47%), Gaps = 22/173 (12%)

Query: 358  GSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRR 417
            G+PDY+A E +EG   D   D+WS+GC+LFE + GY PF   + ++ + N+   K  +  
Sbjct: 1105 GTPDYLAPETIEGTGEDNQCDWWSVGCILFEMVFGYPPFHAETPDQVFRNILEGK--IDW 1162

Query: 418  PVLDN---GRPAFSDRTWDIITR-LIADPINRL--RSFEHIKRMPYFAEVNFNTLRQSAP 471
            P+ D+    R   S    D+I + LI DP  RL     E IK  PYF +V ++ +     
Sbjct: 1163 PIFDSIEEEREYISPEAKDLIMKFLITDPHKRLGYNGTEEIKNHPYFKDVKWDHVYDETA 1222

Query: 472  PFTPQLDSETDAGYFD-------DFTNEADM-------AKYADVFKRQNKLSS 510
             + P ++   D  YFD       DF ++ D            D+ +  NK SS
Sbjct: 1223 SYVPNIEDPEDTDYFDLRGATLQDFGDDNDEDAVLESDGDAIDIGQNPNKFSS 1275

>KLLA0F09020g 836287..839073 weakly similar to sp|P43565
           Saccharomyces cerevisiae YFL033c RIM15 protein kinase
           involved in expression of meiotic genes, start by
           similarity
          Length = 928

 Score =  103 bits (257), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 100/201 (49%), Gaps = 3/201 (1%)

Query: 149 RRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERD 208
           + + P  +D+++I            LA+KR T E  A             +  +V +ER 
Sbjct: 693 KSIIPSIRDYDVIKPISKGAYGSVYLAKKRVTGEYFAIKVLKKSDMIAKNQVTNVKSERA 752

Query: 209 ILTTTRSDWLVKLLYA-FQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFC 267
           I+        V  LYA FQ+ E+L+L M+++ GGD  TL+     L    A+ YI E+  
Sbjct: 753 IMMVQSDKPYVARLYATFQNKENLFLVMQYLSGGDMATLIKMMGNLPEKWAKQYICEVIS 812

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            V+ +H+ G  H DLKP+N LIDS GHIKLTDFGL+   +   R    K R  ++++   
Sbjct: 813 GVDDMHQNGIIHHDLKPDNLLIDSLGHIKLTDFGLSR--MGLLRRHKEKRRNSQIQSSRN 870

Query: 328 PAFTEKSIEDRRKMYTHLRQT 348
           P+FT  S   R+   T   Q+
Sbjct: 871 PSFTCDSSVTRKNSVTDSLQS 891

>CAGL0G04609g complement(437162..440059) similar to sp|Q12236
           Saccharomyces cerevisiae YOL100w PKH2, hypothetical
           start
          Length = 965

 Score =  103 bits (256), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 123/275 (44%), Gaps = 42/275 (15%)

Query: 202 HVLTERDILTTTRS-DWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARF 260
           +V  E+  L   +S   ++ L + FQD  +LY  +E+ P GDF +L+     L      +
Sbjct: 163 YVNIEKTALQNLKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEECTIY 222

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
           Y +++  A+ ++H  G  HRD+KPEN L+D    IKLTDFG A                 
Sbjct: 223 YSAQIIDAIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTAK---------------- 266

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYW 380
                      +KS ++ +  Y  L +     ++S VG+ +Y++ E+L     D+  D W
Sbjct: 267 --------LLQKKSDKNGKPHYNLLTR-----SSSFVGTAEYVSPELLSDNYTDYKCDIW 313

Query: 381 SLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LI 439
           + GC++++ + G  PF  ++   T++ +   +              F     D++   L+
Sbjct: 314 AFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTA--------GFPTIIRDLVKNILV 365

Query: 440 ADPINRLRSFEHIKRMPYFAEVNF--NTLRQSAPP 472
             P  RL +   IK    F  +NF  N++    PP
Sbjct: 366 KQPEKRL-TIPQIKEHCLFENINFSDNSVWNRDPP 399

>Kwal_47.18307
          Length = 621

 Score =  102 bits (254), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 123/269 (45%), Gaps = 47/269 (17%)

Query: 199 ETNHVLTERDILTTTRSDW---LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRN 255
           +  +V  E+D+L          +VKL   F D E+LY  +E+V GG+   L+     L  
Sbjct: 52  KVKYVTIEKDLLNMLAKGGHLGIVKLFCTFHDIENLYFVLEYVSGGELLALIQRLGRLTE 111

Query: 256 THARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSM 315
             +R   +++   V+ +H  G  HRDLKPEN L+  EG + +TDFG A            
Sbjct: 112 DLSRHITAQLVDTVDYMHSKGVIHRDLKPENVLLSQEGRVVITDFGAAC----------- 160

Query: 316 KIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDF 375
                             +  DR+  + + ++T      S VG+ +Y++ E+L   +  F
Sbjct: 161 ------------------TAADRK--FENTKRTA-----SFVGTAEYVSPELLLHSQCGF 195

Query: 376 TVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDII 435
           + D W+LGC++++   G  PF G +  +T+E +      L    L +  P        I 
Sbjct: 196 SSDIWALGCIIYQLNQGKPPFRGENELQTFEKI----VALDYKWLFSNSPQVVSIVQSI- 250

Query: 436 TRLIADPINRLRSFEHIKRMPYFAEVNFN 464
             L+ DP+ R  S   +K+ P+FA ++++
Sbjct: 251 --LVTDPLKR-PSAAQLKQNPWFASIDWD 276

>AFR335C [3527] [Homologous to ScYOL100W (PKH2) - SH; ScYDR490C
           (PKH1) - SH] (1046762..1049863) [3102 bp, 1033 aa]
          Length = 1033

 Score =  102 bits (255), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 126/273 (46%), Gaps = 51/273 (18%)

Query: 210 LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAV 269
           L ++R   ++KL + FQD  +LY  +E+ P GDF +++     L     ++Y +++  A+
Sbjct: 255 LNSSRVPGVIKLYFTFQDEANLYFLLEYAPNGDFLSVMKRFGTLSEECTKYYGAQILDAI 314

Query: 270 NALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPA 329
           + LH+ G  HRD+KPEN L+D    IKLTDFG                            
Sbjct: 315 HHLHKQGIIHRDVKPENILLDKTMKIKLTDFG---------------------------- 346

Query: 330 FTEKSI--EDRRKMYTHLRQTEVNY-ANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCML 386
            T K I  ED  K Y      ++N  + S VG+ +Y++ E+L     D   D W+ GC+L
Sbjct: 347 -TAKLIGREDENKPY------DLNTRSKSFVGTAEYVSPELLNDNYVDSRCDIWAFGCIL 399

Query: 387 FESLVGYTPFSGSSTNETYENLRHWKKTLR-RPVLDNGRPAFSDRTWDIITRLIADPINR 445
           F+ + G  PF   +TNE       ++K +R +     G P       D+I +L+     +
Sbjct: 400 FQMVAGKPPF--KATNEYLT----FQKVMRVQYAFTAGFPMI---LRDLIKQLLVKKPEQ 450

Query: 446 LRSFEHIKRMPYFAEVNF---NTLRQSAPPFTP 475
             +   I++  +F ++NF   +     AP   P
Sbjct: 451 RLTILQIEKHHFFNDINFRNGSVWSNPAPQIAP 483

>Scas_707.3
          Length = 1598

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 100/187 (53%), Gaps = 8/187 (4%)

Query: 147 RKRRLKPKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTE 206
           + + L P  KD+ ++            LARK+ T +  A             +  +V +E
Sbjct: 688 QTKNLTPTIKDYTILKPISKGAYGSVYLARKKITGDYFAIKVLKKSDMIAKNQVTNVKSE 747

Query: 207 RDILTTTRSD--WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISE 264
           R I+   +SD  ++ +L   FQ+ E+L+L ME++PGGD  TL+    +L +   + Y++E
Sbjct: 748 RAIMMV-QSDKPYVARLFATFQNKENLFLVMEYLPGGDLATLIKMMGYLPDQWVKQYLTE 806

Query: 265 MFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLA-AGTIS----TERIQSMKIRL 319
           +   V+ +H     H DLKP+N LID+ GH+KLTDFGL+ AG I      +R++S+    
Sbjct: 807 IIVGVDDMHRNWIIHHDLKPDNLLIDNLGHVKLTDFGLSRAGLIHRHKFVDRVKSLSPST 866

Query: 320 EEVKNLE 326
           E + N++
Sbjct: 867 EILSNIK 873

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 77/152 (50%), Gaps = 10/152 (6%)

Query: 358  GSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRR 417
            G+PDY+A E +EG       D+WS+GC++FE L GY PF  ++    +  +   K  +  
Sbjct: 1007 GTPDYLAPETIEGTGEGDQCDWWSVGCIMFELLFGYPPFHTNTPEGVFRKILSGK--IEW 1064

Query: 418  PVLDN---GRPAFSDRTWDIITR-LIADPINRL--RSFEHIKRMPYFAEVNFNTLRQSAP 471
            P  D+    R   S    D+I + L+ DP  RL     + IK+ PYF +VN++ +     
Sbjct: 1065 PQFDSIEEEREILSPEAKDLIMKLLVVDPSKRLGANGADEIKQHPYFKDVNWDHVYDEEA 1124

Query: 472  PFTPQLDSETDAGYFDDFTNEADMAKYADVFK 503
             F P +++  D  YFD  T  A +  + D ++
Sbjct: 1125 SFVPTVENPEDTDYFD--TRGAVLENFGDDYE 1154

>ACR218W [1265] [Homologous to ScYFL033C (RIM15) - SH]
           complement(731433..736142) [4710 bp, 1569 aa]
          Length = 1569

 Score =  100 bits (249), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 80/152 (52%), Gaps = 1/152 (0%)

Query: 153 PKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTT 212
           P  KD+++I            LA KR T E  A             +  +V +ER I+  
Sbjct: 677 PSIKDYDIIKPISKGAYGSVYLAYKRITGEYFAIKVLRKSDMIAKNQVTNVKSERVIMMV 736

Query: 213 TRSDWLVKLLYA-FQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNA 271
                 V  LYA FQ+ E+L+L ME++ GGD  TL+     L +  A+ YI+E+   V+ 
Sbjct: 737 QSEKPYVAKLYATFQNKENLFLVMEYLSGGDLATLIKMMGNLPDKWAKQYITEVIIGVDD 796

Query: 272 LHELGYTHRDLKPENFLIDSEGHIKLTDFGLA 303
           +H  G  H DLKP+N LIDS GH+KLTDFGL+
Sbjct: 797 MHMSGIIHHDLKPDNLLIDSNGHVKLTDFGLS 828

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 70/136 (51%), Gaps = 8/136 (5%)

Query: 358  GSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRR 417
            G+PDY++ E + G       D+WS+GC+LFE L+GY PF  S+  + ++N+      +  
Sbjct: 1003 GTPDYLSPETILGTGESGASDWWSVGCILFEFLLGYPPFHASTVEDVFKNI--LSGQIDW 1060

Query: 418  PVLDNGRPA---FSDRTWDIITRLI-ADPINRLRS--FEHIKRMPYFAEVNFNTLRQSAP 471
            P   N        S    D+I +L+ ++P  RL +   + IK  PYF  +N++ +     
Sbjct: 1061 PSFPNKETELEYLSPEAKDLILKLLESNPEERLGANGAQEIKEHPYFKGINWSKVYDEEA 1120

Query: 472  PFTPQLDSETDAGYFD 487
             F P +D+  D  YFD
Sbjct: 1121 SFVPTVDNPEDTDYFD 1136

>KLLA0F11143g complement(1026129..1028570) similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, start by similarity
          Length = 813

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 96/215 (44%), Gaps = 52/215 (24%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEM 265
           E D+L       +VKL   F+D ++ Y+ MEFV GGD    +     +     R    ++
Sbjct: 238 ELDVLQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQV 297

Query: 266 FCAVNALHELGYTHRDLKPENFLIDSEGH--IKLTDFGLAAGTISTERIQSMKIRLEEVK 323
             AV  +H+ G +HRDLKP+N +I+ +    IK+TDFGLA                    
Sbjct: 298 LEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAK------------------- 338

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK---------YD 374
                                  Q +  + N+  G+  Y+A EV++GK          Y 
Sbjct: 339 ----------------------VQNQNTFLNTFCGTLAYVAPEVIDGKNAEDKTNRDLYS 376

Query: 375 FTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLR 409
             VD WS+GC+++  L G+ PFSG S NE ++ ++
Sbjct: 377 SLVDMWSIGCLVYVILTGHLPFSGQSQNELFKQIK 411

>Kwal_56.24091
          Length = 381

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/305 (24%), Positives = 127/305 (41%), Gaps = 51/305 (16%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DFE+               + + T  +CA                    E +I ++ +  
Sbjct: 122 DFEVGKKLGKGKFGKVYCVKHKRTGFICALKAMKKSEIVQYNVQKQFRREVEIQSSLKHP 181

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
            L +L   F D + +YL ME++  G+    L +     +  A  ++ +M  A+N +H   
Sbjct: 182 NLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKN 241

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
             HRD+KPEN L+  +  +KLTDFG +   +   +                         
Sbjct: 242 ILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSK------------------------- 276

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
                    R+T       + G+ DY++ E+++ ++YD  VD W+LG + +E LVG  PF
Sbjct: 277 ---------RKT-------LCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGSPPF 320

Query: 397 SGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA-DPINRLRSFEHIKRM 455
              +   TY+  R  K+ LR P         S    D+I+RL+  DP NR+   + +KR 
Sbjct: 321 EEDTKELTYK--RIIKRDLRFP------DQVSPHARDLISRLLEYDPQNRI-PLKDVKRH 371

Query: 456 PYFAE 460
           P+  +
Sbjct: 372 PWIKK 376

>Scas_502.2
          Length = 1116

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 114/255 (44%), Gaps = 44/255 (17%)

Query: 210 LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAV 269
           L  +RS  +++L + FQD  SLY  +E+ P GD  +L+     L      +Y +++  A+
Sbjct: 229 LNNSRS--IIRLFFTFQDEASLYFLLEYAPNGDLLSLMKKFGSLNEECCCYYGAQIIDAI 286

Query: 270 NALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPA 329
             +H  G  HRD+KPEN L+D +  +K+TDFG       T +I   K           P 
Sbjct: 287 KFMHSKGIIHRDIKPENILLDKDMKVKITDFG-------TAKILDNK-----------PP 328

Query: 330 FTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFES 389
            T   +  R K              S VG+ +Y++ E+L     D   D W+ GC++F+ 
Sbjct: 329 GTSYDLLTRSK--------------SFVGTAEYVSPELLNDNYTDARSDIWAFGCIVFQM 374

Query: 390 LVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRLRS 448
           + G  PF  ++   T++ +   +              F     D++ R LI  P  RL +
Sbjct: 375 IAGKPPFKATNEYLTFQKVMKVQYAFTA--------GFPTVVRDLVKRILIKAPEQRL-T 425

Query: 449 FEHIKRMPYFAEVNF 463
            E I++  +F   NF
Sbjct: 426 IEAIEKHHFFRSKNF 440

>Kwal_14.1159
          Length = 1521

 Score = 97.8 bits (242), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 86/169 (50%), Gaps = 2/169 (1%)

Query: 153 PKNKDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTT 212
           P  KD+++I            LA++R T E  A             +  +V +ER I+  
Sbjct: 672 PSIKDYDVIKPISKGAYGSVFLAKRRITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMV 731

Query: 213 TRSDWLVKLLYA-FQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNA 271
             +   V  LYA FQ+  +L+L ME++ GGD  TL+     L +   + YISE+   V  
Sbjct: 732 QSNKPYVAKLYATFQNRGNLFLVMEYLSGGDLGTLIKMMGSLPDQWVKQYISEVIYGVED 791

Query: 272 LHELGYTHRDLKPENFLIDSEGHIKLTDFGLA-AGTISTERIQSMKIRL 319
           +H+ G  H DLKP+N LID  GH+KLTDFGL+  G ++     + K RL
Sbjct: 792 MHQSGIIHHDLKPDNLLIDQRGHLKLTDFGLSRMGLVTRHTGATQKSRL 840

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 67/136 (49%), Gaps = 8/136 (5%)

Query: 358  GSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRR 417
            G+PDY+A E +EG     + D+WS+GCMLFE + GY PF  S+  E + N+      +  
Sbjct: 960  GTPDYLAPETIEGTGETDSSDWWSVGCMLFEFVFGYPPFHASTVEEVFSNI--LAGNIDW 1017

Query: 418  PVLDN---GRPAFSDRTWDIITR-LIADPINRLRS--FEHIKRMPYFAEVNFNTLRQSAP 471
            P   +    R   S    D+I + L+ DP  RL +   E I   PYF +V++  L +   
Sbjct: 1018 PAFPDEATEREYISPEARDLIEKLLVVDPDKRLGANGAEEIFEHPYFQDVDWENLYKDTG 1077

Query: 472  PFTPQLDSETDAGYFD 487
             F P +       YFD
Sbjct: 1078 SFVPDIAHPESTDYFD 1093

>ACL006W [1043] [Homologous to ScYMR001C (CDC5) - SH]
           complement(344395..346521) [2127 bp, 708 aa]
          Length = 708

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 98/235 (41%), Gaps = 42/235 (17%)

Query: 177 KRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAME 236
           K D+ +V A                 +L+E  I  + +   +V+    F+D  ++Y+ +E
Sbjct: 91  KDDSGKVFAAKTVAKISIKSEKTRKKLLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLE 150

Query: 237 FVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIK 296
             P G    LL   + L     RF+ +++  A+  +H     HRDLK  N   D   ++K
Sbjct: 151 ICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLK 210

Query: 297 LTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSM 356
           + DFGLAA   +                            DR + YT            +
Sbjct: 211 IGDFGLAAVLAN----------------------------DRERKYT------------I 230

Query: 357 VGSPDYMALEVLEGKK--YDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLR 409
            G+P+Y+A EVL GK   + F VD WS+G M++  L+G  PF     N  YE ++
Sbjct: 231 CGTPNYIAPEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNTIYERIK 285

>Kwal_26.8796
          Length = 796

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/267 (28%), Positives = 113/267 (42%), Gaps = 57/267 (21%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           V  E ++L       +V L   ++D +S YL MEFV GGD    +     +     R   
Sbjct: 231 VARELEVLQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREIT 290

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLI--DSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
            ++  AV  +H +G +HRDLKP+N LI  D    +K+TDFGLA            KI   
Sbjct: 291 RQILEAVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLA------------KI--- 335

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK-------- 372
                                     Q    +  +  G+  Y+A EV+ GK         
Sbjct: 336 --------------------------QGNGTFMKTFCGTLAYVAPEVISGKNSGEKEGNT 369

Query: 373 YDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTW 432
           Y   VD WS+GC+++  L G+ PFSGS+ N+ Y+ +     +     L + R   SD   
Sbjct: 370 YSSLVDMWSIGCLVYVILTGHLPFSGSTQNDLYKQIT--AGSYHEGPLKDYR--ISDDAR 425

Query: 433 DIITRLI-ADPINRLRSFEHIKRMPYF 458
           D I   +  DP NR+ + E   R P+ 
Sbjct: 426 DFIESFLQVDPRNRMTA-EQALRHPWI 451

>Kwal_56.22476
          Length = 697

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 92/209 (44%), Gaps = 42/209 (20%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           +L+E  I  + R   +V+ +  F+D  ++Y+ +E  P G    LL   + L     RF+ 
Sbjct: 123 LLSEIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFT 182

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
           +++  AV  +H     HRDLK  N   D   ++K+ DFGLAA   +              
Sbjct: 183 TQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLAN-------------- 228

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK--YDFTVDYW 380
                         DR + YT            + G+P+Y+A EVL GK   + + VD W
Sbjct: 229 --------------DRERKYT------------VCGTPNYIAPEVLTGKHTGHSYEVDIW 262

Query: 381 SLGCMLFESLVGYTPFSGSSTNETYENLR 409
           S G M++  L+G  PF     N  YE ++
Sbjct: 263 SCGVMIYALLIGKPPFQAKEVNIIYERIK 291

>ACR142W [1189] [Homologous to ScYPL153C (RAD53) - SH]
           complement(597519..600032) [2514 bp, 837 aa]
          Length = 837

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 114/265 (43%), Gaps = 61/265 (23%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           V  E ++L       +V L   ++D ES YL MEFV GGD    +     +     R   
Sbjct: 260 VTRELEVLRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREIT 319

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGH--IKLTDFGLAAGTISTERIQSMKIRLE 320
            ++  AV  +HE G +HRDLKP+N LI+ +    +K+TDFGLA            KI   
Sbjct: 320 RQILEAVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLA------------KI--- 364

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK-------- 372
                                     Q    +  +  G+  Y+A EV+ GK         
Sbjct: 365 --------------------------QDNTTFMKTFCGTLAYVAPEVIGGKNPEGNGANG 398

Query: 373 --YDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDR 430
             Y   VD WS+GC+++  L G+ PFSGS+  + Y+ + +       P+ D      SD 
Sbjct: 399 NLYSSLVDMWSIGCLVYVILTGHLPFSGSTQEQLYKQIANGSYH-EGPLKDY---WISDE 454

Query: 431 TWDIITRLIA-DPINRL---RSFEH 451
             D I  L+  +P++RL   R+ +H
Sbjct: 455 ARDFIDSLLQINPVDRLTAERALQH 479

>KLLA0B02332g complement(206863..207948) similar to sp|P38991
           Saccharomyces cerevisiae YPL209c IPL1 ser/thr protein
           kinase, start by similarity
          Length = 361

 Score = 91.3 bits (225), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 122/301 (40%), Gaps = 57/301 (18%)

Query: 156 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRS 215
           +DFE+               + R+T  +CA                    E +I  + + 
Sbjct: 98  QDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKKEIVQYTIQKQFRREVEIQGSFKH 157

Query: 216 DWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275
             L +L   F D + +YL ME+V  G+    L N   L  T A +++ +M  A++ +H  
Sbjct: 158 KNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQMANALDYMHSK 217

Query: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335
              HRD+KPEN LI     IKLTDFG +                                
Sbjct: 218 NILHRDIKPENILIGFNNTIKLTDFGWSVYN----------------------------- 248

Query: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395
           ED +K  T            + G+ DY++ E+++ ++Y+  VD W+LG + +E LVG  P
Sbjct: 249 EDGQKRKT------------LCGTIDYLSPELIKSREYNNKVDVWALGVLTYELLVGSPP 296

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRM 455
           F   +   TY   R  +  L+ P+        S +  D+I RL+         FE  KR+
Sbjct: 297 FEEDTKEMTYR--RILRCDLKFPL------NVSPQARDLIVRLL--------QFEPSKRI 340

Query: 456 P 456
           P
Sbjct: 341 P 341

>Scas_700.54
          Length = 698

 Score = 91.3 bits (225), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/298 (27%), Positives = 130/298 (43%), Gaps = 63/298 (21%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEM 265
           E ++L       +V+L   ++D +S Y+ MEFV GGD    +     +     +    ++
Sbjct: 269 ELEVLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQI 328

Query: 266 FCAVNALHELGYTHRDLKPENFLIDSEGH--IKLTDFGLAAGTISTERIQSMKIRLEEVK 323
             AV  +H  G +HRDLKP+N LI+ +    +K+TDFGLA                    
Sbjct: 329 LEAVKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAK------------------- 369

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGK--------KYDF 375
                                  Q   ++  +  G+  Y+A EV+ GK        +Y  
Sbjct: 370 ----------------------VQGNGSFMKTFCGTLAYVAPEVIGGKGETNEERNEYSS 407

Query: 376 TVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDII 435
            VD WS+GC+++  L G+ PFSGS+  + Y+ +   + +     L + R +   R++ I 
Sbjct: 408 LVDMWSMGCLVYVILTGHLPFSGSTQEQLYKQIS--RGSYHEGPLKDFRISDEARSF-ID 464

Query: 436 TRLIADPINRL---RSFEH--IKRMPY---FAEVNFNTLRQSAPPFTPQLDSETDAGY 485
           + L  +P NRL   R+ EH  IK   Y   F E +  +L +S       L+S  DA Y
Sbjct: 465 SLLQVNPGNRLTAARALEHPWIKMAQYSQSFKEASQISLTESLSQ-QKLLESMDDAQY 521

>AFL101C [3094] [Homologous to ScYPL209C (IPL1) - SH]
           (249144..250247) [1104 bp, 367 aa]
          Length = 367

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 116/258 (44%), Gaps = 59/258 (22%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEM 265
           E +I ++ R   L +L   F D + +YL ME++  G+    L       +  A +Y+ +M
Sbjct: 157 EVEIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQM 216

Query: 266 FCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNL 325
             A++ +HE    HRD+KPEN +I     IKLTDFG                        
Sbjct: 217 ADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFG------------------------ 252

Query: 326 EFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCM 385
            +   T K    +RK              ++ G+ DY++ E++  ++Y+  VD W+LG +
Sbjct: 253 -WSVITPKG--SKRK--------------TLCGTVDYLSPELIRSREYNEKVDVWALGVL 295

Query: 386 LFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRT----WDIITRLIA- 440
            +E LVG  PF   S   TY      K+ L+R ++      F D        +I+RL+  
Sbjct: 296 TYELLVGSPPFEEESKELTY------KRILKRNLI------FPDHVDTEARHLISRLLEY 343

Query: 441 DPINRLRSFEHIKRMPYF 458
           DP +R+   + +K+ P+ 
Sbjct: 344 DPGDRI-PLKEVKKHPWI 360

>CAGL0J11638g complement(1128620..1130860) highly similar to
           sp|P32562 Saccharomyces cerevisiae YMR001c CDC5 involved
           in regulation of DNA replication, hypothetical start
          Length = 746

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 92/209 (44%), Gaps = 42/209 (20%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           +L+E  I  +     +V+ +  F+D  ++Y+ +E  P G    L+   + +     RF++
Sbjct: 125 LLSEIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFM 184

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
           +++   +  +H     HRDLK  N   D   ++K+ DFGLAA   +              
Sbjct: 185 TQICGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLAN-------------- 230

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK--YDFTVDYW 380
                         DR + +T            + G+P+Y+A EVL GK   + + VD W
Sbjct: 231 --------------DRERKFT------------ICGTPNYIAPEVLMGKHSGHSYEVDIW 264

Query: 381 SLGCMLFESLVGYTPFSGSSTNETYENLR 409
           S+G ML+  L+G  PF     N  YE ++
Sbjct: 265 SIGVMLYALLIGKPPFQAKDVNTIYERIK 293

>KLLA0C01650g 128119..131457 similar to sp|Q12263 Saccharomyces
           cerevisiae YDR507c GIN4 ser/thr protein kinase, start by
           similarity
          Length = 1112

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 101/238 (42%), Gaps = 47/238 (19%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +++L   ++ ++ LY+ +E+V  G+   LL+    L    A  +  ++   ++  H LG 
Sbjct: 88  VLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGI 147

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLKPEN L+D + ++KL DFG+AA                              +E 
Sbjct: 148 VHRDLKPENLLLDHKFNVKLADFGMAA------------------------------LES 177

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY-DFTVDYWSLGCMLFESLVGYTPF 396
           + K+             +  GSP Y A E++ G  Y  F  D WS G +L+  L G  PF
Sbjct: 178 KDKLL-----------ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 226

Query: 397 SGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLI-ADPINRLRSFEHIK 453
                N     L+        P    G    S    D+I R++  DP  R+++ E +K
Sbjct: 227 DEEDGNIRNLLLKVQSGKFEMP----GDDEISSEAQDLIARILTVDPEQRIKTREILK 280

>KLLA0C06138g 540409..542535 similar to sp|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication, start by similarity
          Length = 708

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/250 (26%), Positives = 103/250 (41%), Gaps = 47/250 (18%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           +L+E  I  + +   +V+    F+D  ++Y+ +E  P G    LL   + L     RF +
Sbjct: 134 LLSEIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCM 193

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
            ++  A+  +H     HRDLK  N   D E ++K+ DFGLAA   +              
Sbjct: 194 IQIIGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLAN-------------- 239

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK--YDFTVDYW 380
                         D+ + YT            + G+P+Y+A EVL GK   + + VD W
Sbjct: 240 --------------DKERKYT------------ICGTPNYIAPEVLTGKHTGHSYEVDIW 273

Query: 381 SLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIA 440
           S+G ML+  L G  PF        YE ++      R  +    +P  SD    I   L  
Sbjct: 274 SIGVMLYALLFGKPPFQAKEVETIYERIK-----CRDFIFPADKPVSSDAKNLISHLLQL 328

Query: 441 DPINRLRSFE 450
           +P  R   +E
Sbjct: 329 NPAARPSLYE 338

>CAGL0K08514g complement(853314..857783) similar to sp|P34244
           Saccharomyces cerevisiae YKL101w
           serine/threonine-protein kinase, hypothetical start
          Length = 1489

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 70/236 (29%), Positives = 103/236 (43%), Gaps = 60/236 (25%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++ LL  +++   LYL +E+V GG+    L++   L    A  Y +++   V+  H    
Sbjct: 188 VMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNI 247

Query: 278 THRDLKPENFLIDSEGH-IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
            HRDLKPEN L+D +   IK+ DFG+AA                    LE P    K +E
Sbjct: 248 CHRDLKPENLLLDKKNKVIKIADFGMAA--------------------LELP---NKLLE 284

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY-DFTVDYWSLGCMLFESLVGYTP 395
                             +  GSP Y + E++ GK Y     D WS G +LF  L G+ P
Sbjct: 285 ------------------TSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLP 326

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGR----PAFSDRTWDIITR-LIADPINRL 446
           F          N  + KK L +  +  GR    P  ++   D+ITR L+ +P  RL
Sbjct: 327 F----------NDDNIKKLLLK--VQAGRFQLPPYLTNDAKDLITRILVTNPEKRL 370

>KLLA0F09031g 839103..841004 similar to sp|P43565 Saccharomyces
           cerevisiae YFL033c RIM15 protein kinase involved in
           expression of meiotic genes, hypothetical start
          Length = 633

 Score = 87.4 bits (215), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 76/143 (53%), Gaps = 8/143 (5%)

Query: 351 NYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
           N + +  G+PDY+A E ++G     T D+WS+GC+ FE L GY PF G++ +E +EN+  
Sbjct: 58  NESKNFFGTPDYLAPETIKGTGESDTCDWWSVGCIFFEFLFGYPPFHGTTVDEVFENI-- 115

Query: 411 WKKTLRRPVLDNGRPAFSDRTWD----IITRLIADPINRLRS--FEHIKRMPYFAEVNFN 464
               +R P   +        + D    +I  L+ DP  RL +   + IK  PYF +V+++
Sbjct: 116 IGGVIRWPEFPDAETEMEYISPDAKDLVIKLLVLDPNKRLGASGSQEIKEHPYFKDVDWD 175

Query: 465 TLRQSAPPFTPQLDSETDAGYFD 487
            +    P F P+++   D  YFD
Sbjct: 176 HVYDEQPSFVPRVEHPEDTEYFD 198

>Scas_627.7
          Length = 349

 Score = 85.5 bits (210), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 103/252 (40%), Gaps = 41/252 (16%)

Query: 157 DFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSD 216
           DFE+               R ++T  +CA                    E +I T+    
Sbjct: 90  DFEIGKKLGKGKFGKVYCVRHKETGFICALKVMDKAEIVQYNLQKQFRREVEIQTSLNHP 149

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
            L KL   F D + +YL ME++  G+   LL +     +  A  ++ ++  A+N LH+  
Sbjct: 150 NLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQ 209

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
             HRDLKPEN LI     IKLTDFG +             I    VK             
Sbjct: 210 IIHRDLKPENILIGFNNVIKLTDFGWSI------------INPRGVK------------- 244

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
                    R+T       + G+ DY++ E++  ++YD  VD W+LG + +E +VG  PF
Sbjct: 245 ---------RKT-------LCGTIDYLSPEMIRSREYDDKVDVWALGVLTYELIVGSPPF 288

Query: 397 SGSSTNETYENL 408
              +   TY+ +
Sbjct: 289 EEDTKELTYKRI 300

>Scas_493.2
          Length = 1117

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 100/247 (40%), Gaps = 47/247 (19%)

Query: 209 ILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCA 268
           I+   R   ++ L   ++   +LY+ +E+   G+   LL+    L    A  +  ++   
Sbjct: 87  IMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEAVRFFRQIIIG 146

Query: 269 VNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFP 328
           ++  H LG  HRDLKPEN L+D + +IK+ DFG+AA                        
Sbjct: 147 ISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA------------------------ 182

Query: 329 AFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY-DFTVDYWSLGCMLF 387
                             +TE     +  GSP Y A E++ G  Y  F  D WS G +LF
Sbjct: 183 -----------------LETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILF 225

Query: 388 ESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLI-ADPINRL 446
             L G  PF     N     L+        P  D      S    D+I+R++  DP  R+
Sbjct: 226 ALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDDDE----MSRDAQDLISRILTVDPTKRI 281

Query: 447 RSFEHIK 453
           ++ E +K
Sbjct: 282 KTREILK 288

>CAGL0M02233g complement(267332..269635) highly similar to sp|P22216
           Saccharomyces cerevisiae YPL153c SPK1 ser/thr/tyr
           protein kinase, hypothetical start
          Length = 767

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 113/287 (39%), Gaps = 69/287 (24%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           V  E ++L       +V L   ++D  + Y+ MEF+ GGD    +     +     R   
Sbjct: 231 VSRELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREIS 290

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGH--IKLTDFGLAAGTISTERIQSMKIRLE 320
            ++  A+  +H  G +HRDLKP+N LI+ +    +K+TDFGLA                 
Sbjct: 291 RQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAK---------------- 334

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEG---------- 370
                                     Q   +   +  G+  Y+A EV+ G          
Sbjct: 335 -------------------------VQGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEET 369

Query: 371 ----KKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPA 426
                +Y   VD WS+GC++F  L G+ PFSGS+  + YE +R  K +     L + R  
Sbjct: 370 EEERIEYSSLVDMWSMGCLVFVILTGHLPFSGSTQEQLYEQIR--KGSYHEGPLKDFR-- 425

Query: 427 FSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPF 473
            SD   D I  L+          +  KRM     +N   ++Q +  F
Sbjct: 426 ISDEARDFIDGLL--------QVDQSKRMTVDDALNHPWIKQCSSQF 464

>AFR696C [3889] [Homologous to ScYDR507C (GIN4) - SH; ScYCL024W
           (KCC4) - SH] (1721689..1725117) [3429 bp, 1142 aa]
          Length = 1142

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 98/237 (41%), Gaps = 45/237 (18%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +++L   ++  + LY+ +E+V  G+   LL+    L    A  +  ++   ++  H LG 
Sbjct: 90  VLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFRQIIIGISYCHALGI 149

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLKPEN L+D + +IKL DFG+AA                              +E 
Sbjct: 150 VHRDLKPENLLLDHKFNIKLADFGMAA------------------------------LES 179

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY-DFTVDYWSLGCMLFESLVGYTPF 396
           + K+             +  GSP Y A E++ G  Y  F  D WS G +L+  L G  PF
Sbjct: 180 KDKLL-----------ETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPF 228

Query: 397 SGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIK 453
                N     L+        P  D   P   D    I+T    +P  R+++ E +K
Sbjct: 229 DEEDGNIRNLLLKVQSGKYEIPGEDEISPEARDLIVQILT---VEPEQRIKTREILK 282

>Scas_616.10
          Length = 1461

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 97/232 (41%), Gaps = 52/232 (22%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++ L   +++   LYL +E+V GG+    L++   L    A  Y  ++   V+  H    
Sbjct: 198 VMALYEVWENKSELYLVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNI 257

Query: 278 THRDLKPENFLIDSEGH-IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
            HRDLKPEN L+D +   IK+ DFG+AA                    LE P        
Sbjct: 258 CHRDLKPENLLLDKKNKSIKIADFGMAA--------------------LELP-------- 289

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY-DFTVDYWSLGCMLFESLVGYTP 395
                   L QT         GSP Y + E++ GK Y     D WS G +LF  L G+ P
Sbjct: 290 ------NKLLQTS-------CGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLP 336

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRL 446
           F+  +  +    ++  K   R P         S    D+I+R L+ DP  R+
Sbjct: 337 FNDDNIKKLLLKVQAGK--FRMPS------TLSPEAQDLISRILVIDPSKRI 380

>YDR507C (GIN4) [1321] chr4 complement(1462346..1465774)
           Serine/threonine-protein kinase required for septin
           organization at the bud neck, has similarity to Ycl024p
           [3429 bp, 1142 aa]
          Length = 1142

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/238 (26%), Positives = 97/238 (40%), Gaps = 47/238 (19%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +++L   ++    LYL +E+   G+   LL+    L    A  +  ++   V+  H LG 
Sbjct: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGI 152

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLKPEN L+D + +IK+ DFG+AA                                 
Sbjct: 153 VHRDLKPENLLLDHKYNIKIADFGMAA--------------------------------- 179

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGYTPF 396
                    +TE     +  GSP Y A E++ G  Y  F  D WS G +LF  L G  PF
Sbjct: 180 --------LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231

Query: 397 SGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLI-ADPINRLRSFEHIK 453
                N     L+  K     P  D      S    D+I +++  DP  R+++ + +K
Sbjct: 232 DEEDGNIRTLLLKVQKGEFEMPSDDE----ISREAQDLIRKILTVDPERRIKTRDILK 285

>CAGL0K05709g complement(555903..559214) similar to sp|Q12263
           Saccharomyces cerevisiae YDR507c GIN4, start by
           similarity
          Length = 1103

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 97/238 (40%), Gaps = 47/238 (19%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +++L   ++    LYL +E+   G+   +L+    L    A     ++   ++  H LG 
Sbjct: 91  VLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGV 150

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLKPEN L+D++ +IK+ DFG+AA                                 
Sbjct: 151 VHRDLKPENLLLDNKLNIKIADFGMAA--------------------------------- 177

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGYTPF 396
                    ++E     +  GSP Y A E++ G  Y+ F+ D WS G +LF  L G  PF
Sbjct: 178 --------LESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPF 229

Query: 397 SGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLI-ADPINRLRSFEHIK 453
                N     L+  K     P  D      +    D++ RL+  DP  R+   E +K
Sbjct: 230 DEEDGNIRNLLLKVQKGEFEMPDDDE----ITKEAQDLLARLLTVDPSKRITIREILK 283

>Kwal_55.21545
          Length = 865

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 96/220 (43%), Gaps = 47/220 (21%)

Query: 180 TKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYA--FQDTESLYLAMEF 237
           TK+VCA             E   V  E   L++ +    +   Y     DT+ L++ ME+
Sbjct: 41  TKQVCAIKVLNLDSADD--EVEDVQKEIQFLSSLKQVPNITHYYGSYLNDTK-LWVIMEY 97

Query: 238 VPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKL 297
             GG  RTLL   + +   +    + E+  A+  +H+ G  HRD+K  N LI ++GHIKL
Sbjct: 98  CAGGSLRTLLRPGK-IGEQYIGVIMRELLTALMHIHKDGVIHRDIKAANVLITNDGHIKL 156

Query: 298 TDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMV 357
            DFG+AA      ++   KIR                           RQT       M 
Sbjct: 157 CDFGVAA------QLSQTKIR---------------------------RQT-------MA 176

Query: 358 GSPDYMALEV-LEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
           G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 177 GTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 216

>Scas_644.15
          Length = 726

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 90/207 (43%), Gaps = 42/207 (20%)

Query: 205 TERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISE 264
           +E  I  + +   +V  +  F+D  ++Y+ +E    G    L+   + L     RF+ ++
Sbjct: 138 SEIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQ 197

Query: 265 MFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKN 324
           +  AV  +H     HRDLK  N   D + ++K+ DFGLAA   +                
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLAN---------------- 241

Query: 325 LEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK--YDFTVDYWSL 382
                       +R + YT            + G+P+Y+A EVL GK   + F VD WS+
Sbjct: 242 ------------NRERKYT------------VCGTPNYIAPEVLMGKHAGHSFEVDIWSI 277

Query: 383 GCMLFESLVGYTPFSGSSTNETYENLR 409
           G M++  LVG  PF     N  Y+ ++
Sbjct: 278 GVMIYALLVGKPPFQAKDVNVIYDRIK 304

>YCL024W (KCC4) [520] chr3 (79161..82274) Serine/threonine protein
           kinase involved in septin organization and cell cycle
           control [3114 bp, 1037 aa]
          Length = 1037

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 95/232 (40%), Gaps = 47/232 (20%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++ L   ++   +LYL +E+   G+   LL++   L    A     ++   ++  H LG 
Sbjct: 89  VLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGI 148

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLKPEN L+DS  +IK+ DFG+AA                                 
Sbjct: 149 VHRDLKPENLLLDSFYNIKIADFGMAA--------------------------------- 175

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGYTPF 396
                    QT+ +   +  GSP Y A E++ G  Y+ F  D WS G +LF  L G  PF
Sbjct: 176 --------LQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPF 227

Query: 397 SGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRLR 447
              + N     L+  K     P         S    D+I + L+ DP  R++
Sbjct: 228 DEENGNVRDLLLKVQKGQFEMP----NDTEISRDAQDLIGKILVVDPRQRIK 275

>CAGL0I09504g 909319..910905 similar to sp|P38147 Saccharomyces
           cerevisiae YBR274w CHK1 regulats inhibitory Cdk
           phosphorylation of PDS1, start by similarity
          Length = 528

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 54/170 (31%), Positives = 79/170 (46%), Gaps = 38/170 (22%)

Query: 229 ESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFL 288
           E L++ +E   GGD    +     +    A+FY  ++  A+N LH++G  HRD+KPEN L
Sbjct: 88  EYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENIL 147

Query: 289 IDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQT 348
           +D +G++KL DFGLA+                               + RRK  T     
Sbjct: 148 LDKKGNLKLADFGLAS-------------------------------QFRRKDGT----- 171

Query: 349 EVNYANSMVGSPDYMALEVLEGKKYDFTV-DYWSLGCMLFESLVGYTPFS 397
            +  +    GSP YMA E+L  + Y   + D WS G +LF  L G  P+S
Sbjct: 172 -LRVSTDQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWS 220

>CAGL0M03729g complement(420316..422901) similar to sp|P48562
           Saccharomyces cerevisiae YNL298w CLA4, start by
           similarity
          Length = 861

 Score = 84.0 bits (206), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 89/202 (44%), Gaps = 48/202 (23%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTES-LYLAMEFVPGGDFRTLLINT-------RFLR 254
           ++ E  ++  +R + +V  L A+  TE  L++ ME++ GG    ++ N+         L 
Sbjct: 626 IVNEIMVMNDSRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLS 685

Query: 255 NTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQS 314
                + + E    +  LH+    HRD+K +N L+D++  +K+TDFG             
Sbjct: 686 EPQIAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFG------------- 732

Query: 315 MKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD 374
                          F  K  + R K  T            MVG+P +MA EV++ K+YD
Sbjct: 733 ---------------FCAKLTDQRSKRAT------------MVGTPYWMAPEVVKQKEYD 765

Query: 375 FTVDYWSLGCMLFESLVGYTPF 396
             VD WSLG M  E L G  P+
Sbjct: 766 AKVDVWSLGIMAIEMLEGEPPY 787

>CAGL0E05720g 569028..570104 similar to sp|P38991 Saccharomyces
           cerevisiae YPL209c IPL1 ser/thr protein kinase, start by
           similarity
          Length = 358

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/303 (23%), Positives = 117/303 (38%), Gaps = 49/303 (16%)

Query: 156 KDFEMITXXXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRS 215
           KDFE+               R + +  +CA                 +  E DI      
Sbjct: 98  KDFEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLGMDH 157

Query: 216 DWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHEL 275
             ++KL   F D + +YL ME    G+    L N     +  A  YI ++  A++ +H+ 
Sbjct: 158 PNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQIADALHYMHKK 217

Query: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSI 335
              HRD+KPEN LI  +  +KL DFG +                                
Sbjct: 218 RIIHRDVKPENVLIGFDNVVKLADFGWS-------------------------------- 245

Query: 336 EDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTP 395
                    +   E +   ++ G+ DY++ E++  ++YD  VD W+LG + +E +VG  P
Sbjct: 246 ---------ILNPEGSKRKTLCGTIDYLSPEMITPREYDEQVDVWALGVLAYELVVGVPP 296

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRM 455
           F  +S   TY+  R  K  L  P       + S    D+I++L+     +  S   +K  
Sbjct: 297 FEENSKELTYK--RILKCDLNFP------ESISKDAKDLISKLLVTDTTQRLSLTGVKTH 348

Query: 456 PYF 458
           P+ 
Sbjct: 349 PWI 351

>YCR073C (SSK22) [598] chr3 complement(242584..246579) Map kinase
            kinase kinase (MAPKKK) with strong similarity to Ssk2p,
            participates in the high-osmolarity signal transduction
            pathway [3996 bp, 1331 aa]
          Length = 1331

 Score = 81.6 bits (200), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 71/166 (42%), Gaps = 27/166 (16%)

Query: 235  MEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGH 294
            ME+  GG   +LL + R       + Y  E+   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1112 MEYCEGGSLASLLDHGRIEDEMVTQVYTFELLEGLAYLHQSGVVHRDIKPENILLDFNGI 1171

Query: 295  IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYAN 354
            IK  DFG A   + +        R   V+N     F                  E    N
Sbjct: 1172 IKYVDFGTARTVVGS--------RTRTVRNAAVQDFG----------------VETKSLN 1207

Query: 355  SMVGSPDYMALEVLEGKKYDFTV---DYWSLGCMLFESLVGYTPFS 397
             M+G+P YMA E + G      +   D W+LGC++ E   G  P+S
Sbjct: 1208 EMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWS 1253

>Scas_700.28
          Length = 896

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 99/243 (40%), Gaps = 49/243 (20%)

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           ++ KL         +++A+E+ PG +    +++   +         +++   V+  H L 
Sbjct: 90  YITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFAQIVGGVHYAHSLN 149

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
             HRDLK EN L+D  G  KLTDFG     ++       K  LE                
Sbjct: 150 CVHRDLKLENILLDKSGDAKLTDFGFTRECMT-------KTTLE---------------- 186

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGYTP 395
                             ++ G+  YMA E++E K YD F +D WSLG +L+  + G  P
Sbjct: 187 ------------------TICGTTVYMAPELIERKSYDGFKIDIWSLGVILYTMINGSMP 228

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRM 455
           F     +E  E    WK   + P L+      +    D+I RL+A   N   + E I + 
Sbjct: 229 F-----DEDDETKTEWKIVHQTPQLNEN--IVTADAKDLILRLLAKNPNDRPTVEQILKH 281

Query: 456 PYF 458
           P+ 
Sbjct: 282 PFL 284

>CAGL0M02519g complement(290723..292993) highly similar to tr|Q03002
           Saccharomyces cerevisiae YPL141c or sp|Q01919
           Saccharomyces cerevisiae YOR233w KIN4, hypothetical
           start
          Length = 756

 Score = 81.3 bits (199), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 81/181 (44%), Gaps = 42/181 (23%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +VKL    Q+++ + + +E+  GG+F   +   R L+  HA    S++  AV+ +H  G 
Sbjct: 129 IVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRRLKENHACRLFSQLISAVHYIHSKGL 188

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLK EN L+D+E ++ +TDFG                        EF          
Sbjct: 189 VHRDLKLENLLLDNEENLIITDFGFVN---------------------EF---------- 217

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKYDF-TVDYWSLGCMLFESLVGYTP 395
                  LRQ  +    +  GSP Y A E V+  + YD    D WS G +LF  L GY P
Sbjct: 218 -------LRQNGM--MKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLP 268

Query: 396 F 396
           +
Sbjct: 269 W 269

>YNR031C (SSK2) [4613] chr14 complement(680693..685432) MAP kinase
            kinase kinase (MAPKKK) involved in the high-osmolarity
            signal transduction pathway [4740 bp, 1579 aa]
          Length = 1579

 Score = 81.3 bits (199), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 80/171 (46%), Gaps = 21/171 (12%)

Query: 235  MEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGH 294
            ME+  GG    LL + R       + Y  ++   +  LHE G  HRD+KPEN L+D  G 
Sbjct: 1344 MEYCEGGSLAALLEHGRIEDEMVTQVYTLQLLEGLAYLHESGIVHRDVKPENILLDFNGV 1403

Query: 295  IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEV---- 350
            IK  DFG A      ++I +   RL  +  +E       + +   +  TH+  ++     
Sbjct: 1404 IKYVDFGAA------KKIANNGTRLASMNKIE-------NADGEHEDVTHVSDSKAVKNN 1450

Query: 351  -NYANSMVGSPDYMALEVLEGKKYDFTV---DYWSLGCMLFESLVGYTPFS 397
             N    M+G+P YMA E + G      +   D WSLGC++ E + G  P++
Sbjct: 1451 ENALLDMMGTPMYMAPESITGSTTKGKLGADDVWSLGCVVLEMITGRRPWA 1501

>CAGL0L11550g 1229719..1232937 similar to sp|P38692 Saccharomyces
           cerevisiae YHR102w NRK1 ser/thr protein kinase, start by
           similarity
          Length = 1072

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 53/172 (30%), Positives = 78/172 (45%), Gaps = 50/172 (29%)

Query: 230 SLYLAMEFVPGGDFRTLL----INTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPE 285
           SL++ ME+  GG  R+LL    I+ +++        + E+  A+  +H+    HRD+K  
Sbjct: 87  SLWIIMEYCAGGSLRSLLRPGKIDEKYIG-----VIMRELLVALKVIHKDNVIHRDIKAA 141

Query: 286 NFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHL 345
           N LI +EG +KL DFG+AA      ++    +R                           
Sbjct: 142 NVLITNEGQVKLCDFGVAA------QLNQTSLR--------------------------- 168

Query: 346 RQTEVNYANSMVGSPDYMALEV-LEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
           RQT       M G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 169 RQT-------MAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 213

>AER264C [2766] [Homologous to ScYCR073C (SSK22) - SH; ScYNR031C
            (SSK2) - SH] (1120017..1124468) [4452 bp, 1483 aa]
          Length = 1483

 Score = 81.3 bits (199), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 73/165 (44%), Gaps = 33/165 (20%)

Query: 235  MEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGH 294
            ME+  GG   +LL + R       + Y  +M   +  LHE G  HRD+KPEN L+D  G 
Sbjct: 1269 MEYCEGGSLASLLAHGRIEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGI 1328

Query: 295  IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYAN 354
            IK  DFG A    S     S K+ LE+                      H+         
Sbjct: 1329 IKYVDFGAAKVLASN---GSKKLNLEQ----------------------HME------GE 1357

Query: 355  SMVGSPDYMALEVLEGKKYD--FTVDYWSLGCMLFESLVGYTPFS 397
             M+G+P YM+ E + G  Y    + D WSLGC++ E + G  P++
Sbjct: 1358 KMIGTPMYMSPEAISGTGYGKFGSDDIWSLGCVILEMVTGRRPWA 1402

>YNL298W (CLA4) [4314] chr14 (68913..71441) Serine/threonine protein
           kinase required for cytokinesis [2529 bp, 842 aa]
          Length = 842

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 90/202 (44%), Gaps = 48/202 (23%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTES-LYLAMEFVPGGDFRTLLINTRFLRNTHARF- 260
           ++ E  ++  +R   +V  L A+  T+  L++ MEF+ GG    ++ N+    N+H+   
Sbjct: 607 IVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLT 666

Query: 261 -----YISEMFC-AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQS 314
                YI    C  +  LH+    HRD+K +N L+D+   +K+TDFG  A          
Sbjct: 667 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCA---------- 716

Query: 315 MKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD 374
                               + D+R               +MVG+P +MA EV++ ++YD
Sbjct: 717 -------------------RLTDKRSKRA-----------TMVGTPYWMAPEVVKQREYD 746

Query: 375 FTVDYWSLGCMLFESLVGYTPF 396
             +D WSLG M  E L G  P+
Sbjct: 747 EKIDVWSLGIMTIEMLEGEPPY 768

>ABL034W [558] [Homologous to ScYKL101W (HSL1) - SH]
           complement(333434..337711) [4278 bp, 1425 aa]
          Length = 1425

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 97/232 (41%), Gaps = 52/232 (22%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++ L   +++   LYL +E+V GG+    LI    L    A  Y  ++   V+  H    
Sbjct: 126 IMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFKQIVQGVSYCHNFNI 185

Query: 278 THRDLKPENFLIDSEGH-IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
            HRDLKPEN L+D +   +K+ DFG+AA              LE    L           
Sbjct: 186 CHRDLKPENLLLDKKNKTVKIADFGMAA--------------LETTNRL----------- 220

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT-VDYWSLGCMLFESLVGYTP 395
                             +  GSP Y + E++ G+KY  +  D WS G +LF  L G+ P
Sbjct: 221 ----------------LETSCGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLP 264

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRL 446
           F+  +  +    ++H +  +   V        S    D+I++ L+ DP  R+
Sbjct: 265 FNDDNVRKLLLKVQHGRYQMPSNV--------SKEAKDLISKILVVDPEKRI 308

>YKL101W (HSL1) [3161] chr11 (248566..253122) Serine/threonine
           protein kinase that genetically interacts with histone
           mutants and negatively regulates Swe1p protein kinase
           [4557 bp, 1518 aa]
          Length = 1518

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 105/243 (43%), Gaps = 60/243 (24%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++ L   +++   LYL +E+V GG+    L++   L    A  Y  ++   V+  H    
Sbjct: 176 VMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNI 235

Query: 278 THRDLKPENFLIDSEG-HIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
            HRDLKPEN L+D +   IK+ DFG+AA                    LE P        
Sbjct: 236 CHRDLKPENLLLDKKNRRIKIADFGMAA--------------------LELP-------- 267

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY-DFTVDYWSLGCMLFESLVGYTP 395
                   L +T         GSP Y + E++ G+ Y     D WS G +LF  L G+ P
Sbjct: 268 ------NKLLKTS-------CGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLP 314

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGR---PA-FSDRTWDIITR-LIADPINRLRSFE 450
           F          N  + KK L +  + +G+   P+  S    D+I++ L+ DP  R+ + E
Sbjct: 315 F----------NDDNIKKLLLK--VQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQE 362

Query: 451 HIK 453
            +K
Sbjct: 363 ILK 365

>YBR274W (CHK1) [453] chr2 (749551..751134) Checkpoint kinase,
           required for metaphase DNA-damage checkpoint [1584 bp,
           527 aa]
          Length = 527

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/183 (32%), Positives = 87/183 (47%), Gaps = 42/183 (22%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALH-ELG 276
           +++L+      E +++ +E   GGD    +     + +  A+FY  ++  A+N LH E G
Sbjct: 78  VLRLIDCNVSKEYMWIILEMADGGDLFDKIEPDVGVDSDVAQFYFQQLVSAINYLHVECG 137

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
             HRD+KPEN L+D  G++KL DFGLA    S  R +   +R+              S++
Sbjct: 138 VAHRDIKPENILLDKNGNLKLADFGLA----SQFRRKDGTLRV--------------SMD 179

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVL---EGKKYDFTVDYWSLGCMLFESLVGY 393
            R                   GSP YMA EVL   EG   D T D WS+G +LF  L G 
Sbjct: 180 QR-------------------GSPPYMAPEVLYSEEGYYADRT-DIWSIGILLFVLLTGQ 219

Query: 394 TPF 396
           TP+
Sbjct: 220 TPW 222

>Kwal_23.5290
          Length = 819

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 90/202 (44%), Gaps = 48/202 (23%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTES-LYLAMEFVPGGDFRTLLINTRFLRNTHARF- 260
           ++ E  ++  ++   +V  L A+  TE  L++ ME++ GG    L+ N+    ++H+   
Sbjct: 584 IVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDLIENSPANGSSHSPLT 643

Query: 261 -----YISEMFC-AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQS 314
                YI    C  +  LH+    HRD+K +N L+D+   +K+TDFG             
Sbjct: 644 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNRARVKITDFG------------- 690

Query: 315 MKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD 374
                          F  K  + R K  T            MVG+P +MA EV++ ++YD
Sbjct: 691 ---------------FCAKLTDKRSKRAT------------MVGTPYWMAPEVVKQREYD 723

Query: 375 FTVDYWSLGCMLFESLVGYTPF 396
             VD WSLG M  E L G  P+
Sbjct: 724 EKVDVWSLGIMTIEMLEGEPPY 745

>YOL113W (SKM1) [4709] chr15 (104325..106292) Serine/threonine
           protein kinase with similarity to Ste20p and Cla4p [1968
           bp, 655 aa]
          Length = 655

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 88/204 (43%), Gaps = 50/204 (24%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQ-DTESLYLAMEFVPGGDFRTLL---------INTRF 252
           ++ E  ++  +R + +V  L A+  D E L++ ME++ GG    +L          ++  
Sbjct: 419 IMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSP 478

Query: 253 LRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERI 312
           L      + + E    +  LH     HRD+K +N L++S+G +K+TDFG           
Sbjct: 479 LNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFG----------- 527

Query: 313 QSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK 372
                            F  +  E R K  T            MVG+P +MA E++  K 
Sbjct: 528 -----------------FCVELTEKRSKRAT------------MVGTPYWMAPEIVNQKG 558

Query: 373 YDFTVDYWSLGCMLFESLVGYTPF 396
           YD  VD WSLG ML E + G  P+
Sbjct: 559 YDEKVDVWSLGIMLIEMIEGEPPY 582

>KLLA0F11319g 1042436..1044967 similar to sgd|S0006071 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 843

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 82/177 (46%), Gaps = 43/177 (24%)

Query: 222 LYAFQDTES-LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHR 280
           LY    TES +++ +E+  G +    L+  + L    ++   S++  AV   HEL   HR
Sbjct: 93  LYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFSQIASAVYYAHELKCVHR 152

Query: 281 DLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRK 340
           DLK EN L+D  GH KLTDFG                            FT       R+
Sbjct: 153 DLKLENVLLDGNGHAKLTDFG----------------------------FT-------RE 177

Query: 341 MYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGYTPF 396
           M T   Q E     ++ G+  YMA E++E K YD F VD WSLG +L+  + GY PF
Sbjct: 178 MATR-SQLE-----TICGTTVYMAPELIERKCYDGFKVDIWSLGIILYTMINGYMPF 228

>KLLA0F13552g complement(1252906..1256709)
           gi|33386566|emb|CAD87727.1 Kluyveromyces lactis protein
           kinase, start by similarity
          Length = 1267

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 99/232 (42%), Gaps = 52/232 (22%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++ L   +++   LYL +E+V GG+    L++   L  + A  Y  ++  AV   H    
Sbjct: 136 VMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIHYFKQIVQAVAYCHGFNI 195

Query: 278 THRDLKPENFLIDSEGH-IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
            HRDLKPEN L+D +   IK+ DFG+AA   S + ++                       
Sbjct: 196 CHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLE----------------------- 232

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT-VDYWSLGCMLFESLVGYTP 395
                             +  GSP Y + E++ G+KY  +  D WS G +LF  L G+ P
Sbjct: 233 ------------------TSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLP 274

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRL 446
           F+  +  +    ++  K  + +          S    D+I+R L+ DP  R+
Sbjct: 275 FNDDNVKKLLLKVQSGKYQMPQ--------WLSVEAKDLISRILVVDPNRRI 318

>KLLA0C04191g 384198..386591 weakly similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15 protein kinase of
           the MAP kinase kinase kinase family, hypothetical start
          Length = 797

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 88/222 (39%), Gaps = 47/222 (21%)

Query: 175 ARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLA 234
           A KR T + CA             E N  + E D+L   R   +V+     Q    LY+ 
Sbjct: 27  AVKRGTNKPCAIKQIEFEDES---ELNEHMLEIDLLKNLRHQNIVEYRGFIQKAHELYII 83

Query: 235 MEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGH 294
           +E+   G  R +L +   L +     Y+++    +  LHE G  HRD+K  N L+  EG 
Sbjct: 84  LEYCARGSLRDILKHGPLLEDDTVN-YVTQTLYGLQYLHEQGVIHRDIKAANLLLTEEGI 142

Query: 295 IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYAN 354
           +KL DFG++                                       T + +  + YA 
Sbjct: 143 VKLADFGVS---------------------------------------TRINRMAMTYA- 162

Query: 355 SMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
              GSP++MA EV+ G+      D WSLG  + E L G  PF
Sbjct: 163 ---GSPNWMAPEVMTGQGASTVSDIWSLGATVVELLTGNPPF 201

>CAGL0M08910g complement(887703..889541) highly similar to sp|Q00372
           Saccharomyces cerevisiae YDR477w carbon catabolite
           derepressing ser/thr protein kinase, hypothetical start
          Length = 612

 Score = 79.0 bits (193), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/250 (26%), Positives = 104/250 (41%), Gaps = 56/250 (22%)

Query: 206 ERDI--LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 85  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQ 143

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 183

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT-VDYWSL 382
           N+                      T+ N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 184 NI---------------------MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 222

Query: 383 GCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAF-SDRTWDIITR-LIA 440
           G +L+  L    PF   S    ++N+ +   TL         P F S    D+I R LI 
Sbjct: 223 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTL---------PKFLSPGASDLIKRMLIV 273

Query: 441 DPINRLRSFE 450
           +P+NR+   E
Sbjct: 274 NPLNRISIHE 283

>YHR102W (KIC1) [2390] chr8 (316574..319816) Serine/threonine
           protein kinase involved in regulation of cell wall beta
           1,6-glucan levels, interacts with Cdc31p [3243 bp, 1080
           aa]
          Length = 1080

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 81/177 (45%), Gaps = 51/177 (28%)

Query: 225 FQDTESLYLAMEFVPGGDFRTLL----INTRFLRNTHARFYISEMFCAVNALHELGYTHR 280
            +DT SL++ ME   GG  R+LL    I+ +++        + E+  A+  +H+    HR
Sbjct: 90  LKDT-SLWIIMEHCAGGSLRSLLRPGKIDEKYIG-----VIMRELLVALKCIHKDNVIHR 143

Query: 281 DLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRK 340
           D+K  N LI +EG++KL DFG+AA      ++    +R                      
Sbjct: 144 DIKAANVLITNEGNVKLCDFGVAA------QVNQTSLR---------------------- 175

Query: 341 MYTHLRQTEVNYANSMVGSPDYMALEV-LEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
                RQT       M G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 176 -----RQT-------MAGTPYWMAPEVIMEGVYYDTKVDIWSLGITTYEIATGNPPY 220

>YGL158W (RCK1) [1831] chr7 (207036..208574) Serine/threonine
           protein kinase with similarity to Cmk1p, Cmk2p, and
           Cmk3p [1539 bp, 512 aa]
          Length = 512

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/176 (29%), Positives = 80/176 (45%), Gaps = 23/176 (13%)

Query: 224 AFQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDL 282
           AFQ++ + Y L  E V GG+    ++         AR  I+++  A+  +H +G  HRD+
Sbjct: 201 AFQESANYYYLVTELVTGGEIFDRIVQLTCFSEDLARHVITQVAIAIKHMHYMGIVHRDV 260

Query: 283 KPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKM- 341
           KPEN L +      +  +GL  G +  E               EF            K+ 
Sbjct: 261 KPENLLFE-----PIPFYGLD-GDMQKED--------------EFTLGVGGGGIGLVKLM 300

Query: 342 -YTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
            +   ++   N A +  G+ +Y+A EV   K+Y   VD WS+GC+LF  L GY PF
Sbjct: 301 DFGLAKKLRNNTAKTPCGTIEYVASEVFTSKRYSMKVDMWSIGCVLFTLLCGYPPF 356

>KLLA0A07403g 661261..663900 similar to sp|P48562 Saccharomyces
           cerevisiae YNL298w CLA4 ser/thr protein kinase, start by
           similarity
          Length = 879

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 88/202 (43%), Gaps = 48/202 (23%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTES-LYLAMEFVPGGDFRTLLINT-------RFLR 254
           ++ E  ++  ++ + +V  L A+  TE  L++ ME++ GG    ++ N+         L 
Sbjct: 644 IVNEILVMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTGSSGQSPLT 703

Query: 255 NTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQS 314
                + + E    +  LH+    HRD+K +N L+D+ G +K+TDFG             
Sbjct: 704 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRGRVKITDFG------------- 750

Query: 315 MKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD 374
                          F  K  + R K  T            MVG+P +MA EV++ ++YD
Sbjct: 751 ---------------FCAKLTDKRSKRAT------------MVGTPYWMAPEVVKQREYD 783

Query: 375 FTVDYWSLGCMLFESLVGYTPF 396
             VD WSLG M  E L    P+
Sbjct: 784 EKVDVWSLGIMTIEMLESEPPY 805

>Scas_675.2
          Length = 527

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 85/195 (43%), Gaps = 49/195 (25%)

Query: 231 LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHE-LGYTHRDLKPENFLI 289
           +++ ME   GGD    +     + +  A+FY  ++  A++ LHE  G  HRD+KPEN L+
Sbjct: 91  MWMIMEMADGGDLFDKIEPDVGVDSEVAQFYFQQLVRAISYLHEECGVAHRDIKPENILL 150

Query: 290 DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTE 349
           D  G++KL DFGL+    S  R +   +R+                 D+R          
Sbjct: 151 DKNGNLKLADFGLS----SQYRRKDGTLRIS---------------TDQR---------- 181

Query: 350 VNYANSMVGSPDYMALEVLEGKK-YDFTVDYWSLGCMLFESLVGYTP----------FSG 398
                   GSP YMA E+L  +  Y  + D WS+G +LF  L G TP          F+ 
Sbjct: 182 --------GSPPYMAPEILHSRGYYAHSTDIWSIGILLFVLLTGETPWELPVIEELNFAS 233

Query: 399 SSTNETYENLRHWKK 413
              N    NL  W K
Sbjct: 234 FLQNNGNLNLGPWAK 248

>CAGL0C05005g complement(467626..470856) similar to sp|P27636
           Saccharomyces cerevisiae YAR019c CDC15, hypothetical
           start
          Length = 1076

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 81/194 (41%), Gaps = 43/194 (22%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           +++E D+L       +VK     Q   +LY+ +E+   G  + L+   R +    A+ Y+
Sbjct: 64  IMSEIDLLKNLNHINIVKYHGFIQKQHNLYIILEYCAKGSLKNLISRNRPMSEHEAKPYV 123

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
            +    +N LHE G  HRD+K  N L+DSE  +KL DFG+           S K+     
Sbjct: 124 RQTLNGLNYLHEQGVIHRDIKAANILLDSENVVKLADFGV-----------STKVN---- 168

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                                       N A ++ GS ++MA E++  +      D WSL
Sbjct: 169 ----------------------------NTAMTLAGSLNWMAPEIIGNRGASTLSDIWSL 200

Query: 383 GCMLFESLVGYTPF 396
           G  + E L G  PF
Sbjct: 201 GATVVELLTGNPPF 214

>Scas_580.6
          Length = 1015

 Score = 78.6 bits (192), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 81/177 (45%), Gaps = 51/177 (28%)

Query: 225 FQDTESLYLAMEFVPGGDFRTLL----INTRFLRNTHARFYISEMFCAVNALHELGYTHR 280
            +DT SL++ ME+  GG  R+LL    I+ +++        + E+  A+  +H+    HR
Sbjct: 104 LKDT-SLWIIMEYCAGGSLRSLLRPGKIDEKYIG-----VIMRELLVALKYIHKDNVIHR 157

Query: 281 DLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRK 340
           D+K  N LI +EG +KL DFG+AA      ++    +R                      
Sbjct: 158 DIKAANVLITNEGSVKLCDFGVAA------QLNQSTLR---------------------- 189

Query: 341 MYTHLRQTEVNYANSMVGSPDYMALEV-LEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
                RQT       M G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 190 -----RQT-------MAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 234

>AAL029W [158] [Homologous to ScYLR248W (RCK2) - SH; ScYGL158W
           (RCK1) - SH] complement(289989..291593) [1605 bp, 534
           aa]
          Length = 534

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 111/276 (40%), Gaps = 23/276 (8%)

Query: 202 HVLTERDILTTTRSDWLVKLLYAFQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARF 260
            VL E  I     S   +     FQ+TES Y +  E + GG+    ++   +     +R 
Sbjct: 163 QVLKEITIHKAVSSGENIVTFIDFQETESYYFIVQELLAGGEIFGEIVRLTYFSEDLSRH 222

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
            I ++  AV  +H LG  HRD+KPEN L          DF      I ++R Q  +    
Sbjct: 223 VIRQLALAVKHMHSLGIVHRDIKPENLLFSP------IDF------IPSKRQQLRQSDDP 270

Query: 321 EVKNLE--FPAFTEKSIEDRRKM--YTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT 376
           + K  E  F            K+  +   +Q       +  G+  Y A EV++ ++Y   
Sbjct: 271 KTKQDEGLFRPGIGGGGIGVIKLADFGLSKQIYATNTTTPCGTVGYTAPEVVKDERYSMK 330

Query: 377 VDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIIT 436
           VD W +GC+L+  L G+ PF     +   E +   + T  RP  D   P       + + 
Sbjct: 331 VDMWGIGCVLYTVLCGFPPFYDEKIDVLTELISKGQYTFLRPWWDEISPGAK----NAVR 386

Query: 437 RLI-ADPINRLRSFEHIKRMPYFAEVNFNTLRQSAP 471
           RL+  DP  R    E +   P+    + N LR   P
Sbjct: 387 RLLEVDPDKRYDIDEFLAD-PWLNSYDCNVLRPLVP 421

>AFR724C [3917] [Homologous to ScYDR523C (SPS1) - SH]
           (1769897..1771219) [1323 bp, 440 aa]
          Length = 440

 Score = 77.0 bits (188), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 104/251 (41%), Gaps = 57/251 (22%)

Query: 210 LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNT--HARFYISEMFC 267
           L+  RS ++     AF    S+++ ME+  GG    LL  T   + T     F +SE+  
Sbjct: 70  LSELRSPYITNYKTAFLVDVSMWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLI 129

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            ++ LH     HRD+K  N L+   GH+KL DFG++   + T +                
Sbjct: 130 GLDYLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSGQMMVTRK---------------- 173

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK--YDFTVDYWSLGCM 385
                                     ++ VG+P +MA EV++  K  Y+   D WSLG  
Sbjct: 174 -------------------------RDTFVGTPFWMAPEVIDRNKQGYNEMADIWSLGIT 208

Query: 386 LFESLVGYTPFSGSSTNETYENLRHWKKTLRR--PVLDNGRPAFSDRTWDIITR-LIADP 442
           + E L+G+ P       + Y+ ++      +R  P LD     FS    D + + LI DP
Sbjct: 209 VIELLMGHPPL------DKYDAMKALMAIPKRDPPKLDK---RFSSHARDFVAQCLIKDP 259

Query: 443 INRLRSFEHIK 453
             R  + E +K
Sbjct: 260 SQRPTAAELLK 270

>YHL007C (STE20) [2279] chr8 complement(95113..97932)
           Serine/threonine protein kinase of the pheromone
           response pathway, also participates in the filamentous
           growth and STE vegetative growth pathways [2820 bp, 939
           aa]
          Length = 939

 Score = 77.8 bits (190), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 41/194 (21%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           ++ E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 662 IINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSL-TDVVTHCILTEGQIGAVC 720

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
            E    +  LH  G  HRD+K +N L+  EG IKLTDFG  A             ++ E+
Sbjct: 721 RETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCA-------------QINEL 767

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                                +L++T      +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 768 ---------------------NLKRT------TMVGTPYWMAPEVVSRKEYGPKVDIWSL 800

Query: 383 GCMLFESLVGYTPF 396
           G M+ E + G  P+
Sbjct: 801 GIMIIEMIEGEPPY 814

>AEL205W [2301] [Homologous to ScYNL298W (CLA4) - SH; ScYOL113W
           (SKM1) - SH] complement(246871..249252) [2382 bp, 793
           aa]
          Length = 793

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 88/202 (43%), Gaps = 48/202 (23%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTES-LYLAMEFVPGGDFRTLLINT-------RFLR 254
           ++ E  ++  ++   +V  L A+  TE  L++ ME++ GG    ++ N+         + 
Sbjct: 558 IVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDVIENSIGSDASESPMT 617

Query: 255 NTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQS 314
                + + E    +  LH+    HRD+K +N L+D+ G +K+TDFG             
Sbjct: 618 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTHGRVKITDFG------------- 664

Query: 315 MKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD 374
                          F  K  + R K  T            MVG+P +MA EV++ ++YD
Sbjct: 665 ---------------FCAKLTDKRSKRAT------------MVGTPYWMAPEVVKQREYD 697

Query: 375 FTVDYWSLGCMLFESLVGYTPF 396
             VD WSLG M  E L G  P+
Sbjct: 698 EKVDVWSLGIMTIEMLEGEPPY 719

>Scas_668.22
          Length = 893

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 85/194 (43%), Gaps = 41/194 (21%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           ++ E  ++  +R   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 653 IINEILVMKGSRHPNIVNFIDSYLLDGDLWVIMEYMEGGSL-TDVVTHCILTEGQIGAVC 711

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  A             ++ E+
Sbjct: 712 RETLSGLQFLHSKGVLHRDIKSDNILLSISGDIKLTDFGFCA-------------QINEI 758

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                                +L++T      +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 759 ---------------------NLKRT------TMVGTPYWMAPEVVSRKEYGPKVDIWSL 791

Query: 383 GCMLFESLVGYTPF 396
           G M+ E + G  P+
Sbjct: 792 GIMIIEMIEGEPPY 805

>AEL185C [2321] [Homologous to ScYBR274W (CHK1) - SH]
           (291129..292676) [1548 bp, 515 aa]
          Length = 515

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 98/234 (41%), Gaps = 53/234 (22%)

Query: 207 RDILTTTRSDW---LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
           R+++  TR      +V++L      E L++AME   GGD    +     + +  ARFY  
Sbjct: 64  REVVLQTRCAGHRHVVRVLDCNVSREYLWIAMELADGGDLFDKIEPDVGVDSEVARFYYQ 123

Query: 264 EMFCAVNALHE-LGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
           ++  A+  LHE  G  HRD+KPEN L+D  G++K+ DFGLA      +  + +       
Sbjct: 124 QLVRALTHLHEACGVAHRDIKPENMLLDRAGNLKVADFGLATRFRRRDGTRRLA------ 177

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDF-TVDYWS 381
                         DRR                  G+  Y+A EV+  + Y   T D WS
Sbjct: 178 -------------RDRR------------------GTLPYLAPEVVGERAYHADTADIWS 206

Query: 382 LGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDII 435
            G ++F  L G TP+S  S ++            R  V D G    SD  W  I
Sbjct: 207 AGVLVFVLLTGETPWSEPSVDD---------GMFRAFVADGGN--LSDGPWGKI 249

>YDR477W (SNF1) [1293] chr4 (1412361..1414262) Serine/threonine
           protein kinase essential for derepression of
           glucose-repressed genes, acts in concert with Snf4p,
           involved in aging [1902 bp, 633 aa]
          Length = 633

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 101/248 (40%), Gaps = 52/248 (20%)

Query: 206 ERDI--LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 101 EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ 159

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 160 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 199

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT-VDYWSL 382
           N+                      T+ N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 200 NI---------------------MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 238

Query: 383 GCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADP 442
           G +L+  L    PF   S    ++N+ +   TL +  L  G      R       LI +P
Sbjct: 239 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPK-FLSPGAAGLIKRM------LIVNP 291

Query: 443 INRLRSFE 450
           +NR+   E
Sbjct: 292 LNRISIHE 299

>ABR014W [605] [Homologous to ScYHL007C (STE20) - SH]
           complement(417710..420625) [2916 bp, 971 aa]
          Length = 971

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 89/194 (45%), Gaps = 41/194 (21%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           ++ E  ++  +R + +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 725 IINEILVMKGSRHNNIVNFIDSYLLKGDLWVIMEYMEGGSL-TDVVTHCILTEGQIAAVS 783

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
            E    ++ LH  G  HRD+K +N L+  +G+IKLTDFG  A             ++ E 
Sbjct: 784 RETLRGLHFLHSKGVIHRDIKSDNILLSMDGNIKLTDFGFCA-------------QINE- 829

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                               T+L++T      +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 830 --------------------TNLKRT------TMVGTPYWMAPEVVSRKEYGPKVDIWSL 863

Query: 383 GCMLFESLVGYTPF 396
           G M+ E + G  P+
Sbjct: 864 GIMIIEMIEGEPPY 877

>Kwal_23.6325
          Length = 1542

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 76/166 (45%), Gaps = 30/166 (18%)

Query: 233  LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSE 292
            L ME+  GG    LL + R       + Y  +M   +  LH+    HRD+KPEN L+D  
Sbjct: 1325 LFMEYCEGGSLAQLLEHGRIEDEMVTQIYALQMLEGLAYLHQSSVVHRDIKPENILLDFN 1384

Query: 293  GHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNY 352
            G IK  DFG AA +++    ++  +  E                            + + 
Sbjct: 1385 GVIKYVDFG-AARSLAANGTKAPNVGAE---------------------------GKADG 1416

Query: 353  ANSMVGSPDYMALEVLEG-KKYDF-TVDYWSLGCMLFESLVGYTPF 396
             NSM+G+P YM+ E + G KK  F + D WSLGC++ E + G  P+
Sbjct: 1417 VNSMMGTPMYMSPESITGAKKGKFGSGDIWSLGCVILEMVTGRRPW 1462

>Scas_660.28
          Length = 623

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 106/256 (41%), Gaps = 53/256 (20%)

Query: 206 ERDI--LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
           ER+I  L   R   ++KL    +  + + + ME+  G +    ++    +    AR +  
Sbjct: 92  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQ 150

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 151 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 190

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT-VDYWSL 382
           N+                      T+ N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 191 NI---------------------MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC 229

Query: 383 GCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADP 442
           G +L+  L    PF   S    ++N+ +   T+ +  L  G          I   LI +P
Sbjct: 230 GVILYVMLCRRLPFDDESIPVLFKNINNGVYTIPK-FLSQGASTL------IKKMLIVNP 282

Query: 443 INRLRSFEHIKRMPYF 458
           +NR+ S + I +  +F
Sbjct: 283 LNRI-SIQEIMQDEWF 297

>Scas_598.6
          Length = 790

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 86/202 (42%), Gaps = 48/202 (23%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTES-LYLAMEFVPGGDFRTLLINTRF-------LR 254
           ++ E  ++  +R   +V  L A+  TE  L++ MEF+ GG    ++ N+         L 
Sbjct: 555 IVNEILVMKDSRHKNIVNFLEAYLKTEDDLWVVMEFMEGGSLTDIIENSPATGSSSSPLT 614

Query: 255 NTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQS 314
                + + E    +  LH+    HRD+K +N L+D+   +K+TDFG             
Sbjct: 615 EPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDNNARVKITDFG------------- 661

Query: 315 MKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD 374
                          F  K  + R K  T            MVG+P +MA EV++ ++YD
Sbjct: 662 ---------------FCAKLTDQRSKRAT------------MVGTPYWMAPEVVKQREYD 694

Query: 375 FTVDYWSLGCMLFESLVGYTPF 396
             VD WSLG M  E L    P+
Sbjct: 695 EKVDVWSLGIMTIEMLESEPPY 716

>CAGL0K02673g complement(240509..243256) similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20
           Serine/threonine-protein kinase, hypothetical start
          Length = 915

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 41/194 (21%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           +L E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 662 ILNEILVMRESKHSNIVNFIDSYLAKGDLWIVMEYMEGGSL-TDVVTHCLLSEGQIGAVC 720

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
            E    +  LH  G  HRD+K +N L+  +G+IKLTDFG  A             ++ E 
Sbjct: 721 RETLKGLQFLHSKGVLHRDIKSDNILLSLKGNIKLTDFGFCA-------------QINE- 766

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                                +L++T      +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 767 --------------------NNLKRT------TMVGTPYWMAPEVVSRKEYGPKVDIWSL 800

Query: 383 GCMLFESLVGYTPF 396
           G M+ E + G  P+
Sbjct: 801 GIMIIEMIEGEPPY 814

>Kwal_47.18233
          Length = 598

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 130/326 (39%), Gaps = 77/326 (23%)

Query: 206 ERDI--LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 77  EREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQ 135

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 136 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 175

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT-VDYWSL 382
           N+                      T+ N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 176 NI---------------------MTDGNFLRTSCGSPNYAAPEVISGKLYAGPEVDVWSS 214

Query: 383 GCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAF-SDRTWDIITR-LIA 440
           G +L+  L    PF   S    ++N+ +   TL         P F S    ++I R LI 
Sbjct: 215 GVILYVMLCRRLPFDDESIPVLFKNISNGIYTL---------PKFLSPGAANLIKRMLIV 265

Query: 441 DPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSETDAGYFDDFTNEADMAKYAD 500
           +P+NR+ +   I +  +F     +      PP               D  NEA+   +  
Sbjct: 266 NPLNRI-TIHEIMQDEWF---KVDMQDYLIPP---------------DLKNEAENHGHDG 306

Query: 501 VFKRQNKLSSMVDDSAVD--SKLVGF 524
             + QN     VDDS V   SK +G+
Sbjct: 307 EQQGQNDAEEEVDDSLVTMLSKTMGY 332

>Scas_720.94
          Length = 1683

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 101/235 (42%), Gaps = 32/235 (13%)

Query: 235  MEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGH 294
            ME+  GG   +LL + R       + Y  E+   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1439 MEYCEGGSMASLLEHGRIEDEMVTQVYTLELLEGLAYLHQAGVVHRDIKPENILLDFNGI 1498

Query: 295  IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYAN 354
            IK  DFG AA  I+    +   I  +                   +      +   N  +
Sbjct: 1499 IKYVDFG-AARKIAKNGTKVTNINSKSKD--------------DDEPDEKDTEGGANSVH 1543

Query: 355  SMVGSPDYMALEVLEG--KKYDF-TVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHW 411
             M+G+P YMA E + G   K  F + D WS GC++ E + G  P+  ++ +  +  + H 
Sbjct: 1544 DMLGTPMYMAPESITGYKNKTKFGSDDIWSFGCVVLEMITGRRPW--ANLDNEWAIIYHV 1601

Query: 412  K--KTLRRPVLDNGRPA---FSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEV 461
               +T + P  +   PA   F  R       L+ DPI R  + E +   P+  E+
Sbjct: 1602 AAGQTPQLPYPNEVSPAGRRFLQRC------LVQDPIKRATAVELLMD-PWIVEI 1649

>Kwal_26.7788
          Length = 1267

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 98/246 (39%), Gaps = 53/246 (21%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++ L   +++   L+L +E+V GG+    L++   L    A  Y  ++       H    
Sbjct: 119 VMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQIIEGTAYCHGFNI 178

Query: 278 THRDLKPENFLIDSEG-HIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
            HRDLKPEN L+D +   IK+ DFG+AA                                
Sbjct: 179 CHRDLKPENLLLDKKNKRIKIADFGMAA-------------------------------- 206

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGYTP 395
                     QT      +  GSP Y + E++ GK Y+    D WS G +LF  L G+ P
Sbjct: 207 ---------LQTSNKLLETSCGSPHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLP 257

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRLRSFEHIKR 454
           F+  +       ++  K  + + V        S    D+I+R L+ DP  R+ S   I  
Sbjct: 258 FNDDNIKRLLLKVQAGKYQMPQSV--------SSGAQDLISRILVVDPDKRI-SINEILA 308

Query: 455 MPYFAE 460
            P  A+
Sbjct: 309 HPLLAK 314

>ACL104C [945] [Homologous to ScYHR102W (KIC1) - SH]
           (157357..160200) [2844 bp, 947 aa]
          Length = 947

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 75/171 (43%), Gaps = 50/171 (29%)

Query: 231 LYLAMEFVPGGDFRTLL----INTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPEN 286
           L++ ME+  GG  RTLL    I+ ++L        + ++  A+  +H+    HRD+K  N
Sbjct: 97  LWVIMEYCAGGSLRTLLRPGKIDEKYLG-----VIVRKLLIALVYIHKDNVIHRDIKAAN 151

Query: 287 FLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLR 346
            LI +EGH+KL DFG+AA                                 +     H R
Sbjct: 152 VLITNEGHVKLCDFGVAA---------------------------------QLTAANHKR 178

Query: 347 QTEVNYANSMVGSPDYMALEV-LEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
           QT       M G+P +MA EV +EG  Y+   D WSLG   +E   G  P+
Sbjct: 179 QT-------MAGTPYWMAPEVIMEGVYYNTKADIWSLGITAYEIATGNPPY 222

>Kwal_26.8751
          Length = 848

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/251 (25%), Positives = 106/251 (42%), Gaps = 52/251 (20%)

Query: 222 LYAFQDTES-LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHR 280
           LY    TE+ +++A+E+ PG +    L+  + +         S++  AV   H +   HR
Sbjct: 93  LYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELFSQIVGAVYYAHSMKCVHR 152

Query: 281 DLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRK 340
           DLK EN L+D +GH KLTDFG         R  + K  LE                    
Sbjct: 153 DLKLENILLDKKGHAKLTDFGFT-------RECATKGILE-------------------- 185

Query: 341 MYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGYTPFSGS 399
                         ++ G+  YMA E++E K Y+ + +D WSLG +L+  + G  PF   
Sbjct: 186 --------------TICGTTVYMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEV 231

Query: 400 STNETYENLRHWKKTLRRPVLD-NGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYF 458
              +T   + H+  T     +D NG+        ++I++L+    N+  S   + + P+ 
Sbjct: 232 DEVKTKYKIVHYNPTYDNDYIDSNGK--------ELISQLLEKDPNQRPSLTQVLQHPFL 283

Query: 459 AEVNFNTLRQS 469
                  L ++
Sbjct: 284 QPYGLKILERT 294

>KLLA0E21780g complement(1936438..1939488) similar to sp|P38692
           Saccharomyces cerevisiae YHR102w NRK1 ser/thr protein
           kinase that interacts with CDC31P, start by similarity
          Length = 1016

 Score = 76.6 bits (187), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 72/167 (43%), Gaps = 42/167 (25%)

Query: 231 LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLID 290
           L++ ME+  GG  RTLL     +   +    + E+  A+ ++H     HRD+K  N LI 
Sbjct: 88  LWVIMEYCAGGSLRTLL-RPGIIEEKYIGVIMREILVALISIHRDNVIHRDIKAANILIA 146

Query: 291 SEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEV 350
           + G +KL DFG+AA     +  QSM  R                                
Sbjct: 147 NNGSVKLCDFGVAA-----QLSQSMLKR-------------------------------- 169

Query: 351 NYANSMVGSPDYMALEV-LEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
               +M G+P +MA EV +EG  YD  VD WSLG   +E   G  P+
Sbjct: 170 ---QTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPY 213

>Scas_618.15
          Length = 620

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 82/199 (41%), Gaps = 11/199 (5%)

Query: 225 FQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLK 283
           F +T+S Y +  E++ GG+    ++   +      R  I ++  AV  LH +G  HRD+K
Sbjct: 245 FVETKSYYYIVQEYLHGGEIYDQIVRLTYFSEDLTRHVIRQLAHAVKHLHSMGIIHRDIK 304

Query: 284 PENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYT 343
           PEN L +   HI  T   L        ++     R         PA     I   +    
Sbjct: 305 PENLLFEPIQHIPSTHVKLRKTDNPFTKVDEGMFR---------PAIGGGGIGAVKLTDF 355

Query: 344 HL-RQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTN 402
            L +Q      N+  G+  Y A E++   +YD  +D W +GC+L+  L G+ PF      
Sbjct: 356 GLSKQLSTETTNTPCGTISYAAPELIRNHQYDNKIDLWGIGCVLYTLLCGFPPFYADQHK 415

Query: 403 ETYENLRHWKKTLRRPVLD 421
                +RH +     P  D
Sbjct: 416 SVTRKIRHGEYHFLSPWWD 434

>KLLA0F12188g 1122745..1124385 similar to sp|P38623 Saccharomyces
           cerevisiae YLR248w RCK2 Ca/calmodulin-dependent ser/thr
           protein kinase, start by similarity
          Length = 546

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 107/266 (40%), Gaps = 29/266 (10%)

Query: 202 HVLTERDILTTTRSDWLVKLLYAFQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARF 260
            VL E  I     S   +     FQ++E  Y +  E + GG+    ++   +     +R 
Sbjct: 188 QVLKEIAIHKIVSSGENIVSFIDFQESEKYYYIIQELLAGGEIFGEIVKYTYFSEDLSRH 247

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
            I ++  AV  +H+LG  HRD+KPEN L +    I      L +    + ++     R  
Sbjct: 248 VIRQLANAVKYMHQLGIVHRDIKPENLLFEPIDFIPNPKPKLRSSDDPSTKLDEGVFRPG 307

Query: 321 E-------VKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY 373
                   VK  +F             +   + QT        VG   Y A EV++ ++Y
Sbjct: 308 IGGGGIGVVKLADF------------GLSKQIYQTNTKTPCGTVG---YTAPEVVKDERY 352

Query: 374 DFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWD 433
              VD W +GC+L+  L G+ PF     +   E +   + T  RP  D      SD   +
Sbjct: 353 SMQVDMWGVGCVLYTVLCGFPPFFDEKIDVLTEKISRGEYTFLRPWWDQ----ISDGAKN 408

Query: 434 IITRLI-ADPINRLRSFEHIKRMPYF 458
            + +L+  DP  R  S E + + P+ 
Sbjct: 409 CVRKLLEVDPAKRYTS-EQLLQDPWL 433

>KLLA0C08525g 744554..749209 similar to sp|P53599 Saccharomyces
            cerevisiae YNR031c SSK2 MAP kinase kinase kinase of the
            high osmolarity signal transduction pathway, start by
            similarity
          Length = 1551

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/165 (29%), Positives = 74/165 (44%), Gaps = 30/165 (18%)

Query: 235  MEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGH 294
            MEF  G    +LL + R       + Y  ++   +  LH+ G  HRD+KPEN L+D  G 
Sbjct: 1337 MEFCEGSSLASLLEHGRIEDEMVTQVYTLQLLEGLACLHQSGVVHRDIKPENILLDRNGV 1396

Query: 295  IKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYAN 354
            IK  DFG AA  I+  +  S +I L+                            +     
Sbjct: 1397 IKYVDFG-AAKLIA--KNGSKRISLDA-------------------------NNKSTGGK 1428

Query: 355  SMVGSPDYMALEVLEGKKYD--FTVDYWSLGCMLFESLVGYTPFS 397
             M+G+P YMA E + G+ +    + D WSLGC++ E + G  P++
Sbjct: 1429 DMIGTPMYMAPETVTGQGHGKFGSDDIWSLGCVVLEMVTGRRPWA 1473

>CAGL0M02299g 273725..276406 similar to tr|Q12152 Saccharomyces
           cerevisiae YPL150w, start by similarity
          Length = 893

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 78/181 (43%), Gaps = 42/181 (23%)

Query: 217 WLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           ++ KL         +++A+E+ PG +    L++   L         +++  AV+  H L 
Sbjct: 94  YITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHTLN 153

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIE 336
             HRDLK EN L+D  G+ KLTDFG                            FT     
Sbjct: 154 CVHRDLKLENVLLDKNGNAKLTDFG----------------------------FT----- 180

Query: 337 DRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGYTP 395
            R  M   + +T       + G+  YMA E+++ K YD F VD WSLG +L+  L G  P
Sbjct: 181 -RESMTKAVLET-------VCGTTVYMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLP 232

Query: 396 F 396
           F
Sbjct: 233 F 233

>YOR233W (KIN4) [5024] chr15 (775846..778248) Serine/threonine
           protein kinase related to Kin1p and Kin2p, catalytic
           domain is highly related to Snf1p [2403 bp, 800 aa]
          Length = 800

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 82/193 (42%), Gaps = 42/193 (21%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           ++ L    Q+++ + + +EFV GG+F   +   R L+ + A    +++   VN +H  G 
Sbjct: 112 IIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRLFAQLISGVNYMHYKGL 171

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLK EN L+D   ++ +TDFG                            F  +  ED
Sbjct: 172 VHRDLKLENLLLDKHENLVITDFG----------------------------FVNEFFED 203

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKYDF-TVDYWSLGCMLFESLVGYTP 395
              M T              GSP Y A E V+  K Y+    D WS G +L+  L GY P
Sbjct: 204 NELMKT------------SCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLP 251

Query: 396 FSGSSTNETYENL 408
           +     N T +++
Sbjct: 252 WDDDHENPTGDDI 264

>CAGL0M10153g complement(1010688..1013291) some similarities with
           sp|Q03497 Saccharomyces cerevisiae YHL007c ser/thr
           protein kinase of the pheromone pathway, hypothetical
           start
          Length = 867

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 92/223 (41%), Gaps = 43/223 (19%)

Query: 174 LARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYL 233
           L+  R  K  C              E   ++ E  ++++++   +V  + ++     L++
Sbjct: 582 LSHSRSDKSQCVAIKQMNLEKQPKKEL--IVNEIMVMSSSKHQNIVNYIDSYLSGLDLWV 639

Query: 234 AMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEG 293
            ME++ GG   T ++    L          E+   +  LH  G  HRD+K +N L+   G
Sbjct: 640 VMEYMEGGCL-TDVVTYCVLTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDNVLLSMNG 698

Query: 294 HIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYA 353
            IKLTDFG  A                              + D     T +++T     
Sbjct: 699 DIKLTDFGFCA-----------------------------QVND-----TVIKRT----- 719

Query: 354 NSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
            +MVG+P +MA E++  K+Y   VD WSLG M+ E + G  P+
Sbjct: 720 -TMVGTPYWMAPEIVSRKEYGPKVDIWSLGIMIIEMIEGEPPY 761

>Kwal_26.7861
          Length = 955

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 85/194 (43%), Gaps = 41/194 (21%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           ++ E  ++  ++   +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 709 IINEILVMKASKHANIVNFIDSYLLRGDLWVVMEYMEGGSL-TDVVTHCILTEGQIGAVS 767

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  A             ++ E+
Sbjct: 768 RETLKGLQFLHSKGVIHRDIKSDNVLLSMSGEIKLTDFGFCA-------------QINEI 814

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                                +L++T      +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 815 ---------------------NLKRT------TMVGTPYWMAPEVVSRKEYGPKVDIWSL 847

Query: 383 GCMLFESLVGYTPF 396
           G M+ E + G  P+
Sbjct: 848 GIMIIEMIEGEPPY 861

>KLLA0A03806g complement(338807..340615) gi|2181934|emb|CAA61235.1
           Kluyveromyces lactis putative kinase, start by
           similarity
          Length = 602

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 102/248 (41%), Gaps = 52/248 (20%)

Query: 206 ERDI--LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 81  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQ 139

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           ++  AV+  H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 140 QIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 179

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT-VDYWSL 382
           N+                      T+ N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 180 NI---------------------MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS 218

Query: 383 GCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADP 442
           G +L+  L    PF   S    ++N+ +   T+    L  G  +       I   LI +P
Sbjct: 219 GVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPN-FLSQGAASL------IKKMLIVNP 271

Query: 443 INRLRSFE 450
           +NR+   E
Sbjct: 272 VNRITVHE 279

>CAGL0J03828g 362722..364125 similar to sp|P32490 Saccharomyces
           cerevisiae YOR231w MKK1 ser/thr protein kinase or
           sp|P32491 Saccharomyces cerevisiae YPL140c MKK2, start
           by similarity
          Length = 467

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 83/190 (43%), Gaps = 48/190 (25%)

Query: 214 RSDWLVKLLYAFQDTE--SLYLAMEFVPGGDFRTL---LINTRFLRNTHARFYISEMFC- 267
           +S+++V+    F D +  S+Y+AME++ G     +   L++     +      ISE    
Sbjct: 235 KSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRISEKVLGKISEAVLR 294

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            ++ LHE    HRD+KP+N L++ +G +KL DFG     +S E + S+            
Sbjct: 295 GLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFG-----VSGEAVNSL------------ 337

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLF 387
                                    A +  G+  YMA E ++G+ Y  T D WSLG  + 
Sbjct: 338 -------------------------ATTFTGTSYYMAPERIQGQPYSVTCDVWSLGLTIL 372

Query: 388 ESLVGYTPFS 397
           E   G+ PF 
Sbjct: 373 EVAQGHFPFG 382

>YDL101C (DUN1) [768] chr4 complement(280307..281848) Protein kinase
           required for induction of Rnr3p and DNA repair genes
           after DNA damage [1542 bp, 513 aa]
          Length = 513

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 84/216 (38%), Gaps = 65/216 (30%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESL-----YLAMEFVPGGDFRTLLINTRFLRNTHARF 260
           E +IL   +   +V LL +F +  S      YL +E +  G+    ++    LR   ++ 
Sbjct: 248 ETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKA 307

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLI-------------------DSEGHIKLTDFG 301
              ++   +  LHE    HRD+KPEN L+                   + +  +K+ DFG
Sbjct: 308 LFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFG 367

Query: 302 LAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPD 361
           LA  T                                          E+ + N++ G+P 
Sbjct: 368 LAKFT-----------------------------------------GEMQFTNTLCGTPS 386

Query: 362 YMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFS 397
           Y+A EVL  K Y   VD WS G +L+  L G+ PFS
Sbjct: 387 YVAPEVLTKKGYTSKVDLWSAGVILYVCLCGFPPFS 422

>KLLA0B13607g 1191592..1194561 weakly similar to sp|Q03497
           Saccharomyces cerevisiae YHL007c STE20 ser/thr protein
           kinase of the pheromone pathway, hypothetical start
          Length = 989

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 86/194 (44%), Gaps = 41/194 (21%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           ++ E  ++  ++ + +V  + ++     L++ ME++ GG   T ++    L         
Sbjct: 740 IVNEILVMKGSKHNNIVNFIDSYLFRGDLWVVMEYMEGGSL-TDVVTHCILTEGQIGAVS 798

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
            E    +  LH  G  HRD+K +N L+   G IKLTDFG  A             ++ EV
Sbjct: 799 RETLKGLQFLHSKGVIHRDIKSDNILLSMNGDIKLTDFGFCA-------------QINEV 845

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                                +L++T      +MVG+P +MA EV+  K+Y   VD WSL
Sbjct: 846 ---------------------NLKRT------TMVGTPYWMAPEVVSRKEYGPKVDIWSL 878

Query: 383 GCMLFESLVGYTPF 396
           G M+ E + G  P+
Sbjct: 879 GIMIIEMIEGEPPY 892

>ACL191C [858] [Homologous to ScYGR040W (KSS1) - SH] (26475..27572)
           [1098 bp, 365 aa]
          Length = 365

 Score = 73.6 bits (179), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 77/176 (43%), Gaps = 34/176 (19%)

Query: 224 AFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLK 283
           ++QD E++YL  E +     R +     FL + H +++  ++  A+ +LH     HRDLK
Sbjct: 83  SYQDFEAVYLVQELMETDLQRIISQPNSFLSDDHIQYFTYQILRALKSLHSAQVIHRDLK 142

Query: 284 PENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYT 343
           P N L++S   +KL DFGL+    S++R                                
Sbjct: 143 PSNLLLNSSCDLKLCDFGLSRCLASSDRS------------------------------- 171

Query: 344 HLRQTEVNYANSMVGSPDYMALEV-LEGKKYDFTVDYWSLGCMLFESLVGYTPFSG 398
             R+  V +    V +  Y A E+ L  ++Y   +D WS GC+L E + G   F G
Sbjct: 172 --RENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMISGKPLFPG 225

>KLLA0F01276g complement(120001..121560) similar to sp|P38147
           Saccharomyces cerevisiae YBR274w CHK1 regulats
           inhibitory Cdk phosphorylation of PDS1, start by
           similarity
          Length = 519

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 86/181 (47%), Gaps = 42/181 (23%)

Query: 231 LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHE-LGYTHRDLKPENFLI 289
           L++AME   GGD    +     + +  A+FY  ++  A++ LH+  G  HRD+KPEN L+
Sbjct: 91  LWIAMELAEGGDLFDKIEPDIGVDSEVAQFYYKQLIKAISYLHDTCGVAHRDIKPENILL 150

Query: 290 DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTE 349
           D +G++KL DFGLA          S+  R +  K +           D+R          
Sbjct: 151 DKDGNLKLADFGLA----------SLFKRKDGSKRIS---------RDQR---------- 181

Query: 350 VNYANSMVGSPDYMALEVL--EGKKYDFTVDYWSLGCMLFESLVGYTPFS-GSSTNETYE 406
                   GS  YMA E++  +G   D T D WS+G +LF  L G TP+      +ET+ 
Sbjct: 182 --------GSLPYMAPEIIYCDGYYADMT-DIWSIGVLLFVLLTGETPWELPHEDDETFR 232

Query: 407 N 407
           N
Sbjct: 233 N 233

>Scas_673.20*
          Length = 758

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 82/197 (41%), Gaps = 47/197 (23%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARF-- 260
           + TE  +L   +   ++  + ++   ++L++ ME++ GG    ++    F   T  +   
Sbjct: 523 IWTEMLVLKEYQHPNIINFINSYLLHDTLWIVMEYMDGGSLADIV---SFFTPTEEQMAT 579

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
              E    +N LH  G  HRD+K +N L+   G IK+TDFG                   
Sbjct: 580 ICRETLFGLNFLHSRGIVHRDIKSDNILLSMNGDIKITDFGFCG---------------- 623

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYA-NSMVGSPDYMALEVLEGKKYDFTVDY 379
                                    + TE N    +MVG+P +MA EV+  K+Y   VD 
Sbjct: 624 -------------------------QLTESNTKRTTMVGTPYWMAPEVIASKEYGPKVDV 658

Query: 380 WSLGCMLFESLVGYTPF 396
           WSLG M+ E + G  P+
Sbjct: 659 WSLGIMIIEMIEGEPPY 675

>AEL230W [2276] [Homologous to ScYDR477W (SNF1) - SH]
           complement(198401..200227) [1827 bp, 608 aa]
          Length = 608

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 104/250 (41%), Gaps = 56/250 (22%)

Query: 206 ERDI--LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
           ER+I  L   R   ++KL    +  + + + +E+  G +    ++    +    AR +  
Sbjct: 85  EREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQ 143

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           ++  AV   H     HRDLKPEN L+D   ++K+ DFGL+                    
Sbjct: 144 QIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLS-------------------- 183

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT-VDYWSL 382
           N+                      T+ N+  +  GSP+Y A EV+ GK Y    VD WS 
Sbjct: 184 NI---------------------MTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS 222

Query: 383 GCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAF-SDRTWDIITR-LIA 440
           G +L+  L    PF   S    ++N+ +   ++         P F S    ++I R LI 
Sbjct: 223 GVILYVMLCRRLPFDDESIPVLFKNISNGVYSI---------PKFLSQGAANLIKRMLIV 273

Query: 441 DPINRLRSFE 450
           +P+NR+   E
Sbjct: 274 NPLNRITIHE 283

>Scas_640.16
          Length = 505

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 84/197 (42%), Gaps = 48/197 (24%)

Query: 214 RSDWLVKLLYAFQD--TESLYLAMEFVPGGDFRTLLIN--TRFLRNTHARF-YISE-MFC 267
           +SD++V+    F D  + S+Y+AME++ G     +  N  +R  R +      ISE +  
Sbjct: 265 KSDYIVRYYGMFNDVNSSSIYIAMEYMGGKSLEAVYKNLLSRGGRISEKVLGKISESVLR 324

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            ++ LHE    HRD+KP+N L + +G +KL DFG     +S E + S+            
Sbjct: 325 GLSYLHEQKVIHRDIKPQNILFNEKGQVKLCDFG-----VSGEAVNSL------------ 367

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLF 387
                                    A +  G+  YMA E ++G+ Y  T D WSLG  + 
Sbjct: 368 -------------------------ATTFTGTSFYMAPERIQGQPYSVTCDIWSLGLTIL 402

Query: 388 ESLVGYTPFSGSSTNET 404
           E   G  PF       T
Sbjct: 403 EVAQGRFPFGSDKITAT 419

>ACR133C [1180] [Homologous to ScYPL150W - SH] (581468..584023)
           [2556 bp, 851 aa]
          Length = 851

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 97/221 (43%), Gaps = 52/221 (23%)

Query: 222 LYAFQDTES-LYLAMEFVPGGD-FRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTH 279
           LY    TE+ +++A+E+ PG + +  LL+  R   +   R + +++  AV   H L   H
Sbjct: 93  LYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLF-AQIVSAVFYAHSLQCVH 151

Query: 280 RDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRR 339
           RDLK EN L+D  G+  LTDFG         R  + K +LE V                 
Sbjct: 152 RDLKLENILLDKNGYAMLTDFGFT-------RECATKTQLETV----------------- 187

Query: 340 KMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGYTPFSG 398
                             G+  YMA E+++ + YD + VD WSLG +L+  L GY PF  
Sbjct: 188 -----------------CGTTVYMAPELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDE 230

Query: 399 SSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLI 439
             T  T   + H +      VLD      S +  D+I RL+
Sbjct: 231 DDTVRTGLKIMHEEPA----VLDE---YTSPQAKDLIVRLL 264

>AER223C [2725] [Homologous to ScYAR019C (CDC15) - SH]
           (1044971..1047679) [2709 bp, 902 aa]
          Length = 902

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 77/189 (40%), Gaps = 44/189 (23%)

Query: 208 DILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFC 267
           D+L   + + +VK     Q +  LY+ +E+   G  R L I    L    A+ Y+ +   
Sbjct: 66  DLLKNLKHENIVKYHGFIQSSHELYILLEYCIRGSLRDL-IKKEALSEAKAKTYVRQTLR 124

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            +  LH+ G  HRD+K  N L+   G +KL DFG++       R+ +M            
Sbjct: 125 GLQYLHDQGVIHRDIKAANLLLTENGVVKLADFGVST------RVNNM------------ 166

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLF 387
                                    A +  GSP++MA EV+ GK      D WSLG  + 
Sbjct: 167 -------------------------AMTYAGSPNWMAPEVMLGKGASTVSDIWSLGATVV 201

Query: 388 ESLVGYTPF 396
           E L G  PF
Sbjct: 202 ELLTGNPPF 210

>KLLA0E01584g 149713..150960 highly similar to sp|P39009
           Saccharomyces cerevisiae YDL101c DUN1 protein kinase,
           start by similarity
          Length = 415

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 114/306 (37%), Gaps = 38/306 (12%)

Query: 175 ARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTES---- 230
           AR ++T E  A              T     E  IL + +   +VKL+  F +  S    
Sbjct: 118 ARNKETGETVAVKIFHPQQNDDDKRTKKFTEETKILLSIQHPNIVKLIDRFVEPVSKTQI 177

Query: 231 -LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLI 289
             YL +E +  G+    ++    LR    +    ++   +  LH     HRD+KPEN L+
Sbjct: 178 QTYLVLEKINDGELFERIVRKNNLREDETKALFRQLLNGLKYLHSRNIIHRDIKPENILL 237

Query: 290 DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTE 349
                    +  L         IQ       ++ +     FT                 E
Sbjct: 238 SISKRRSPEEIALGPWDDDELDIQV------KIADFGLAKFT----------------GE 275

Query: 350 VNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGS-STNETYENL 408
           + + N++ G+P Y+A EVL    Y   VD WS G +L+  L G+ PFS   +     E +
Sbjct: 276 MKFTNTLCGTPSYVAPEVLVKTGYTSRVDMWSAGVLLYVCLCGFPPFSEQLAPPSMKEQI 335

Query: 409 RHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRLRSFEHIKRMPYF----AEVNF 463
              K     P  DN      D    +I+  L+ +P +R  S       P+F    AEV  
Sbjct: 336 LQGKFAFYSPYWDN----IDDSVLHLISNLLVVNPASRF-SVNDALTHPWFTSNNAEVTM 390

Query: 464 NTLRQS 469
              R+S
Sbjct: 391 GNERRS 396

>YGL179C (TOS3) [1812] chr7 complement(163413..165095)
           Serine/threonine protein kinase with similarity to Elm1p
           and Kin82p [1683 bp, 560 aa]
          Length = 560

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 93/221 (42%), Gaps = 40/221 (18%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTES--LYLAMEFV--------PGGDFRTLLI 248
           E   V  E +++     + +V+L     D ES  +YL +E+         P        +
Sbjct: 97  ENPRVNQEIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAV 156

Query: 249 NTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTIS 308
               L    +R  + ++   +  LH  G THRD+KP N LI S G +K++DFG+A  T +
Sbjct: 157 GPSILTFQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTAT 216

Query: 309 -TERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEV 367
            +  IQS   +L + + L  PAF              L  TE  Y+ S            
Sbjct: 217 GSTNIQSSHEQLLKSRALGTPAF----------FAPELCSTEKEYSCSS----------- 255

Query: 368 LEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENL 408
                    +D WSLG  ++  L G  PF+ +S  E ++++
Sbjct: 256 --------AIDIWSLGVTIYCLLFGKLPFNANSGLELFDSI 288

>KLLA0D07304g 623352..624749 some similarities with sp|P32491
           Saccharomyces cerevisiae YPL140c MKK2 protein kinase of
           the map kinase kinase (MEK) family, hypothetical start
          Length = 465

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 88/194 (45%), Gaps = 54/194 (27%)

Query: 212 TTRSDWLVKL--LYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARF------YIS 263
           + +SD++V+   ++A ++T ++++AME++ G   R+L    + L +   R        I+
Sbjct: 231 SCKSDFIVRYYGMFACEETSTIFIAMEYMGG---RSLDSVYKHLLSKGGRIGEKVLGKIA 287

Query: 264 E-MFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
           E +   +  LHE    HRD+KP+N L +  G IKL DFG     +S E + S+       
Sbjct: 288 ESVLRGLFYLHERKIIHRDIKPQNILFNEIGQIKLCDFG-----VSGEAVNSL------- 335

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                                         A +  G+  YMA E ++G+ Y  T D WSL
Sbjct: 336 ------------------------------ATTFTGTSYYMAPERIQGQPYSVTSDVWSL 365

Query: 383 GCMLFESLVGYTPF 396
           G  L E   G++PF
Sbjct: 366 GLTLLEVAQGHSPF 379

>Kwal_27.9763
          Length = 868

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 79/193 (40%), Gaps = 44/193 (22%)

Query: 204 LTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYIS 263
           + E D+L   + + +VK     Q +  L++ +E+   G  R L I    +     + YI 
Sbjct: 66  MLEIDLLKNLKHENIVKYHGFIQKSHQLFILLEYCSQGSLRDL-IKRGPVEEQQCKTYIR 124

Query: 264 EMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVK 323
           +    +  LH+ G  HRD+K  N L+D++  +KL DFG++       R+           
Sbjct: 125 QTLHGLKYLHDQGVIHRDIKAANLLLDAQNVVKLADFGVST------RVN---------- 168

Query: 324 NLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLG 383
                                      N A +  GSP++MA EV+ G+      D WSLG
Sbjct: 169 ---------------------------NLAMTYAGSPNWMAPEVMMGQGASTVSDIWSLG 201

Query: 384 CMLFESLVGYTPF 396
             + E L G  PF
Sbjct: 202 ATVVEILTGNPPF 214

>Kwal_0.155
          Length = 587

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 106/253 (41%), Gaps = 28/253 (11%)

Query: 202 HVLTERDILTTTRSDWLVKLLYAFQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARF 260
            VL E  I  T  +   V     FQ++ + Y +  E + GG+    ++   +     +R 
Sbjct: 218 QVLKEVAIHRTVSASENVVSFVDFQESHNYYFIVQELLAGGEIFGEIVRLTYFSEDLSRH 277

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFL---IDSEGH----IKLTDFGLAAGTISTERIQ 313
            I ++  AV  +H +G  HRD+KPEN L   +D E      ++ +D   A       R  
Sbjct: 278 VIRQLALAVKHMHAMGIVHRDIKPENLLFEHVDYEPSPSPVLRKSDDPKAKQDEGIFRPG 337

Query: 314 SMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY 373
                +  VK  +F           +++Y+   +T         G+  Y A EV++ ++Y
Sbjct: 338 IGGGGIGTVKLADFGL--------SKQIYSTNTKTPC-------GTVGYTAPEVVKDERY 382

Query: 374 DFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWD 433
              VD W +GC+L+  L G+ PF     +   E +   + T  RP  D      SD   +
Sbjct: 383 SMQVDMWGIGCVLYTVLCGFPPFYDEKIDVLTEKISRGEFTFLRPWWDE----ISDGAKN 438

Query: 434 IITRLI-ADPINR 445
            + RL+  DP  R
Sbjct: 439 AVRRLLEVDPSKR 451

>YDR523C (SPS1) [1335] chr4 complement(1485554..1487026)
           Serine/threonine protein kinase involved in middle/late
           stage of meiosis [1473 bp, 490 aa]
          Length = 490

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/256 (26%), Positives = 100/256 (39%), Gaps = 58/256 (22%)

Query: 210 LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRF--LRNTHARFYISEMFC 267
           L   +S  +   +    +  S+++ ME+  GG    LL  +    L      F I E+  
Sbjct: 68  LAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDLLKRSYVNGLPEEKVSFIIHEVTL 127

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            +  LHE    HRD+K  N L++ EG +KL DFG++                        
Sbjct: 128 GLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSG----------------------- 164

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVL--EGKKYDFTVDYWSLGCM 385
                           H+R T     ++ VG+P +MA EV+  E   Y+   D WSLG  
Sbjct: 165 ----------------HIRSTL--KRDTFVGTPYWMAPEVVCCEVDGYNEKADIWSLGIT 206

Query: 386 LFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR-LIADPIN 444
            +E L G  P S     +   NL       R+P    G   FSD   D +   L+  P +
Sbjct: 207 TYELLKGLPPLSKYDPMKVMTNLPK-----RKPPKLQG--PFSDAAKDFVAGCLVKTPAD 259

Query: 445 R-----LRSFEHIKRM 455
           R     L SFE +K +
Sbjct: 260 RPSAYNLLSFEFVKNI 275

>Kwal_14.2497
          Length = 418

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 78/176 (44%), Gaps = 39/176 (22%)

Query: 235 MEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALH-ELGYTHRDLKPENFLIDSEG 293
           ME   GGD    +     + +  ARFY  ++  A++ LH   G  HRD+KPEN L+D  G
Sbjct: 1   MELASGGDLFDKIEPDVGVDSEVARFYFKQLINAIDHLHNRCGVAHRDIKPENLLLDERG 60

Query: 294 HIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYA 353
           ++KL DFGLA+                         F  K  +  +++ +  R       
Sbjct: 61  NLKLADFGLAS------------------------QFKRK--DGSKRIMSDTR------- 87

Query: 354 NSMVGSPDYMALEVLEGKK-YDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENL 408
               GS  YMA E++  K  Y  + D WS G ++F  L G TP+   S +  +++ 
Sbjct: 88  ----GSLPYMAPEIVYSKSYYADSTDIWSCGVLVFVLLTGETPWDSPSDDSRFDDF 139

>Scas_685.24
          Length = 515

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/193 (26%), Positives = 77/193 (39%), Gaps = 49/193 (25%)

Query: 210 LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLL--INTRFLRNTHARFYISEMFC 267
           L   +S +++  +    +  S+++ ME+  GG    LL       L      +   E+  
Sbjct: 72  LAELKSPYIINYITTLLEDASMWIVMEYCGGGSCSDLLKYYFNNGLPEKKVAYITREILK 131

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            +  LHE    HRD+K  N L+  EGH+KL DFG++    ST R                
Sbjct: 132 GLQYLHEQKKIHRDIKAANILLTEEGHVKLGDFGVSGQLKSTLR---------------- 175

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEV----LEGKKYDFTVDYWSLG 383
                                      ++VG+P +MA EV    +EG  YD  +D WSLG
Sbjct: 176 -------------------------RGTIVGTPYWMAPEVASQNIEG--YDEKIDIWSLG 208

Query: 384 CMLFESLVGYTPF 396
             +FE L G  P 
Sbjct: 209 ITVFELLKGVPPL 221

>YLR248W (RCK2) [3644] chr12 (634254..636086)
           Calcium/calmodulin-dependent serine/threonine protein
           kinase (CaM kinase) [1833 bp, 610 aa]
          Length = 610

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/240 (23%), Positives = 97/240 (40%), Gaps = 39/240 (16%)

Query: 225 FQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLK 283
           FQ+T+S Y +  E + GG+    ++   +     +R  I ++  AV  +H LG  HRD+K
Sbjct: 256 FQETDSYYYIIQELLTGGEIFGEIVRLTYFSEDLSRHVIKQLALAVKHMHSLGVVHRDIK 315

Query: 284 PENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPA----FTEKSIEDRR 339
           PEN L +                   E  +S+K +L +  + +  A    FT        
Sbjct: 316 PENLLFE-----------------PIEFTRSIKPKLRKSDDPQTKADEGIFTPGVGGGGI 358

Query: 340 KM-----YTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYT 394
            +     +   +Q       +  G+  Y A EV++ + Y   VD W +GC+L+  L G+ 
Sbjct: 359 GIVKLADFGLSKQIFSKNTKTPCGTVGYTAPEVVKDEHYSMKVDMWGIGCVLYTMLCGFP 418

Query: 395 PFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKR 454
           PF     +   E +   + T  +P             WD I+    + + +L   E  KR
Sbjct: 419 PFYDEKIDTLTEKISRGEYTFLKP------------WWDEISAGAKNAVAKLLELEPSKR 466

>Scas_477.5
          Length = 703

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 84/199 (42%), Gaps = 38/199 (19%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEM 265
           E ++L     + +V    + Q+  +L + +E+VPGG   ++L N      +    +I ++
Sbjct: 491 EMNLLKELHHENIVTYYGSSQEGPNLNIFLEYVPGGSVSSMLNNYGPFEESLIVNFIRQV 550

Query: 266 FCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNL 325
              V  LH     HRD+K  N LID++G +K+TDFG++                      
Sbjct: 551 LIGVAYLHNKNIIHRDIKGANILIDTKGCVKITDFGISK--------------------- 589

Query: 326 EFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCM 385
                +  S +D+R               S+ GS  +MA EV++        D WS GC+
Sbjct: 590 ---KLSPLSKQDKRA--------------SLQGSVYWMAPEVVKQTATTEKADIWSTGCV 632

Query: 386 LFESLVGYTPFSGSSTNET 404
           + E   G  PF   S  +T
Sbjct: 633 VIEMFTGKHPFPDFSQMQT 651

>CAGL0K02167g complement(191468..194956) similar to sp|P38990
           Saccharomyces cerevisiae YER129w
           Serine/threonine-protein kinase, start by similarity
          Length = 1162

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 117/285 (41%), Gaps = 43/285 (15%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTES--LYLAMEFVPGGDFR--------TLLI 248
           E + +  E  I+       +VKL+    D +S  +YL +E+   G+ +        T   
Sbjct: 192 ENDKIKREIAIMKKCHHKHVVKLIEVLDDLKSRKIYLVLEYCSRGEVKWCPPDCLETEAK 251

Query: 249 NTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFG--LAAGT 306
               L     R  +  +   +  LH  G  HRD+KP N L+   G +K++DFG  LAA +
Sbjct: 252 GPSPLSFQFTREILRGVVLGLEYLHYQGIIHRDIKPANLLLSETGIVKISDFGVSLAASS 311

Query: 307 ISTERIQSMKIRLEEVKNLEFPAFTEKSI---EDRRKMYTHLRQTEVNYANSMVGSPDYM 363
            + +        LE  K    PAF    I   ED  + Y   R+                
Sbjct: 312 SNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDRE---------------- 355

Query: 364 ALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH-------WKKTLR 416
             E+ +G    F +D W+LG  L+  + G  PF  S   E +E + +       +   L+
Sbjct: 356 --ELFKGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLK 413

Query: 417 -RPVLDNGRPAFSDRTWDIITRLI-ADPINRLRSFEHIKRMPYFA 459
              VL     A  +   D++TRL+  +PI R+ + E IKR P+  
Sbjct: 414 NNQVLQMTEEAEYEAAKDLLTRLLEKNPIKRI-NIEEIKRHPFVC 457

>Kwal_14.1416
          Length = 365

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 97/241 (40%), Gaps = 54/241 (22%)

Query: 229 ESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFL 288
           +++YL  E +     + +      L + H +++  ++  A+ A+H     HRD+KP N L
Sbjct: 88  QAVYLVQELMETDLHKVISSGGASLSDDHIQYFTYQILRALKAIHSAQVIHRDIKPSNLL 147

Query: 289 IDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQT 348
           ++S   +K+ DFGLA   IS+                                 TH RQ 
Sbjct: 148 LNSNCDLKVCDFGLARCLISS---------------------------------THSRQN 174

Query: 349 EVNYANSMVGSPDYMALEV-LEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYEN 407
            V +    V +  Y A E+ L  ++Y   +D WS GC+L E + G   F G         
Sbjct: 175 LVGFMTEYVATRWYRAPEIMLTFQQYTVAMDIWSCGCILAEMITGKPLFPG--------- 225

Query: 408 LRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLR 467
            R +   L   +   G P++ D           + IN  R+ E+I  +P   ++ +  + 
Sbjct: 226 -RDYHHQLWLILEALGTPSYED----------FENINSKRAKEYIANLPLRQKLPWQVVL 274

Query: 468 Q 468
           Q
Sbjct: 275 Q 275

>Scas_700.35
          Length = 439

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 79/189 (41%), Gaps = 48/189 (25%)

Query: 214 RSDWLVKLLYAFQDT--ESLYLAMEFVPGGD----FRTLLINTRFLRNTHARFYISEMFC 267
           +S+++V     F DT   S+Y+AME++ G      +++LL     +           +  
Sbjct: 205 KSNYIVTYYGMFNDTLNGSIYIAMEYMGGQSLDTIYKSLLSRGGRIGEKILGKIAESVLR 264

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            ++ LHE    HRD+KP+N L++ EG +KL DFG     +S E + S+            
Sbjct: 265 GLSYLHERKIIHRDIKPQNILLNEEGEVKLCDFG-----VSGEAVNSL------------ 307

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLF 387
                                    A +  G+  YMA E ++G  Y  T D WSLG  + 
Sbjct: 308 -------------------------ATTFTGTSFYMAPERIQGHPYSVTCDVWSLGLTIL 342

Query: 388 ESLVGYTPF 396
           E   G  PF
Sbjct: 343 EVAQGRFPF 351

>Scas_628.9
          Length = 621

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 1/85 (1%)

Query: 218 LVKLLYAFQDTESLYL-AMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           +V  L  FQD +  Y   ME+  GGD  +L+++   L    A  +  ++   V  +H++G
Sbjct: 400 IVTTLDLFQDAKGEYCEVMEYCSGGDLFSLIVSAGKLEYAEADCFFKQLMRGVVYMHDMG 459

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFG 301
            +HRDLKPEN L+ S+G +K+TDFG
Sbjct: 460 VSHRDLKPENLLLTSDGVLKITDFG 484

>CAGL0B03509g complement(349638..351431) similar to sp|P38623
           Saccharomyces cerevisiae YLR248w RCK2
           Ca/calmodulin-dependent or sp|P38622 Saccharomyces
           cerevisiae YGL158w RCK1, start by similarity
          Length = 597

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 87/207 (42%), Gaps = 17/207 (8%)

Query: 225 FQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLK 283
           FQ+T+  Y L  E + GG+    ++   +L    +R  I ++  AV  +H LG  HRD+K
Sbjct: 249 FQETKHYYYLIQELLDGGEIFNEIVRLTYLSEDLSRHVIKQVALAVRHMHSLGIVHRDIK 308

Query: 284 PENFLIDSEGHI--KLTDFGLA--AGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRR 339
           PEN L  S  +I  K   F  +    T + E +    I    +  ++   F         
Sbjct: 309 PENLLFKSIEYIPSKKRTFRKSDDPATKADEGVFIPTIGGGGIGIVKLADFG-------- 360

Query: 340 KMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGS 399
            +   + Q         +G   Y A EV++ +KY   VD W +GC+L+  L G+ PF   
Sbjct: 361 -LSKQIFQKNTKTPCGTIG---YTAPEVVKDEKYSMQVDMWGIGCVLYTMLCGFPPFYDE 416

Query: 400 STNETYENLRHWKKTLRRPVLDNGRPA 426
             +   E +   + T   P  D   P 
Sbjct: 417 KIDVLTEKISRGEYTFLEPWWDEISPG 443

>Scas_564.7
          Length = 1210

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 101/266 (37%), Gaps = 68/266 (25%)

Query: 174 LARKRDTKEVCAXXXXXXXXXXXXXETNHVL---TERDILT--------------TTRSD 216
           LAR   TKE+CA             +   +    TE+++L               T R  
Sbjct: 178 LARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVLERQKKLEKEISRDKRTIREA 237

Query: 217 WLVKLLY---------AFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFC 267
            L ++LY             +   Y+  E+V GG     +I    LR  HAR +   +  
Sbjct: 238 SLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIAS 297

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
           A+  +H     HRDLK EN +I + G IK+ DFGL+                        
Sbjct: 298 ALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLS------------------------ 333

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFT-VDYWSLGCML 386
                 ++ DR+K             ++  GS  + A E+L+   Y    VD WS G +L
Sbjct: 334 ------NVFDRKKQL-----------HTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVL 376

Query: 387 FESLVGYTPFSGSSTNETYENLRHWK 412
           +  + G  PF   +++  +E ++  K
Sbjct: 377 YVLVCGKVPFDDENSSVLHEKIKQGK 402

>KLLA0E11979g complement(1060048..1061892) some similarities with
           sp|P25333 Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, hypothetical
           start
          Length = 614

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 49/85 (57%), Gaps = 1/85 (1%)

Query: 218 LVKLLYAFQDTESLYL-AMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           +++ L  FQD +  Y   ME+  GGD  TL+I    L    A  ++ ++   V  +H +G
Sbjct: 396 IIETLDLFQDAKGDYCEVMEYCSGGDLFTLIIAAGKLEYQEADCFLKQLITGVVYMHNMG 455

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFG 301
             HRDLKPEN L+  +G +K+TDFG
Sbjct: 456 VCHRDLKPENLLLTHDGTLKITDFG 480

>KLLA0A02497g 218592..219680 highly similar to sp|P14681
           Saccharomyces cerevisiae YGR040w KSS1 ser/thr protein
           kinase of the MAP kinase family, start by similarity
          Length = 362

 Score = 68.9 bits (167), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 94/211 (44%), Gaps = 39/211 (18%)

Query: 229 ESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFL 288
           E++YL  E +   D + + IN + L   H ++++ ++  A+ +LH     HRDLKP N L
Sbjct: 88  EAVYLVQELM-ETDLQKI-INQQNLSEDHIQYFVYQILRALKSLHSAQVIHRDLKPSNLL 145

Query: 289 IDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQT 348
           ++S   +K+ DFGLA    S++  QS                               R+ 
Sbjct: 146 LNSNCDLKVCDFGLARCLASSD--QS-------------------------------REN 172

Query: 349 EVNYANSMVGSPDYMALEV-LEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYEN 407
            V +    V +  Y A E+ L  ++Y   +D WS GC+L E ++G   F G    + +  
Sbjct: 173 MVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGKPLFPG---KDYHHQ 229

Query: 408 LRHWKKTLRRPVLDNGRPAFSDRTWDIITRL 438
           L    + L  P L++     S R  + I++L
Sbjct: 230 LWIILEVLGSPTLEDFEQIKSKRAKEYISQL 260

>ACR117W [1164] [Homologous to ScYOR231W (MKK1) - SH; ScYPL140C
           (MKK2) - SH] complement(557738..559312) [1575 bp, 524
           aa]
          Length = 524

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 84/194 (43%), Gaps = 54/194 (27%)

Query: 212 TTRSDWLVKLLYAFQDTE--SLYLAMEFVPGGDFRTLLINTRFLRNTHARF------YIS 263
           + +SD++V+    F D E  S+Y+AME++ G   R+L    + L     R        I+
Sbjct: 289 SCKSDYIVRYYGMFTDEEHSSIYIAMEYMGG---RSLDAIYKHLLKHGGRVGEKVLGKIA 345

Query: 264 E-MFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
           E +   ++ LH+    HRD+KP+N L++  G +KL DFG     +S E + S+       
Sbjct: 346 ESVLRGLSYLHQRKIIHRDIKPQNILLNEAGQVKLCDFG-----VSGEAVNSL------- 393

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
                                         A +  G+  YMA E ++G+ Y  T D WSL
Sbjct: 394 ------------------------------ATTFTGTSYYMAPERIQGQPYSVTSDVWSL 423

Query: 383 GCMLFESLVGYTPF 396
           G  L E    + PF
Sbjct: 424 GLTLLEVAQAHFPF 437

>Scas_613.5
          Length = 517

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 90/247 (36%), Gaps = 65/247 (26%)

Query: 232 YLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLI-- 289
           YL ++ +  G+    ++    LR    +   +++   +  LH+    HRD+KPEN L+  
Sbjct: 283 YLVLDKIDDGELFERIVKKTCLRQDETKAIFNQILMGLKHLHQQNIIHRDIKPENILLNI 342

Query: 290 -----------------DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTE 332
                            + +  +K+ DFGLA  T                          
Sbjct: 343 TRRTNPEQKQLGPWDEDEIDIQVKIADFGLAKFT-------------------------- 376

Query: 333 KSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVG 392
                           E+ + N++ G+P Y+A EVL  K Y   VD WS G +L+  L G
Sbjct: 377 ---------------GEMQFTNTLCGTPSYVAPEVLTKKGYTSKVDMWSAGVILYVCLCG 421

Query: 393 YTPFSGSSTNETY-ENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEH 451
           + PFS      +  E +   K     P  DN      D    +I+ L+    +   S E 
Sbjct: 422 FPPFSEQLGPPSLKEQILQAKFAFYTPYWDN----IDDNVLHLISHLLVLDADARYSVED 477

Query: 452 IKRMPYF 458
               P+F
Sbjct: 478 TINHPWF 484

>Scas_573.10
          Length = 569

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 93/227 (40%), Gaps = 22/227 (9%)

Query: 225 FQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLK 283
           FQ++++ Y +  E + GG+    ++   +     +R  I ++  AV  LH LG  HRD+K
Sbjct: 215 FQESKTYYYIVQELIHGGEIFGEIVKYTYFSEDLSRHVIKQLALAVQHLHSLGVVHRDIK 274

Query: 284 PENFLIDSEGHIKLTDFGLA----AGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRR 339
           PEN L +    I   +  L       T S E +    +    +  ++   F         
Sbjct: 275 PENLLFEPIEFIPSKEPKLRKSDDPSTKSDEGLFVPGVGGGGIGVVKLADFGLS------ 328

Query: 340 KMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGS 399
                 +Q       +  G+  Y A EV++ + Y   VD W +GC+L+  L G+ PF   
Sbjct: 329 ------KQIFATNTKTPCGTVGYTAPEVVKDEHYSMKVDMWGVGCVLYTMLCGFPPFYDE 382

Query: 400 STNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLI-ADPINR 445
             +   E +   + T  RP  D      S    + + RL+  DP  R
Sbjct: 383 KIDVLTEKISRGEYTFLRPWWDE----ISAGAKNAVIRLLEVDPNKR 425

>YCR008W (SAT4) [542] chr3 (128467..130278) Serine/threonine protein
           kinase involved in sensitivity to salt [1812 bp, 603 aa]
          Length = 603

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 218 LVKLLYAFQDTESLYL-AMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           +V  L  FQD +  Y   ME+  GGD  TL++    L    A  +  ++   V  +HE+G
Sbjct: 385 IVTTLDLFQDAKGEYCEVMEYCAGGDLFTLVVAAGKLEYMEADCFFKQLIRGVVYMHEMG 444

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFG 301
             HRDLKPEN L+  +G +K+TDFG
Sbjct: 445 VCHRDLKPENLLLTHDGVLKITDFG 469

>KLLA0C00979g 73295..74746 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 483

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 80/195 (41%), Gaps = 35/195 (17%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
           +L E   L+T    ++      F    +LY+ ME+   G    LL     L      F I
Sbjct: 61  LLKEIYFLSTLHCPYITHYYGTFTGDCNLYIVMEYCSNGSLLNLLRYYSRLTEQTTCFII 120

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEV 322
            ++  A+  LHE    HRDLK  N L++ +G ++L D G+      T +++    R    
Sbjct: 121 LQVCHALEYLHEKRLIHRDLKAANILLNDDGEVRLADLGV------TGQLKFNSTR-HGG 173

Query: 323 KNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSL 382
           KNL                            N+ VG+P +MA E+++ + YD   D WSL
Sbjct: 174 KNL----------------------------NTFVGTPFWMAPEIIKNQSYDGKCDIWSL 205

Query: 383 GCMLFESLVGYTPFS 397
           G    E L G  P S
Sbjct: 206 GITTLELLNGKPPMS 220

>Kwal_33.13222
          Length = 148

 Score = 64.7 bits (156), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/87 (34%), Positives = 51/87 (58%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +++L   ++   +LY+ +E+V  G+   LL+    L    A  +  ++   ++  H LG 
Sbjct: 9   VLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGI 68

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAA 304
            HRDLKPEN L+D + +IK+ DFG+AA
Sbjct: 69  VHRDLKPENLLLDHKFNIKIADFGMAA 95

>Scas_713.7
          Length = 983

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 79/199 (39%), Gaps = 44/199 (22%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTR-FLRNTH 257
           E   ++TE D+L       +VK     Q + +LY+ +EF   G  + LL   +  +    
Sbjct: 64  ELIEIMTEIDLLKNLNHVNIVKYHGFIQKSSNLYIILEFCSKGSLKNLLTGYKDGIPELD 123

Query: 258 ARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKI 317
           A+ YI +    +  LHE G  HRD+K  N L+DS   +KL DFG++    +T        
Sbjct: 124 AKVYIRQTLNGLVYLHEQGVIHRDIKAANLLLDSNDVVKLADFGVSTKVSNT-------- 175

Query: 318 RLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTV 377
                                              A ++ GS  +M+ E++  +      
Sbjct: 176 -----------------------------------AMTLAGSLHWMSPEIIGNRGASTLS 200

Query: 378 DYWSLGCMLFESLVGYTPF 396
           D WSLG  + E + G  PF
Sbjct: 201 DIWSLGATVVELVTGNPPF 219

>Scas_693.17
          Length = 1049

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 75/182 (41%), Gaps = 42/182 (23%)

Query: 232 YLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDS 291
           Y+  E+V GG     +I    L+ + AR +  ++  A+  LH     HRDLK EN +I  
Sbjct: 176 YMLFEYVSGGQLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISK 235

Query: 292 EGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVN 351
           +G+IKL DFGL+                                     +Y      + N
Sbjct: 236 DGNIKLIDFGLS------------------------------------NLY-----DKCN 254

Query: 352 YANSMVGSPDYMALEVLEGKKY-DFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
              +  GS  + A E+L+   Y    +D WS G +L+  + G  PF   ++N  +E ++ 
Sbjct: 255 KLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIKQ 314

Query: 411 WK 412
            K
Sbjct: 315 GK 316

>Scas_700.34
          Length = 864

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 102/237 (43%), Gaps = 54/237 (22%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +VKL    Q+++ + + +E+  GG+F   +   + L+   A    +++   V+ +H  G 
Sbjct: 119 IVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEGPACRLFAQLINGVHYIHSKGL 178

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLK EN L+D   ++ +TDFG  +                     EF          
Sbjct: 179 VHRDLKLENLLLDKHENLIITDFGFVS---------------------EF---------- 207

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKYDF-TVDYWSLGCMLFESLVGYTP 395
               Y+H    + +      GSP Y A E V+  K Y+    D WS G +L+  L GY P
Sbjct: 208 ----YSHGELMKTS-----CGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLP 258

Query: 396 F---SGSSTNETYENLRHW--KKTLRRPVLDNGRPAFSDRTWDIITR-LIADPINRL 446
           +   +G+   +    L H+  +  L+ P   N  P       D++ R LI+DP  R+
Sbjct: 259 WDDDAGNPDGDDISRLYHYITQTPLKFPDYINPIPR------DLLRRILISDPRRRI 309

>YLR096W (KIN2) [3511] chr12 (332591..336034) Serine/threonine
           protein kinase, related to Kin1p and S. pombe KIN1 [3444
           bp, 1147 aa]
          Length = 1147

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 76/182 (41%), Gaps = 42/182 (23%)

Query: 232 YLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDS 291
           Y+  E+V GG     +I    L+  HAR +   +  A+  LH     HRDLK EN +I S
Sbjct: 199 YMLFEYVSGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISS 258

Query: 292 EGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVN 351
            G IK+ DFGL+                              +I D RK           
Sbjct: 259 SGEIKIIDFGLS------------------------------NIFDYRKQL--------- 279

Query: 352 YANSMVGSPDYMALEVLEGKKYDFT-VDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
             ++  GS  + A E+L+ + Y    VD WS G +L+  + G  PF   +++  +E ++ 
Sbjct: 280 --HTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSILHEKIKK 337

Query: 411 WK 412
            K
Sbjct: 338 GK 339

>CAGL0M11396g 1120559..1124137 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase,
           hypothetical start
          Length = 1192

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 75/182 (41%), Gaps = 42/182 (23%)

Query: 232 YLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDS 291
           Y+  E+V GG     +I    LR  HAR +   +  A+  LH     HRDLK EN +I +
Sbjct: 208 YMLFEYVAGGQLLDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISN 267

Query: 292 EGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVN 351
            G IK+ DFGL+                              ++ D RK           
Sbjct: 268 SGEIKIIDFGLS------------------------------NVYDTRKQL--------- 288

Query: 352 YANSMVGSPDYMALEVLEGKKYDFT-VDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
             ++  GS  + A E+L+   Y    VD WS G +L+  + G  PF   +++  +E ++ 
Sbjct: 289 --HTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKR 346

Query: 411 WK 412
            K
Sbjct: 347 GK 348

>KLLA0F19536g 1808263..1811577 similar to sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2 ser/thr protein kinase, start by
           similarity
          Length = 1104

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 103/266 (38%), Gaps = 68/266 (25%)

Query: 174 LARKRDTKEVCAXXXXXXXXXXXXXETNHVL---TERDILT--------------TTRSD 216
           LA+ R T EVCA             + N +    TE +++               T R  
Sbjct: 114 LAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEELMERKKKLEKELSRDRRTIREA 173

Query: 217 WLVKLLY---------AFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFC 267
            L ++LY             +   Y+  E+V GG     +I    LR  HAR ++  +  
Sbjct: 174 SLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLRERHARKFVRGIAS 233

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
           A+  LH     HRDLK EN +I + G IK+ DFGL+                    NL  
Sbjct: 234 ALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLS--------------------NL-- 271

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY-DFTVDYWSLGCML 386
                   +++++++T              GS  + A E+L+   Y    VD WS G ++
Sbjct: 272 -------YDNKKQLHT------------FCGSLYFAAPELLKANPYIGPEVDIWSFGVVI 312

Query: 387 FESLVGYTPFSGSSTNETYENLRHWK 412
           +  + G  PF   + +  +E ++  K
Sbjct: 313 YVLVCGKVPFDDENASVLHEKIKKGK 338

>ACL054W [995] [Homologous to ScYGL180W (APG1) - SH]
           complement(269703..272621) [2919 bp, 972 aa]
          Length = 972

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 116/301 (38%), Gaps = 58/301 (19%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARF----- 260
           E  IL   +   +V LL   +     YL ME+   GD    +   R L + H        
Sbjct: 67  EIAILKKIKHPHIVGLLECERTGTDFYLMMEYCALGDLTFFIKKRRSLMDKHPLVRTLFE 126

Query: 261 -------------------YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFG 301
                              Y+ ++  A+  L      HRD+KP+N L+ +     L D+ 
Sbjct: 127 KYPPPSEHHNGLNRVLVVNYLQQLSSALKFLRSKNLVHRDIKPQNLLLST----PLVDYN 182

Query: 302 LAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPD 361
             A   +   +    + + ++ +  F  F   +                + A ++ GSP 
Sbjct: 183 DPAEFHARGFVGIYNLPILKIADFGFARFLPNT----------------SLAETLCGSPL 226

Query: 362 YMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLD 421
           YMA E+L  +KY+   D WS+G +L+E   G  PF  S+  E ++ ++     ++ P   
Sbjct: 227 YMAPEILNYQKYNAKADLWSVGTVLYEMCCGKPPFKASNHLELFQKIKKANDVIQFP--- 283

Query: 422 NGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYFAEVNFNTLRQSAPPFTPQLDSET 481
               A      D+I  L+        +FE  KRM +    +   + +   P+  +++SE 
Sbjct: 284 -KHAALESAMVDLICGLL--------TFEPAKRMGFTEFFSNGLVNEDLSPY--EVESEP 332

Query: 482 D 482
           D
Sbjct: 333 D 333

>CAGL0H01639g 158967..160532 similar to sp|P08458 Saccharomyces
           cerevisiae YDR523c SPS1 ser/thr protein kinase,
           hypothetical start
          Length = 521

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 82/203 (40%), Gaps = 45/203 (22%)

Query: 210 LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLIN--TRFLRNTHARFYISEMFC 267
           L   +S ++   +    +  S+++AME+  GG    LL    T  L     RF   E+  
Sbjct: 55  LAELKSPYVTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPEHKTRFITREILK 114

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            ++ LH     HRD+K  N L+  EG +KL+DFG++   +S+ R                
Sbjct: 115 GLSYLHSQRKIHRDIKAANILLTDEGKVKLSDFGVSGKLLSSFR---------------- 158

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVL--EGKKYDFTVDYWSLGCM 385
                                     ++ VG+P +MA E++  + + YD   D WSLG  
Sbjct: 159 -------------------------RDTFVGTPYWMAPEIVAHDSEGYDERADIWSLGIT 193

Query: 386 LFESLVGYTPFSGSSTNETYENL 408
           + E L G  P S     +   NL
Sbjct: 194 VIEMLRGSPPLSKYDPMKVIANL 216

>Kwal_0.307
          Length = 490

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 55/100 (55%), Gaps = 1/100 (1%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYL-AMEFVPGGDFRTLLINTRFLRNTHARFY 261
           + +E  I ++ +   ++  L  FQD +  Y   ME+  GGD  TL+I    L    A  +
Sbjct: 318 LTSEFCISSSLKHTNIIMTLDLFQDAKGDYCQVMEYCFGGDLFTLIIAAGKLEYMEADCF 377

Query: 262 ISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFG 301
             ++   V  +H++G  HRDLKPEN L+ S G +K+TDFG
Sbjct: 378 FKQLIRGVVYMHDMGVCHRDLKPENLLLSSNGTLKITDFG 417

>Kwal_33.13112
          Length = 505

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 92/239 (38%), Gaps = 50/239 (20%)

Query: 210 LTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLL--INTRFLRNTHARFYISEMFC 267
           L+  R+ ++      + +  S+++ MEF  GG    LL  +    L      + I E+  
Sbjct: 86  LSELRAPFVTTYYKTYVEDVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLY 145

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            +  LH     HRD+K  N L+  EG +KL DFG++   ++T +                
Sbjct: 146 GLEYLHSQRKIHRDVKAANILLTDEGEVKLGDFGVSGQIMATLK---------------- 189

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVL-EGKKYDFTVDYWSLGCML 386
                                     N+ VG+P +MA E++     YD   D WSLG   
Sbjct: 190 -------------------------RNTFVGTPYWMAPEIIARDNGYDEKADIWSLGITA 224

Query: 387 FESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINR 445
            E L G  P++     +   N+      LR+P    GR   S R + I   L  DP  R
Sbjct: 225 MELLTGQPPYAKYDPMKVLMNI-----PLRKPPRLQGRFTSSARDF-IALCLTKDPALR 277

>KLLA0B13112g complement(1146006..1148198) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, start by similarity
          Length = 730

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 81/191 (42%), Gaps = 37/191 (19%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEM 265
           E +IL     + +V    + Q+  +L + +E+VPGG   ++L N         + +  ++
Sbjct: 518 EMNILKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNNYGPFDEPLVKNFTRQI 577

Query: 266 FCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNL 325
              +  LH+    HRD+K  N LID +G +K+TDFG++                      
Sbjct: 578 LIGLAYLHKRNIIHRDIKGANILIDIKGGVKITDFGIS---------------------- 615

Query: 326 EFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCM 385
                         K  + L + + N   S+ GS  +MA EV++        D WS+GC+
Sbjct: 616 --------------KKLSPLNKQQ-NKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGCV 660

Query: 386 LFESLVGYTPF 396
           + E   G  PF
Sbjct: 661 IVEMFTGKHPF 671

>Kwal_55.20326
          Length = 750

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 81/191 (42%), Gaps = 37/191 (19%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEM 265
           E  +L   + + +V    + Q+  +L + +E+VPGG   ++L +         R +  ++
Sbjct: 537 EMGLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLIRNFTRQI 596

Query: 266 FCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNL 325
              ++ LH     HRD+K  N LID +G +K+TDFG++                      
Sbjct: 597 LIGLSYLHRKDIIHRDIKGANILIDIKGCVKITDFGIS---------------------- 634

Query: 326 EFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCM 385
                         K  + L Q + N   S+ GS  +MA EV++        D WS+GC+
Sbjct: 635 --------------KKLSPLNQQQ-NKRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCV 679

Query: 386 LFESLVGYTPF 396
           + E   G  PF
Sbjct: 680 IIEMFTGKHPF 690

>Scas_640.14*
          Length = 728

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 103/246 (41%), Gaps = 46/246 (18%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +V+L    Q+++ + + +E+  GG+F   +   R L+   A    +++   V+ +H  G 
Sbjct: 108 IVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEATACRLFAQLISGVSYMHSKGI 167

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLK EN L+D   ++ +TDFG                        EF A  E     
Sbjct: 168 VHRDLKLENLLLDKHENLIITDFGFVN---------------------EFYADNE----- 201

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKYDF-TVDYWSLGCMLFESLVGYTP 395
                  L +T         GSP Y A E V+  + Y     D WS G +L+  L GY P
Sbjct: 202 -------LMKTS-------CGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLP 247

Query: 396 FSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR--LIADPINRLRSFEHIK 453
           +     N   E++      + +  L   R  ++     I  R  L+++P+ R+ S  HIK
Sbjct: 248 WDDDKQNPNGEDIVRLYHYITKTPLKFPRIHYTT-FLGICLRHILVSNPVRRMSS-RHIK 305

Query: 454 RMPYFA 459
           +  + +
Sbjct: 306 KHEWLS 311

>CAGL0J03872g 365869..367854 similar to sp|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4 ser/thr protein kinase or
           tr|Q03002 Saccharomyces cerevisiae YPL141c, start by
           similarity
          Length = 661

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 77/187 (41%), Gaps = 42/187 (22%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +V+L    Q+++ + + +E+  GG+F   +   R L+ + A    +++   V  +H    
Sbjct: 115 VVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLISGVTYMHSKNL 174

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLK EN L+D   ++ +TDFG                            F  + + D
Sbjct: 175 VHRDLKLENLLLDKNENLVITDFG----------------------------FVNEFLPD 206

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKY-DFTVDYWSLGCMLFESLVGYTP 395
              M T              GSP Y A E V+  + Y     D WS G +L+  L GY P
Sbjct: 207 NEYMKT------------SCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLP 254

Query: 396 FSGSSTN 402
           +   STN
Sbjct: 255 WDDDSTN 261

>YLR362W (STE11) [3744] chr12 (849865..852018) MAP kinase kinase
           kinase (MAPKKK or MEKK), component of pheromone
           response, filamentous growth, high-osmolarity sensing,
           and STE vegetative growth pathways [2154 bp, 717 aa]
          Length = 717

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 48/191 (25%), Positives = 80/191 (41%), Gaps = 37/191 (19%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEM 265
           E ++L     + +V    A Q+  +L + +E+VPGG   ++L N      +    +  ++
Sbjct: 504 EMNLLKELHHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQI 563

Query: 266 FCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNL 325
              V  LH+    HRD+K  N LID +G +K+TDFG++                      
Sbjct: 564 LIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGIS---------------------- 601

Query: 326 EFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCM 385
                         K  + L + + N   S+ GS  +M+ EV++        D WS GC+
Sbjct: 602 --------------KKLSPLNKKQ-NKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCV 646

Query: 386 LFESLVGYTPF 396
           + E   G  PF
Sbjct: 647 VIEMFTGKHPF 657

>CAGL0B02739g complement(262590..264620) similar to sp|P23561
           Saccharomyces cerevisiae YLR362w STE11 ser/thr protein
           kinase of the MEKK family, hypothetical start
          Length = 676

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 77/191 (40%), Gaps = 36/191 (18%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEM 265
           E  +L   + + +V    + Q+  +L + +E+VPGG   ++L N           +  ++
Sbjct: 462 EMSLLKELQHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLSNYGPFEEPLIVNFTRQI 521

Query: 266 FCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNL 325
              V  LH     HRD+K  N LID +G +K+TDFG++                      
Sbjct: 522 LIGVAYLHRKNIIHRDIKGANILIDIKGCVKITDFGIS---------------------- 559

Query: 326 EFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCM 385
                         K  + L Q   +   S+ GS  +M+ EV++        D WS GC+
Sbjct: 560 --------------KKLSPLNQENQDKRTSLQGSVYWMSPEVVKQTATTSKADIWSTGCV 605

Query: 386 LFESLVGYTPF 396
           + E   G  P+
Sbjct: 606 VIEMFTGKHPY 616

>CAGL0L07810g complement(857656..859446) similar to sp|P25333
           Saccharomyces cerevisiae YCR008w SAT4
           serine/threonine-specific protein kinase, start by
           similarity
          Length = 596

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 218 LVKLLYAFQDTESLYL-AMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           +V  L  FQD    Y   ME+  GGD  TL+I    L    A  +  ++   V  +H++G
Sbjct: 360 IVDTLDLFQDANGDYCEVMEYCAGGDLFTLIIAAGKLEYMEADCFFKQLLRGVVYMHDMG 419

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFG 301
             HRDLKPEN ++  +G +K+TDFG
Sbjct: 420 VCHRDLKPENLILTHDGVLKITDFG 444

>Kwal_23.3590
          Length = 499

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 103/285 (36%), Gaps = 76/285 (26%)

Query: 175 ARKRDTKEVCAXXXXXXXXXXXXXETNHVLTERDILTTTRSDWLVKLLYAFQDTES---- 230
           A  +D+ +V A             +T     E  IL + +   +VKL+  F +  S    
Sbjct: 203 AIDKDSGDVVAVKIFHAQHNDDQKKTKQFREETKILMSIQHKNIVKLIDRFVEPVSKAQI 262

Query: 231 -LYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLI 289
             +L +E V  G+    ++    LR         ++   +  LH     HRD+KPEN L+
Sbjct: 263 QTFLVLEKVSDGELFDRIVRKTRLREDETNAIFKQILNGLRYLHAKNIIHRDIKPENILL 322

Query: 290 -------------------DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAF 330
                              + +  IK+ DFGLA                           
Sbjct: 323 SIRKRRHSDEQQLGPWDDDEIDITIKIADFGLAKFI------------------------ 358

Query: 331 TEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESL 390
                             E+ + N++ G+P Y+A EVL    Y   VD WS G +L+  L
Sbjct: 359 -----------------GEMQFTNTLCGTPSYVAPEVLTKTGYTSRVDMWSAGVLLYVCL 401

Query: 391 VGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDII 435
            G+ PFS        E L     +++  +L NG+ AF    WD I
Sbjct: 402 CGFPPFS--------EQLA--PPSMKEQIL-NGKFAFYSPYWDDI 435

>YGL180W (ATG1) [1811] chr7 (160069..162762) Serine/threonine
           protein kinase involved in induction of autophagy after
           nutrient limitation [2694 bp, 897 aa]
          Length = 897

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 104/267 (38%), Gaps = 51/267 (19%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDF-------RTLLINTRFLRNTHA 258
           E  IL   +   +V L+   + +   YL ME+   GD        + L+ N   LR    
Sbjct: 73  EIAILKKIKHPHIVGLIDCERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFE 132

Query: 259 RF-----------------YISEMFCAVNALHELGYTHRDLKPENFLIDSE--GHIKLTD 299
           ++                 Y+ ++  A+  L      HRD+KP+N L+ +   G+     
Sbjct: 133 KYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKS 192

Query: 300 FGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGS 359
           F    G +    +  +KI      +  F  F   +                + A ++ GS
Sbjct: 193 FH-ELGFVGIYNLPILKI-----ADFGFARFLPNT----------------SLAETLCGS 230

Query: 360 PDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPV 419
           P YMA E+L  +KY+   D WS+G ++FE   G  PF  S+  E ++ ++     +  P 
Sbjct: 231 PLYMAPEILNYQKYNAKADLWSVGTVVFEMCCGTPPFRASNHLELFKKIKRANDVITFPS 290

Query: 420 LDNGRPAFSDRTWDIITRLIADPINRL 446
             N  P   +    ++T    DP  R+
Sbjct: 291 YCNIEPELKELICSLLT---FDPAQRI 314

>YOR231W (MKK1) [5022] chr15 (772601..774127) Serine/threonine
           protein kinase of the MAP kinase kinase (MEK) family
           involved in cell wall integrity (low-osmolarity) pathway
           [1527 bp, 508 aa]
          Length = 508

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 79/190 (41%), Gaps = 48/190 (25%)

Query: 214 RSDWLVKLLYAFQDTE--SLYLAMEFVPG----GDFRTLLINTRFLRNTHARFYISEMFC 267
           +S+++V+    F D E  S+Y+AME++ G      ++ LL     +           +  
Sbjct: 276 QSEYIVRYYGMFTDDENSSIYIAMEYMGGRSLDAIYKNLLERGGRISEKVLGKIAEAVLR 335

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEF 327
            ++ LHE    HRD+KP+N L++  G +KL DFG     +S E + S+            
Sbjct: 336 GLSYLHEKKVIHRDIKPQNILLNENGQVKLCDFG-----VSGEAVNSL------------ 378

Query: 328 PAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLF 387
                                    A +  G+  YMA E ++G+ Y  T D WSLG  + 
Sbjct: 379 -------------------------ATTFTGTSFYMAPERIQGQPYSVTSDVWSLGLTIL 413

Query: 388 ESLVGYTPFS 397
           E   G  P S
Sbjct: 414 EVANGKFPCS 423

>YOR351C (MEK1) [5128] chr15 complement(995013..996506)
           Serine/threonine protein kinase required for meiotic
           recombination [1494 bp, 497 aa]
          Length = 497

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 101/257 (39%), Gaps = 56/257 (21%)

Query: 218 LVKLLYAFQD-TESLYLAMEFVPGGDFRTLLINTRFLRN---THARFYISEMFCAVNALH 273
           ++K+ + F D    LY+  + +PGGD  + L     L +   T +   + ++  A+N LH
Sbjct: 223 IIKVYHTFCDRNNHLYIFQDLIPGGDLFSYLAKGDCLTSMSETESLLIVFQILQALNYLH 282

Query: 274 ELGYTHRDLKPENFLI---DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAF 330
           +    HRDLK +N L+   +    I L DFG+A      + + S K R+  V        
Sbjct: 283 DQDIVHRDLKLDNILLCTPEPCTRIVLADFGIA------KDLNSNKERMHTVVGTPEYCA 336

Query: 331 TEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESL 390
            E      RK Y    +                    LE + YD   D WSLG +    L
Sbjct: 337 PEVGFRANRKAYQSFSRA-----------------ATLEQRGYDSKCDLWSLGVITHIML 379

Query: 391 VGYTPFSGSSTNETYENLRHWKKTLRRPVLDN---GRPAFSDRTWDIIT---------RL 438
            G +PF G  +               R ++ N   G+  F  + WDI++          L
Sbjct: 380 TGISPFYGDGS--------------ERSIIQNAKIGKLNFKLKQWDIVSDNAKSFVKDLL 425

Query: 439 IADPINRLRSFEHIKRM 455
             D + RL S + +K +
Sbjct: 426 QTDVVKRLNSKQGLKHI 442

>AER195C [2697] [Homologous to ScYCR008W (SAT4) - SH]
           (1005431..1006945) [1515 bp, 504 aa]
          Length = 504

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 1/85 (1%)

Query: 218 LVKLLYAFQDTESLYL-AMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELG 276
           ++  L  FQD +  Y   ME+  GGD  +L++    L    A  +  +M   V  +H++G
Sbjct: 286 IINTLDLFQDAKGDYCEVMEYCSGGDLFSLIVTAGKLEYMEADCFFKQMIRGVVYMHDMG 345

Query: 277 YTHRDLKPENFLIDSEGHIKLTDFG 301
             HRDLKPEN ++ + G +K+TDFG
Sbjct: 346 VCHRDLKPENLILTANGVLKITDFG 370

>CAGL0L07326g 808532..810052 similar to sp|P39009 Saccharomyces
           cerevisiae YDL101c DUN1 protein kinase, start by
           similarity
          Length = 506

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/266 (23%), Positives = 96/266 (36%), Gaps = 71/266 (26%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESL-----YLAMEFVPGGDFRTLLINTRFLRNTHARF 260
           E  IL       +V LL +F +  S      YL +E +  G+    ++    L    ++ 
Sbjct: 241 ETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKA 300

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLI-------------------DSEGHIKLTDFG 301
              ++   +  LH     HRD+KPEN L+                   + +  +K+ DFG
Sbjct: 301 IFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFG 360

Query: 302 LAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPD 361
           LA  T                                          E+ + N++ G+P 
Sbjct: 361 LAKFT-----------------------------------------GEMQFTNTLCGTPS 379

Query: 362 YMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETY-ENLRHWKKTLRRPVL 420
           Y+A EVL  K Y   VD WS G +L+  L G+ PFS      +  E +   K     P  
Sbjct: 380 YVAPEVLVKKGYTSKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQIMSAKYAFYSPYW 439

Query: 421 DNGRPAFSDRTWDIITRLIA-DPINR 445
           D       D    +I+ L+  DP NR
Sbjct: 440 DE----IDDAALHLISNLLVLDPENR 461

>CAGL0B01925g 176316..179150 similar to sp|P13185 Saccharomyces
           cerevisiae YDR122w KIN1 or sp|P13186 Saccharomyces
           cerevisiae YLR096w KIN2, hypothetical start
          Length = 944

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 78/195 (40%), Gaps = 43/195 (22%)

Query: 222 LYAFQD-TESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHR 280
           LY  Q  +   Y+  EF+ GG     +I    L+  HAR     +  A+  LH     HR
Sbjct: 156 LYEMQTLSNHYYMFFEFISGGQLLDYIIQHGSLKENHARKVSRGILSALQYLHANNIVHR 215

Query: 281 DLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRK 340
           DLK EN ++   G IKL DFGL+                    N+  P         R+ 
Sbjct: 216 DLKIENIMLSKTGEIKLIDFGLS--------------------NMYDP---------RKS 246

Query: 341 MYTHLRQTEVNYANSMVGSPDYMALEVLEGKKY-DFTVDYWSLGCMLFESLVGYTPFSGS 399
           + T              GS  + A E+L+   Y    VD WS G +L+  + G  PF   
Sbjct: 247 LQT------------FCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE 294

Query: 400 STNETYENLRHWKKT 414
           +++  +E ++  K T
Sbjct: 295 NSSALHEKIKKGKVT 309

>CAGL0L06006g complement(670707..673535) similar to sp|P53104
           Saccharomyces cerevisiae YGL180w APG1 essential for
           autophagocytosis, hypothetical start
          Length = 942

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 105/266 (39%), Gaps = 49/266 (18%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARF----- 260
           E  IL   +   +V L+   + T   YL M++   GD   L+   + L N H        
Sbjct: 60  EIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIKKRKELENNHPLLQTVFN 119

Query: 261 -------------------YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFG 301
                              Y+ ++  A+  L      HRD+KP+N L+ +     LT++ 
Sbjct: 120 KYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDIKPQNLLLAT----PLTNYR 175

Query: 302 LAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPD 361
            +        +    + + ++ +  F  F   +                + A ++ GSP 
Sbjct: 176 DSKTFHELGYVGIYNLPILKIADFGFARFLPST----------------SLAETLCGSPL 219

Query: 362 YMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLD 421
           YMA E+L  +KY+   D WS+G +LFE   G  PF+ S+  E ++ ++     +  P + 
Sbjct: 220 YMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFPEV- 278

Query: 422 NGRPAFSDRTWDIITRLIA-DPINRL 446
                  D   ++I  L+  DP  R+
Sbjct: 279 ---CEVEDGLKELICSLLTFDPAKRI 301

>Kwal_26.8703
          Length = 444

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 82/202 (40%), Gaps = 48/202 (23%)

Query: 202 HVLTERDILTTTRSDWLVKL--LYAFQDTESLYLAMEFVPGGD----FRTLLINTRFLRN 255
            VL E     +  S+++V+   ++A + T S+Y+AME++ G      ++ LL     +  
Sbjct: 200 QVLRELQFNRSCSSEYIVRYYGMFAEESTSSIYIAMEYMGGKSLDAIYKHLLERGGRIGE 259

Query: 256 THARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSM 315
                    +   ++ L E    HRD+KP+N L++  G +KL DFG++   +++      
Sbjct: 260 KVLGKIAESVLKGLSYLQERKIIHRDIKPQNILLNEAGQVKLCDFGVSGVAVNS------ 313

Query: 316 KIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDF 375
                                                A +  G+  YMA E ++G+ Y  
Sbjct: 314 ------------------------------------LATTFTGTSFYMAPERIQGQPYSV 337

Query: 376 TVDYWSLGCMLFESLVGYTPFS 397
           T D WSLG  L E   G  PF 
Sbjct: 338 TSDVWSLGLTLLEVAQGQFPFG 359

>AFL188C [3007] [Homologous to ScYDL101C (DUN1) - SH] (88793..90211)
           [1419 bp, 472 aa]
          Length = 472

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 96/273 (35%), Gaps = 85/273 (31%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTES-----LYLAMEFVPGGDFRTLLINTRFLRNTHARF 260
           E  IL     + +VKLL  F +  S      YL +E +  G+    ++    L     R 
Sbjct: 203 ETKILMGLNHENIVKLLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRA 262

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLI-------------------DSEGHIKLTDFG 301
              ++   +  LH+    HRD+KPEN L+                   + +  +K+ DFG
Sbjct: 263 LFKQILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFG 322

Query: 302 LAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPD 361
           LA  T                                          E+ +  ++ G+P 
Sbjct: 323 LAKFT-----------------------------------------GEMQFTTTLCGTPS 341

Query: 362 YMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLD 421
           Y+A EVL    Y   VD WS G +L+  L G+ PFS                +++  +L 
Sbjct: 342 YVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLA----------PPSMKEQIL- 390

Query: 422 NGRPAFSDRTWD---------IITRLIADPINR 445
            G+ AF    WD         I   L+ DP  R
Sbjct: 391 QGKFAFYSPYWDEIDDSVLHLISNLLVVDPAKR 423

>AGR058W [4368] [Homologous to ScYLR096W (KIN2) - SH; ScYDR122W
           (KIN1) - SH] complement(823632..826847) [3216 bp, 1071
           aa]
          Length = 1071

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 76/182 (41%), Gaps = 42/182 (23%)

Query: 232 YLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDS 291
           Y+  E+V GG     +I    LR  HAR +   +  A+  LH     HRDLK EN +I S
Sbjct: 156 YMLFEYVSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISS 215

Query: 292 EGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVN 351
            G I++ DFGL+                    N+  P         +++++T        
Sbjct: 216 SGEIRIIDFGLS--------------------NMYDP---------KKQLHT-------- 238

Query: 352 YANSMVGSPDYMALEVLEGKKYDFT-VDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
                 GS  + A E+L+   Y    VD WS G +L+  + G  PF   + +  +E ++ 
Sbjct: 239 ----FCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQ 294

Query: 411 WK 412
            K
Sbjct: 295 GK 296

>CAGL0D02244g complement(229504..230967) similar to sp|P24719
           Saccharomyces cerevisiae YOR351c MEK1 ser/thr protein
           kinase, hypothetical start
          Length = 487

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 83/206 (40%), Gaps = 30/206 (14%)

Query: 206 ERDILTTTRSDWLVKLLYAFQD-TESLYLAMEFVPGGDFRTLLINTRFL---RNTHARFY 261
           E  IL       ++K+     D + +LY+  E +PGGD  + L     L     T A  +
Sbjct: 205 EAKILMQLNHPNIIKVFKTHTDKSNNLYIFQELIPGGDLFSYLAKGDCLMPISQTEALVF 264

Query: 262 ISEMFCAVNALHELGYTHRDLKPENFLIDSE---GHIKLTDFGLAAGTISTERIQSMKIR 318
           + ++  A+  LH  G  HRDLK +N L+ +      I L DFG+A        + +MK R
Sbjct: 265 VYQILHALKYLHTKGIVHRDLKLDNILLCTPEPFTKIVLADFGIA------RTVTTMKSR 318

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVD 378
           +  V         E   +  RK Y                   +     LE + YD   D
Sbjct: 319 MFTVVGTPEYCAPEVGFKANRKAYH-----------------SFFRAATLEQQGYDSKCD 361

Query: 379 YWSLGCMLFESLVGYTPFSGSSTNET 404
            WSLG +    L G +PF G  T ++
Sbjct: 362 LWSLGVITHIMLTGISPFYGDGTEQS 387

>Kwal_33.13831
          Length = 700

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 81/197 (41%), Gaps = 40/197 (20%)

Query: 201 NHVLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINT--RFLRNTHA 258
            H L+ER+  +      ++K+L   Q  +     +EF P GD  +LL  T    L    A
Sbjct: 453 GHSLSERETASQKPHPNILKMLDLMQTHDGFIEVLEFCPSGDLYSLLSRTSKNGLHPLEA 512

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
             ++ ++   V  +H+ G  H DLKPEN L   +G +K+ DFG +               
Sbjct: 513 DCFMKQLLHGVKYMHDHGIAHCDLKPENILFGPQGVLKICDFGTSC-------------- 558

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMAL-EVLEGKKYD-FT 376
                                 ++    + +V++    VGS  Y+A  E +  ++YD   
Sbjct: 559 ----------------------VFQTAWEKQVHFQTGAVGSEPYVAPEEFIAEREYDPRL 596

Query: 377 VDYWSLGCMLFESLVGY 393
           VD WS G +    ++G+
Sbjct: 597 VDSWSCGVIYCTMVLGH 613

>AAR009W [195] [Homologous to ScYOL016C (CMK2) - SH; ScYFR014C
           (CMK1) - SH] complement(358947..360308) [1362 bp, 453
           aa]
          Length = 453

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 70/187 (37%), Gaps = 43/187 (22%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +VK    F+  E  Y+  +   GG+    ++       T A   + +M  AV  +H    
Sbjct: 115 IVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEYMHSQNV 174

Query: 278 THRDLKPENFLI---DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKS 334
            HRDLKPEN L      E  + ++DFG+A                   K L         
Sbjct: 175 VHRDLKPENVLYLDPSDESQLVISDFGIA-------------------KQLS-------- 207

Query: 335 IEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYT 394
                        +E    +   GS  Y+A EVL    +    D WSLG + +  L GY+
Sbjct: 208 -------------SESQLIHRAAGSMGYVAPEVLTTSGHGKPCDIWSLGVITYTLLCGYS 254

Query: 395 PFSGSST 401
           PF   ST
Sbjct: 255 PFIAEST 261

>Kwal_56.23717
          Length = 858

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 73/182 (40%), Gaps = 42/182 (23%)

Query: 232 YLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDS 291
           Y+  E+V GG     +I    LR   AR +   +  A+  LH     HRDLK EN +I +
Sbjct: 9   YMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIST 68

Query: 292 EGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVN 351
            G IK+ DFGL+                                     MY   +Q    
Sbjct: 69  SGEIKIIDFGLS------------------------------------NMYNPKKQL--- 89

Query: 352 YANSMVGSPDYMALEVLEGKKYDFT-VDYWSLGCMLFESLVGYTPFSGSSTNETYENLRH 410
             ++  GS  + A E+L+   Y    VD WS G +LF  + G  PF   +++  +E ++ 
Sbjct: 90  --HTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQ 147

Query: 411 WK 412
            K
Sbjct: 148 GK 149

>Kwal_47.17263
          Length = 1127

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 90/383 (23%), Positives = 151/383 (39%), Gaps = 55/383 (14%)

Query: 108 RRQRTKSVLNYLERNQNSLSTEELNN----EWTAYLQQEHDVLRKRRLKPKNKDFEMITX 163
           +RQR    LN+   +QN +S   L      + T  +  E+D + KR++      +E+I  
Sbjct: 58  QRQRQ---LNH-PMHQNHISVPPLATPRKVKETTKISLEYDPISKRKVL---NTYEIIGE 110

Query: 164 XXXXXXXXXXLARKRDTKEVCAXXXXXXXXXXX--------XXETNHVLTERDILTTTRS 215
                     LAR   TK++ A                      ++ +  E  I+     
Sbjct: 111 LGQGQHGKVKLARDLVTKQLVAIKIVDRNGGKSNRFSFKKNTNGSDKIKREIAIMKKCHH 170

Query: 216 DWLVKLLYAFQDTES--LYLAMEFV--------PGGDFRTLLINTRFLRNTHARFYISEM 265
           + +VKL+    D+ S  +YL +E+         PG    T       L    AR     +
Sbjct: 171 EHVVKLVEVLDDSTSRKIYLVLEYCSKGEVKWCPGDQLETEARGPPLLTFQRAREIFRGV 230

Query: 266 FCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLA-AGTISTERIQSMKIRLEEVKN 324
              +  LH  G  HRD+KP N LI   G +K++DFG++ A + S     S+   LE  K 
Sbjct: 231 VLGLEYLHYQGIIHRDIKPANLLISESGTVKISDFGVSFAASKSGAGYGSLD-ELELAKT 289

Query: 325 LEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGC 384
              PAF    I              + +  S   +PD  + +   G    + +D W++G 
Sbjct: 290 AGTPAFFAPEI-------------CLGHEASERFAPDRPSSD--HGSIISYNIDIWAIGV 334

Query: 385 MLFESLVGYTPFSGSSTNETYENLRHWKKTLR--RPVLDNGRPAFSDR-----TWDIITR 437
            L   L G  PF      E ++ + + +  L+    +  NG    S++       D++ R
Sbjct: 335 TLHCLLFGMLPFFSEFELELFDKIINQELVLKTYEEMASNGISKISNQEEYEAAKDLLGR 394

Query: 438 LIA-DPINRLRSFEHIKRMPYFA 459
           L+  +P  R++  E IK+ P+  
Sbjct: 395 LLTKNPFKRIKIAE-IKKHPFVC 416

>Scas_651.19
          Length = 801

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 78/182 (42%), Gaps = 42/182 (23%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLI----NTRFLRNTHARFYISEMFCAVNALH 273
           ++K++   ++ ++ +  MEF P GD  +LL     N   L    A  ++ ++   V  +H
Sbjct: 574 ILKIIDLLENNDTFFEVMEFCPSGDLYSLLTRKSKNGTALHPLEADCFMKQLLHGVKYMH 633

Query: 274 ELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEK 333
           + G  H DLKPEN L   +G +K+ DFG +                              
Sbjct: 634 DHGVAHCDLKPENILFHPDGLLKICDFGTSC----------------------------- 664

Query: 334 SIEDRRKMYTHLRQTEVNYANSMVGSPDYMAL-EVLEGKKYD-FTVDYWSLGCMLFESLV 391
                  ++    +  V++ +  +GS  Y+A  E + GK+YD   VD WS G +    ++
Sbjct: 665 -------VFQTAWEKHVHFQSGAMGSEPYVAPEEFISGKEYDPRLVDCWSCGVVYCTMVM 717

Query: 392 GY 393
           G+
Sbjct: 718 GH 719

>Scas_707.36
          Length = 915

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 56/209 (26%), Positives = 85/209 (40%), Gaps = 33/209 (15%)

Query: 201 NHVLTERDILTTTRSDWLVKLLYAFQDTES--LYLAMEFVPGGDF-----RTLLINTRF- 252
           N +  E  I+    +  +VKL+    D  S  +YL +E+   G         L I++R  
Sbjct: 142 NKIKKEIAIMKKCNNKHVVKLIEILDDLSSRKIYLVLEYCEKGPILWCPRDQLEIDSRGP 201

Query: 253 --LRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGL---AAGTI 307
             L    AR    ++   +  LH  G  HRD+KP N L+D  G +K++DFG+   A G I
Sbjct: 202 PQLSFQRAREIFRDVILGLEYLHSQGIIHRDIKPANLLMDKNGVVKISDFGVSLAANGNI 261

Query: 308 STERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEV 367
            T   +     LE  K +  P F                  E+    + +   +    E+
Sbjct: 262 DTNDDE-----LELTKTVGTPVFYA---------------PEICLGAAAMERFNLDKDEL 301

Query: 368 LEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
             G    F +D W+LG  L+  L G  PF
Sbjct: 302 FNGSCISFKIDIWALGITLYCLLFGMLPF 330

>Kwal_27.12559
          Length = 414

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 118/297 (39%), Gaps = 63/297 (21%)

Query: 229 ESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFL 288
           + LY   E V   D   ++ +T      H + ++ ++ C +  +H     HRDLKP N L
Sbjct: 144 DGLYCYQELV-DYDLARVIHSTVQFSEFHIKHFLYQILCGLKYIHSADVIHRDLKPGNIL 202

Query: 289 IDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQT 348
               G++K+ DFGLA G                      P + E+             ++
Sbjct: 203 CSIGGNLKICDFGLARGIA--------------------PQYFEQ-------------KS 229

Query: 349 EVNYANSMVGSPDYMALE-VLEGKKYDFTVDYWSLGCMLFESLVGYTP-FSGSSTNETYE 406
           +  +  S V +  Y A E +L  ++Y   +D W++GC+L E   G  P F G   +++  
Sbjct: 230 DEIHITSYVATRWYRAPELILSHRRYTKAIDIWAVGCILAE-FYGRKPIFMG---HDSLH 285

Query: 407 NLRHWKKTLRRPVLDNGRPAFSDRTWDIITRLIADPINRLRSFEHIKRMPYF-------- 458
            +    K L  P  +      S R+W+I +          RS   +K+MP+         
Sbjct: 286 QVSEILKVLGSPCRETVAKYCSARSWEIFSG---------RS--EVKKMPWSSVYPKSCS 334

Query: 459 -AEVNFNTLRQSAPPFTPQLDSETDAGYFDDFTNEAD--MAKYADV-FKRQNKLSSM 511
            A+   + L    P   P ++      +F+D +N  D     Y    F  +NK +SM
Sbjct: 335 DAQALLDMLLTWDPDKRPGVEVALCHPFFEDVSNPYDEPSCPYGPFDFSYENKFTSM 391

>KLLA0B11946g complement(1048033..1049352) similar to sp|P41808
           Saccharomyces cerevisiae YPR054w SMK1
           sporulation-specific MAP kinase, start by similarity
          Length = 439

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/209 (28%), Positives = 86/209 (41%), Gaps = 40/209 (19%)

Query: 230 SLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLI 289
            LY   E V     R +  N  F    H + ++ ++ C +  +H     HRDLKP N L 
Sbjct: 152 GLYCYQELVDYDLARVIHSNVLF-SEFHIKHFLYQILCGMKYIHSADVIHRDLKPGNILC 210

Query: 290 DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTE 349
              G IK+ DFGLA G IS                   P+FT             +    
Sbjct: 211 SITGEIKICDFGLARG-IS-------------------PSFT-------------VAGGI 237

Query: 350 VNYANSMVGSPDYMALE-VLEGKKYDFTVDYWSLGCMLFESLVGYTP-FSGSSTNETYEN 407
            N+  + V +  Y A E +L  K+Y  +VD W++GC+L E   G  P F G   N++   
Sbjct: 238 SNHITNYVATRWYRAPELILSHKRYSKSVDMWAVGCILAE-FYGRKPVFMG---NDSLHQ 293

Query: 408 LRHWKKTLRRPVLDNGRPAFSDRTWDIIT 436
           +   +K L  P     R   S R +DI +
Sbjct: 294 VMEIQKILGTPKQIVIRTYGSSRCYDIFS 322

>KLLA0D11990g join(complement(1023928..1023944),
           gi|2499590|sp|Q92241|PH85_KLULA Kluyveromyces lactis
           NEGATIVE REGULATOR OF THE PHO SYSTEM, hypothetical start
          Length = 304

 Score = 63.9 bits (154), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 99/241 (41%), Gaps = 62/241 (25%)

Query: 206 ERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTH-------A 258
           E  ++   + D +V+L         L L  EF+   D +  + N R   N+H        
Sbjct: 53  EISLMKELKHDNIVRLFDVIHTENKLTLVFEFM-DNDLKKFMDN-RNKGNSHKGLEMDLV 110

Query: 259 RFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           +++  ++   V   HE    HRDLKP+N LI++ G +KL DFGLA               
Sbjct: 111 KYFQWQLLQGVAFCHENRILHRDLKPQNLLINNRGQLKLGDFGLAR-------------- 156

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKK-YDFTV 377
                     AF                   VN  +S V +  Y A +VL G + Y  ++
Sbjct: 157 ----------AFG----------------IPVNTFSSEVVTLWYRAPDVLMGSRNYCTSI 190

Query: 378 DYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGRPAFSDRTWDIITR 437
           D WS GC+L E ++G   F GS+     E L+    T+  PV         ++TW  +T+
Sbjct: 191 DIWSCGCILAEMIMGKPLFPGSNDE---EQLKLIFDTMGTPV---------EQTWPQVTQ 238

Query: 438 L 438
           L
Sbjct: 239 L 239

>Kwal_55.21709
          Length = 340

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 76/276 (27%), Positives = 113/276 (40%), Gaps = 70/276 (25%)

Query: 206 ERDILTT-TRSDWLVKLLYAFQDTESLYLAMEF--VPGGDFRTLLINTRFLRNTHARFYI 262
           E  ILT  T    ++ LL   QD+ S   A+ F  V   DFRTL +          ++Y 
Sbjct: 92  ELKILTNLTGGPNVIALLDIVQDSGSKIPALIFEEVKNVDFRTLYLKFTL---PDIQYYF 148

Query: 263 SEMFCAVNALHELGYTHRDLKPENFLIDS-EGHIKLTDFGLAAGTISTERIQSMKIRLEE 321
           S++  A++  H +G  HRD+KP+N +ID  E  ++L D+GLA                  
Sbjct: 149 SQLLIALDYCHSMGIMHRDVKPQNVMIDPVERKLRLIDWGLA------------------ 190

Query: 322 VKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEG-KKYDFTVDYW 380
               EF                      V+Y N  V S  +   E+L    +YD+++D W
Sbjct: 191 ----EF------------------YHPGVDY-NVRVASRYHKGPELLVNLNQYDYSLDLW 227

Query: 381 SLGCMLFESLVGYTPFSGSSTNE-----------TYENLRHWKK-TLRRP-VLDNGRPAF 427
           S+GCML   +    PF   STN            T E L +  K  L+ P   DN    F
Sbjct: 228 SVGCMLAAIVFKKEPFFKGSTNPDQLVKIARVLGTTELLAYLNKYGLKLPREYDNIMKDF 287

Query: 428 SDRTWD--------IITRLIADPINRLRSFEHIKRM 455
             +TW         ++   + D I  L  ++H +R+
Sbjct: 288 PRKTWSEFTTPDTPLVVPEVVDLIENLLRYDHQERL 323

>Kwal_26.8709
          Length = 829

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 75/181 (41%), Gaps = 42/181 (23%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGY 277
           +V+L    Q+++ + + +E+  GG+F   +   R L+   A    +++   V  +H  G 
Sbjct: 107 IVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACRLFAQLISGVYYMHSKGL 166

Query: 278 THRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIED 337
            HRDLK EN L+D   ++ +TDFG                            F  + + +
Sbjct: 167 VHRDLKLENLLLDKNENLLITDFG----------------------------FVNEFLPE 198

Query: 338 RRKMYTHLRQTEVNYANSMVGSPDYMALE-VLEGKKYDF-TVDYWSLGCMLFESLVGYTP 395
              M T              GSP Y A E V+  + Y+    D WS G +L+  L GY P
Sbjct: 199 NELMKT------------SCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLP 246

Query: 396 F 396
           +
Sbjct: 247 W 247

>YNL307C (MCK1) [4306] chr14 complement(56446..57573) Member of the
           GSK3 subfamily of protein kinases, positive regulator of
           meiosis and spore formation [1128 bp, 375 aa]
          Length = 375

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 91/228 (39%), Gaps = 63/228 (27%)

Query: 206 ERDILTTTRSDWLVKLLYAF-----QDTESL-YLAMEFVPGGDFRTLLINT-RFLRNT-- 256
           E  IL       +VKL Y F     QD +   +LAME +P     TL I   R++ N   
Sbjct: 80  ELQILRIADHPNIVKLQYFFTHLSPQDNKVYQHLAMECLP----ETLQIEINRYVTNKLE 135

Query: 257 ----HARFYISEMFCAVNALHELGYTHRDLKPENFLIDSE-GHIKLTDFGLAAGTISTER 311
               H R Y  ++   +  LH LG  HRD+KP N L+D E G +K+ DFG A        
Sbjct: 136 MPLKHIRLYTYQIARGMLYLHGLGVCHRDIKPSNVLVDPETGVLKICDFGSA-------- 187

Query: 312 IQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEG- 370
                      K LE                    Q  ++Y  S      Y A E++ G 
Sbjct: 188 -----------KKLEH------------------NQPSISYICSRF----YRAPELIIGC 214

Query: 371 KKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRP 418
            +Y   +D W LGC++ E L+G   F G    E    LR   K L  P
Sbjct: 215 TQYTTQIDIWGLGCVMGEMLIGKAIFQG---QEPLLQLREIAKLLGPP 259

>Scas_711.25
          Length = 1515

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 80/179 (44%), Gaps = 47/179 (26%)

Query: 224  AFQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDL 282
             F++ +++Y L +E+V GG   +L+           R   +++   +  LH  G  HRD+
Sbjct: 1284 GFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIRHLNTQVLRGLAYLHSRGILHRDM 1343

Query: 283  KPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMY 342
            K +N L+D +G  K++DFG++                                       
Sbjct: 1344 KADNLLLDQDGVCKISDFGIS--------------------------------------- 1364

Query: 343  THLRQTEVNYANS---MVGSPDYMALEVLEGKK-YDFTVDYWSLGCMLFESLVGYTPFS 397
               R+++  Y+NS   M G+  +MA E+++ K+ Y   VD WSLGC++ E   G  P+S
Sbjct: 1365 ---RKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWS 1420

>Kwal_23.5576
          Length = 504

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 75/169 (44%), Gaps = 36/169 (21%)

Query: 230 SLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLI 289
            LYL  E +   D   ++ + + L + H + +I ++ CA+  +H     HRDLKP N L+
Sbjct: 103 GLYLYEELMEC-DIHQIIKSGQPLTDAHYQSFIYQLLCALKYIHSADVLHRDLKPGNLLV 161

Query: 290 DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTE 349
           +++  +K+ DFGLA G                        ++E  +E+ + +  ++    
Sbjct: 162 NADCQLKVCDFGLARG------------------------YSENPVENNQFLTEYV---- 193

Query: 350 VNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSG 398
              A     +P+ M    L  + Y   +D WS GC+L E L G   F G
Sbjct: 194 ---ATRWYRAPEIM----LSYQGYTKAIDIWSCGCILAELLGGKPIFKG 235

>Kwal_17.2687
          Length = 362

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 93/238 (39%), Gaps = 56/238 (23%)

Query: 247 LINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGT 306
           +I T+ L + H ++++ ++  A+  LH     HRDLKP N L+++   +KL DFGLA   
Sbjct: 103 VIATQTLSDDHIQYFVYQILRALKCLHGAEVIHRDLKPANLLVNANCDVKLCDFGLA--- 159

Query: 307 ISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALE 366
               R   M            P  +              +  E       V +  Y A E
Sbjct: 160 ----RCAGMG-----------PGASNTG-----------KAGEAGQMTEYVATRWYRAPE 193

Query: 367 V-LEGKKYDFTVDYWSLGCMLFESLVGYTPFS---------------GSSTNETYENL-- 408
           V L   +Y F +D WS GC+L E L+    F                GS T    E +  
Sbjct: 194 VMLTAAEYTFAMDVWSCGCILAELLLRRPLFPGKDYHHQLLLIFQVIGSPTEADLECVRS 253

Query: 409 ---RHWKKTLRRPVLDNG----RPAFSDRTWDIITR-LIADPINRLRSFEHIKRMPYF 458
              R +  TL R     G     P  S    D++ R L+ DP  R+ + + + R PY 
Sbjct: 254 RRARQYLGTLPRYAAREGLRQLLPQASAEALDLLKRMLVFDPRRRISAAQAL-RHPYL 310

>Scas_635.1
          Length = 378

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 103/250 (41%), Gaps = 65/250 (26%)

Query: 199 ETNHVLTERDILTTTRSDWLVKLLYAF-----QDTESL-YLAMEFVPGGDFRTLLIN-TR 251
           +T +   E +IL  T    +VKL Y F     QD +   +LAME +P     TL I  +R
Sbjct: 77  QTEYKSRELEILRITNHPNIVKLEYFFTHVSPQDHKVYQHLAMECLP----ETLQIEISR 132

Query: 252 FLRNT------HARFYISEMFCAVNALHELGYTHRDLKPENFLID-SEGHIKLTDFGLAA 304
           +  N       H + Y  ++   +  LH LG  HRD+KP N L+D + G +K+ DFG A 
Sbjct: 133 YAHNKMELALKHVKLYSYQIARGMLYLHALGICHRDIKPSNILVDPNTGVLKICDFGSAK 192

Query: 305 GTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMA 364
                        RLE                        + Q  ++Y  S      Y A
Sbjct: 193 -------------RLE------------------------INQPSISYICSRF----YRA 211

Query: 365 LEVLEG-KKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNG 423
            E++ G  +Y   VD W LGC++ E L+G   F G    E    LR   K L  P  D  
Sbjct: 212 PELILGCTQYTTQVDIWGLGCVIGEMLLGKAIFQG---QEPLLQLREIAKLLGPP--DKK 266

Query: 424 RPAFSDRTWD 433
              FS+  +D
Sbjct: 267 FIFFSNPGYD 276

>KLLA0E17127g complement(1515721..1518279) similar to sp|P38691
           Saccharomyces cerevisiae YHR082c KSP1 ser/thr protein
           kinase, start by similarity
          Length = 852

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 82/205 (40%), Gaps = 56/205 (27%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNT-HARFY 261
            L E DI T       +  LY F D+   Y+ ME+  GGD    + +    R T +    
Sbjct: 113 ALYEVDIQTKIGKHKNITELYDFFDS---YIIMEYCSGGDLYEAIKDDMVPRKTKNVTNI 169

Query: 262 ISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEE 321
           I+++  AV  +H  G  HRD+KPEN LI    +IKLTD+GLA                  
Sbjct: 170 INQILDAVEYVHSRGIYHRDIKPENILIAGNWNIKLTDWGLAT----------------- 212

Query: 322 VKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGK--------KY 373
                    T+K+  +R                  VGS  YMA E+ E           Y
Sbjct: 213 ---------TDKTSMERN-----------------VGSERYMAPELFESNLDREERTDAY 246

Query: 374 DFT-VDYWSLGCMLFESLVGYTPFS 397
           D   VD W++G ++   +    PF+
Sbjct: 247 DCAKVDIWAIGIVMLNIVFHKNPFT 271

>Kwal_23.5668
          Length = 1689

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 79/169 (46%), Gaps = 34/169 (20%)

Query: 230 SLYLAMEFVPGGDFRTL--LINTRFLRNTHARFY--ISEMFCAVNALHELGYTHRDLKPE 285
           +L++ ME+      RTL  LI+T  L      ++    E+  A++ +H  G  HRDLKP 
Sbjct: 811 TLFIQMEYCEN---RTLFDLIHTENLCAQKEEYWRLFREILDALSYIHSQGIIHRDLKPM 867

Query: 286 NFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHL 345
           N  ID   +IK+ DFGLA                   KN+       KS+ D  +M +H+
Sbjct: 868 NIFIDESRNIKIGDFGLA-------------------KNV------HKSV-DLLRMDSHI 901

Query: 346 RQTEVNYANSMVGSPDYMALEVLEGK-KYDFTVDYWSLGCMLFESLVGY 393
                    S +G+  Y+A EVL G   Y+  +D +SLG + FE +  +
Sbjct: 902 STASTEDLTSAIGTALYVATEVLTGSGNYNEKIDMYSLGIIFFEMVYSF 950

>Scas_602.11
          Length = 1186

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 86/210 (40%), Gaps = 37/210 (17%)

Query: 218 LVKLLYAFQDTES--LYLAMEFVPGGDFR--------TLLINTRFLRNTHARFYISEMFC 267
           +VKL+    D +S  +YL +E+   G+ +        T       L    AR  I  +  
Sbjct: 243 VVKLIEVLDDLKSRKIYLVLEYCAQGEIKWCPKDCLETEAKGPPLLSFQSAREIIRGVIL 302

Query: 268 AVNALHELGYTHRDLKPENFLIDSEGHIKLTDFG--LAAGTISTERIQSMKIRLEEVKNL 325
            +  LH  G  HRD+KP N L+D EG +K++DFG  LA+ +       S  +     +NL
Sbjct: 303 GLEYLHYQGIIHRDIKPANLLVDEEGTVKISDFGVSLASRSSGNSTANSSSVLGGTPRNL 362

Query: 326 EFPAFTEKSIEDRRKMYTHLRQT--EVNYANSMVGSPDYMALEV---------------- 367
                +  S E       +  ++  EV  A +  G+P + A E+                
Sbjct: 363 -----SRSSTESMNTTNNNDDESIDEVELAKT-AGTPAFFAPEICLGEEAFDKFSLRKNE 416

Query: 368 -LEGKKYDFTVDYWSLGCMLFESLVGYTPF 396
             +G    F +D W+LG   +  L G  PF
Sbjct: 417 MFKGSCISFMIDIWALGITFYCLLFGMLPF 446

>AFR092W [3284] [Homologous to ScYJL095W (BCK1) - SH]
            complement(595092..599363) [4272 bp, 1423 aa]
          Length = 1423

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 78/179 (43%), Gaps = 47/179 (26%)

Query: 224  AFQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDL 282
             F++   +Y L +E+V GG   +L+           RF  +++   +  LH  G  HRD+
Sbjct: 1194 GFENKNCIYSLFLEYVAGGSVGSLIRLYGHFDEQLIRFLTTQVLEGLAYLHLRGILHRDM 1253

Query: 283  KPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMY 342
            K +N L+D++G  K++DFG++                                       
Sbjct: 1254 KADNLLLDNDGVCKISDFGIS--------------------------------------- 1274

Query: 343  THLRQTEVNYANS---MVGSPDYMALEVLE-GKKYDFTVDYWSLGCMLFESLVGYTPFS 397
               R++   Y+NS   M G+  +MA E+++  + Y   VD WSLGC++ E   G  P+S
Sbjct: 1275 ---RKSNNIYSNSEMTMRGTVFWMAPEMVDTTQGYSAKVDIWSLGCVVLEMFAGKRPWS 1330

>YJL095W (BCK1) [2820] chr10 (247171..251607) Serine/threonine protein
            kinase of the MEKK family involved in the cell wall
            integrity (low-osmolarity) and nutrient sensing pathways
            [4437 bp, 1478 aa]
          Length = 1478

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 79/179 (44%), Gaps = 47/179 (26%)

Query: 224  AFQDTESLY-LAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDL 282
             F++  ++Y L +E+V GG   +L+           +   +++   +  LH  G  HRD+
Sbjct: 1245 GFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDM 1304

Query: 283  KPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMY 342
            K +N L+D +G  K++DFG++                                       
Sbjct: 1305 KADNLLLDQDGICKISDFGIS--------------------------------------- 1325

Query: 343  THLRQTEVNYANS---MVGSPDYMALEVLEGKK-YDFTVDYWSLGCMLFESLVGYTPFS 397
               R+++  Y+NS   M G+  +MA E+++ K+ Y   VD WSLGC++ E   G  P+S
Sbjct: 1326 ---RKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFAGKRPWS 1381

>YDL028C (MPS1) [834] chr4 complement(400994..403288)
           Multi-functional serine/threonine/tyrosine protein
           kinase involved in mitotic checkpoint, spindle pole body
           duplication in meiosis and mitosis, and proper
           chromosome segregation in meiosis [2295 bp, 764 aa]
          Length = 764

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 74/186 (39%), Gaps = 61/186 (32%)

Query: 231 LYLAMEFVPGGDFRTLLINTRF---LRNTHARFYISEMFCAVNALHELGYTHRDLKPENF 287
           LYL ME   G    + ++N R    L     RFY  EM   +  +H+ G  H DLKP NF
Sbjct: 512 LYLIMEC--GDHDLSQILNQRSGMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANF 569

Query: 288 LIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQ 347
           ++  +G +K+ DFG+A                        P  T                
Sbjct: 570 VL-VKGILKIIDFGIANAV---------------------PEHT---------------- 591

Query: 348 TEVN-YANSMVGSPDYMALEVL-------------EGKKYDFT--VDYWSLGCMLFESLV 391
             VN Y  + +G+P+YMA E L             EG K+      D WS GC++++ + 
Sbjct: 592 --VNIYRETQIGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIY 649

Query: 392 GYTPFS 397
           G  P+ 
Sbjct: 650 GKPPYG 655

>ADR300C [2042] [Homologous to ScYHR082C (KSP1) - SH]
           (1222346..1225018) [2673 bp, 890 aa]
          Length = 890

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 73/265 (27%), Positives = 110/265 (41%), Gaps = 72/265 (27%)

Query: 200 TNHV----LTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRN 255
           +NH+    L E DI +       +  LY + D+   Y+ ME+  GGD    +      R 
Sbjct: 97  SNHICFEALYEVDIQSKIGKHKNITELYDYFDS---YIIMEYCSGGDLYEAIKADTIPRK 153

Query: 256 THARFYI-SEMFCAVNALHELGYTHRDLKPENFLI-DSEGHIKLTDFGLAAGTISTERIQ 313
           T    +I S++  AV  +H  G  HRD+KPEN LI DS   +KLTD+GLA          
Sbjct: 154 TRQLTHIISQILDAVEFVHSKGIYHRDIKPENILIADSNWTVKLTDWGLAT--------- 204

Query: 314 SMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEG--- 370
                            T+++  DR                  VGS  YMA E+ E    
Sbjct: 205 -----------------TDQTSMDRN-----------------VGSERYMAPELFESNLD 230

Query: 371 -----KKYDFT-VDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKKTLRRPVLDNGR 424
                + Y+ + VD W++G +L   +    PFS +  N+T ++  ++    R  + D   
Sbjct: 231 YDERNEPYECSKVDIWAIGIVLLNIVFHKNPFSVA--NQTDKSFCYFAAN-REALFD--- 284

Query: 425 PAFSDRTWDIIT----RLIADPINR 445
             FS  ++D+       L  DP NR
Sbjct: 285 -VFSTMSYDLYQLLRHSLTIDPTNR 308

>CAGL0H07535g 736241..737137 highly similar to sp|P00546
           Saccharomyces cerevisiae YBR160w CDC28, start by
           similarity
          Length = 298

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/283 (26%), Positives = 113/283 (39%), Gaps = 67/283 (23%)

Query: 204 LTERDILTTTRSDWLVKLL-YAFQDTESLYLAMEFVPGGDFRTL--LINTRFLRNTHARF 260
           + E  +L   + D +V+L      D   LYL +EF+     R +  +   + L     + 
Sbjct: 56  IREISLLKELKDDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESIPKDQPLGVNIIKK 115

Query: 261 YISEMFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
           ++ ++   +   H     HRDLKP+N LID EG++KL DFGLA       R   + +R  
Sbjct: 116 FMVQLCKGIAYCHAHRILHRDLKPQNLLIDKEGNLKLGDFGLA-------RAFGVPLR-- 166

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEV-LEGKKYDFTVDY 379
                                YTH            + +  Y A EV L GK+Y   VD 
Sbjct: 167 --------------------AYTH-----------EIVTLWYRAPEVLLGGKQYSTGVDT 195

Query: 380 WSLGCMLFESLVGYTPFSG-SSTNETYENLR--------HWKKTL------------RRP 418
           WS+GC+  E       FSG S  ++ ++  R         W   +            RR 
Sbjct: 196 WSIGCIFAEMCNRKPIFSGDSEIDQIFKIFRILGTPSEAVWPDIVYLPDFKPSFPQWRRK 255

Query: 419 VLDNGRPAFSDRTWDIITRLIA-DPINRLRSFEHIKRMPYFAE 460
            L    P+      D++ +L+A DPINR+ S       PYF E
Sbjct: 256 DLAEVVPSLDPHGIDLLDKLLAYDPINRI-SARRAANHPYFHE 297

>Kwal_55.20189
          Length = 812

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 85/206 (41%), Gaps = 57/206 (27%)

Query: 203 VLTERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYI 262
            L E DI T       +  LY F D+   ++ ME+  GGD    +      + T    +I
Sbjct: 104 ALYEVDIHTKVGKHKNITELYDFFDS---FIVMEYCSGGDLYEAIKADLIPKRTKVITHI 160

Query: 263 -SEMFCAVNALHELGYTHRDLKPENFLID-SEGHIKLTDFGLAAGTISTERIQSMKIRLE 320
            S++  A+  +H+ G  HRDLKPEN LI+ S+  IKLTD+GLA                 
Sbjct: 161 ASQIMEAIEFVHQKGIYHRDLKPENILIEGSDWTIKLTDWGLAT---------------- 204

Query: 321 EVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLE--------GKK 372
                     TE +  DR                  VGS  YMA E+ E         + 
Sbjct: 205 ----------TEPTSLDRS-----------------VGSERYMAPELFEENLDRDERSEP 237

Query: 373 YDFT-VDYWSLGCMLFESLVGYTPFS 397
           YD + VD W++G +L   +    PFS
Sbjct: 238 YDCSKVDLWAIGIVLLNIVFQKNPFS 263

>AEL284C [2221] [Homologous to ScYGR052W - SH] (106480..107919)
           [1440 bp, 479 aa]
          Length = 479

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 80/189 (42%), Gaps = 48/189 (25%)

Query: 218 LVKLLYAFQDTESLYLAMEFVPGGDFRTLL--INTRFLRNTHARFYISEMFCAVNALHEL 275
           + +LL  ++D ++    +E+   GD    +  I  R     +   ++ ++  A++  H  
Sbjct: 71  ICQLLDFYEDADTYVFVLEYCAYGDLYDFIKAIRERPTMRINFHSFLFQLCSAISYCHSK 130

Query: 276 GYTHRDLKPENFLIDSEGHIKLTDFGLAA-GTISTERIQSMKIRLEEVKNLEFPAFTEKS 334
             +HRD+KPEN L+D  G +KLTDFGL+  G++S +                        
Sbjct: 131 DVSHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKDYC---------------------- 168

Query: 335 IEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYD-FTVDYWSLGCMLFESLVGY 393
                                 +G+  Y+A E    + ++ F  DYWSLG  +F  + G 
Sbjct: 169 ----------------------IGTEKYLAPETFLREYHNTFATDYWSLGITIFCLMFGS 206

Query: 394 TPFSGSSTN 402
            PF  +S++
Sbjct: 207 CPFESASSD 215

>Scas_688.14
          Length = 479

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 75/169 (44%), Gaps = 36/169 (21%)

Query: 230 SLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISEMFCAVNALHELGYTHRDLKPENFLI 289
            LYL  E +   D   ++ +++ L + H + +I ++ C +  +H     HRDLKP N L+
Sbjct: 103 GLYLYEELMEC-DMHQIIKSSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLV 161

Query: 290 DSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKNLEFPAFTEKSIEDRRKMYTHLRQTE 349
           +++  +K+ DFGLA G                        ++E  +E+ + +  ++    
Sbjct: 162 NADCQLKICDFGLARG------------------------YSENPVENNQFLTEYV---- 193

Query: 350 VNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVGYTPFSG 398
              A     +P+ M    L  + Y   +D WS GC+L E L G   F G
Sbjct: 194 ---ATRWYRAPEIM----LSYQGYTKAIDIWSTGCILAEFLGGKPIFKG 235

>ABL011C [581] [Homologous to ScYLR362W (STE11) - SH]
           (378259..380364) [2106 bp, 701 aa]
          Length = 701

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 80/192 (41%), Gaps = 37/192 (19%)

Query: 205 TERDILTTTRSDWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRFLRNTHARFYISE 264
           T+ ++L     + +V    + Q+  +L + +E+VPGG   ++L +         + +  +
Sbjct: 486 TKMNLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEEPLVKNFTRQ 545

Query: 265 MFCAVNALHELGYTHRDLKPENFLIDSEGHIKLTDFGLAAGTISTERIQSMKIRLEEVKN 324
               +  LH     HRD+K  N LID +G +K+TDFG++                     
Sbjct: 546 TLVGLTYLHRKNIIHRDIKGANLLIDIKGSVKITDFGIS--------------------- 584

Query: 325 LEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGC 384
                          K  + L + + N   S+ GS  +MA EV++        D WS+GC
Sbjct: 585 ---------------KKLSPLNKKQ-NKRASLQGSVYWMAPEVVKQVVTTEKADIWSVGC 628

Query: 385 MLFESLVGYTPF 396
           ++ E   G  PF
Sbjct: 629 VVVEMFTGKHPF 640

>ADR379C [2120] [Homologous to ScYOR351C (MEK1) - SH]
           (1386601..1388079) [1479 bp, 492 aa]
          Length = 492

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 89/223 (39%), Gaps = 65/223 (29%)

Query: 206 ERDILTTTRSDWLVKLLYAFQD-TESLYLAMEFVPGGDFRTLLINTRFL---RNTHARFY 261
           E  +LT  + + ++K+   F D  +++Y+  + V GGD  + L     L     T A   
Sbjct: 207 EEHVLTRGQPN-VIKVHDTFVDENDNIYIFEDLVAGGDLFSYLAKKDCLAPISETEALVI 265

Query: 262 ISEMFCAVNALHELGYTHRDLKPENFLI---DSEGHIKLTDFGLAAGTISTERIQSMKIR 318
           + ++  A+  LH  G  HRDLK +N L+   +    I L DFG+A    ST         
Sbjct: 266 VYQILQALKFLHSKGIVHRDLKLDNILLCTPEPCSRIVLADFGIAKDLPST--------- 316

Query: 319 LEEVKNLEFPAFTEKSIEDRRKMYTHLRQTEVNYANSMVGSPDYMALEV----------- 367
                              R +M+T            +VG+P+Y A EV           
Sbjct: 317 -------------------RVRMHT------------IVGTPEYCAPEVGFRVDRNSYRN 345

Query: 368 ------LEGKKYDFTVDYWSLGCMLFESLVGYTPFSGSSTNET 404
                 +E + YDF  D WSLG M    L G +PF G  T  +
Sbjct: 346 FSRTASMEQQGYDFKCDLWSLGVMTHIMLTGISPFYGDGTEAS 388

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,626,460
Number of extensions: 761350
Number of successful extensions: 3445
Number of sequences better than 10.0: 647
Number of HSP's gapped: 3182
Number of HSP's successfully gapped: 1003
Length of query: 553
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 446
Effective length of database: 12,891,983
Effective search space: 5749824418
Effective search space used: 5749824418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)