Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_705.2286986941220.0
YPR112C (MRD1)88790528960.0
CAGL0B04169g86188626560.0
KLLA0D14949g87890026170.0
Kwal_23.398587689725950.0
ADR035C83887525950.0
Scas_88.125624510041e-130
CAGL0E03245g4251861854e-14
YGR159C (NSR1)4141971773e-13
AFR107W3962041738e-13
Scas_621.104151851749e-13
KLLA0C11495g4451851651e-11
YHR015W (MIP6)6592951581e-10
Sklu_1879.44211851542e-10
CAGL0L11792g5792251428e-09
AGR122C5851731401e-08
Sklu_2442.114642111347e-08
Scas_576.75751681347e-08
Kwal_56.23486587931348e-08
YER165W (PAB1)5771751348e-08
Scas_701.3321601311e-07
KLLA0C17600g5921631284e-07
Sklu_1715.1396831274e-07
Sklu_1838.3589931285e-07
KLLA0F07799g5241031213e-06
YIL061C (SNP1)300601175e-06
KLLA0D08206g391561176e-06
KLLA0A08338g766821187e-06
Scas_565.8322831167e-06
ADL063W320601159e-06
Sklu_2353.5252491131e-05
Kwal_33.15208186781111e-05
Sklu_1790.3473731151e-05
AFL224W206751101e-05
ABL134C375831132e-05
YOL123W (HRP1)534691142e-05
Scas_637.23771711132e-05
ADL160W526501132e-05
Sklu_2307.26971021142e-05
YCL011C (GBP2)4271741123e-05
Kwal_26.7179456841123e-05
CAGL0J11154g380831104e-05
CAGL0E01947g452491105e-05
YNL110C (NOP15)220831066e-05
KLLA0C12925g570501098e-05
Kwal_23.5864278491068e-05
Kwal_33.14463393831089e-05
YNL016W (PUB1)4531761089e-05
CAGL0M03795g513691089e-05
Scas_635.7581691081e-04
KLLA0B00847g269561032e-04
CAGL0K06655g802811062e-04
YOL041C (NOP12)459581052e-04
Kwal_55.21960597831052e-04
AGL250W729651043e-04
CAGL0I08943g6021721043e-04
YNL175C (NOP13)403831033e-04
Kwal_47.18572363761033e-04
Scas_696.324453061024e-04
CAGL0D05236g443781025e-04
CAGL0H04763g3831191016e-04
YPL043W (NOP4)685891026e-04
KLLA0F23650g312751006e-04
YDR432W (NPL3)414971016e-04
CAGL0B04807g4192041007e-04
KLLA0A05346g874781017e-04
AEL016C6781871018e-04
Sklu_2182.3371761008e-04
Scas_316.1483891008e-04
Scas_666.11224109978e-04
Kwal_0.25021683970.001
CAGL0L12672g68289990.001
YIR005W (IST3)14872930.001
Kwal_56.2470982883990.001
CAGL0L03806g25569960.001
AFL050W21871950.001
KLLA0D11792g68564990.001
Kwal_26.752226270960.001
AGR390C378182970.002
Scas_643.16448131970.002
Scas_621.1631470960.002
Scas_376.1404186970.002
Scas_717.4137999960.002
CAGL0I09900g21156940.002
Sklu_2407.322162940.002
Scas_598.151649960.002
AFR649W31081950.002
Kwal_27.11832686190960.003
ADR017W173118910.003
YBR212W (NGR1)672229950.003
YFR023W (PES4)611174950.004
YNL004W (HRB1)429325940.004
KLLA0D13420g16662900.004
Sklu_2221.828156930.004
AGR010C26672920.004
CAGL0M12573g29949930.005
YGL044C (RNA15)29670930.005
AEL217W83478940.005
KLLA0F09383g25870910.006
ACR274W42674920.007
CAGL0F01023g39658920.007
Kwal_26.845821977900.007
AAR151W48173920.008
KLLA0C05522g54073920.008
Scas_558.143571910.009
CAGL0H03267g77573920.009
CAGL0H03861g443216910.010
KLLA0E11011g43280910.011
Sklu_2375.520765880.012
CAGL0H10604g41686900.012
CAGL0E03630g74664910.013
CAGL0A03117g232122880.013
CAGL0D06182g28070890.014
KLLA0E08745g47585900.014
Sklu_1984.328472880.017
Scas_671.444375890.018
Kwal_55.2097213572820.027
KLLA0B00979g34261870.028
CAGL0C01529g23660850.029
CAGL0H02211g381117870.030
Sklu_2257.418862840.031
YPL178W (CBC2)20860840.038
ADR189W26957850.039
Sklu_1706.1672423860.042
ADR001C32487850.042
AGL038C71255860.049
Kwal_0.37056065850.051
Sklu_2213.425770840.051
Kwal_27.10364443167850.056
Kwal_27.1144743987840.060
CAGL0H04675g27468830.060
KLLA0C08019g30160830.071
Kwal_33.1349633072830.072
Kwal_27.1109620165800.098
Kwal_27.1233720956800.099
YIR001C (SGN1)25069810.10
Sklu_905.1515147820.11
YHR086W (NAM8)52382820.11
Scas_697.10610181820.11
YHL024W (RIM4)71355820.13
Scas_709.2*171114790.13
CAGL0J01914g16972780.14
YDR429C (TIF35)27462800.14
AER285C42669810.15
ADR183C32057800.15
Kwal_55.2041428480800.17
KLLA0F18216g70851810.17
Scas_714.5923362790.17
Kwal_30.1289028038790.18
KLLA0D13772g34572800.18
Sklu_2249.430978790.24
AAL018W33772790.25
KLLA0D05016g26278780.27
Scas_607.1060575790.32
ACL071C29872770.37
Scas_530.468455780.40
Kwal_55.2090314765740.43
Scas_720.224560760.44
CAGL0A04213g63970770.47
ADR307W56655760.57
CAGL0J02200g144108730.59
YBL051C (PIN4)66841760.67
YDR381W (YRA1)22685740.73
KLLA0B10472g19865730.74
Kwal_55.2103911963691.1
CAGL0H02123g55573731.3
KLLA0F14861g58962731.4
KLLA0C08041g57432731.4
Scas_241.118663701.8
Scas_632.7*22980711.8
KLLA0C07194g29745712.0
CAGL0F08217g67859722.0
Scas_665.421967702.2
YOR319W (HSH49)21361702.4
ABL059W20474692.4
CAGL0L04290g75435712.4
Scas_622.828772693.5
ACR235W57870684.9
Scas_591.5*29053675.3
YFR032C28983675.5
KLLA0B11594g11456646.0
Kwal_55.2015452273677.4
Scas_500.662170678.2
Scas_645.1471730678.5
YMR268C (PRP24)44467669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_705.22
         (869 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_705.22                                                          1592   0.0  
YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein w...  1120   0.0  
CAGL0B04169g complement(404713..407298) highly similar to tr|Q06...  1027   0.0  
KLLA0D14949g complement(1259860..1262496) similar to sgd|S000631...  1012   0.0  
Kwal_23.3985                                                         1004   0.0  
ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH] (768392..77...  1004   0.0  
Scas_88.1                                                             391   e-130
CAGL0E03245g complement(299236..300513) similar to sp|P27476 Sac...    76   4e-14
YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar ...    73   3e-13
AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH] complement(...    71   8e-13
Scas_621.10                                                            72   9e-13
KLLA0C11495g complement(990832..992169) some similarities with s...    68   1e-11
YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similar...    65   1e-10
Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement         64   2e-10
CAGL0L11792g 1259275..1261014 highly similar to sp|P04147 Saccha...    59   8e-09
AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH] (978634..98...    59   1e-08
Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement      56   7e-08
Scas_576.7                                                             56   7e-08
Kwal_56.23486                                                          56   8e-08
YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding prot...    56   8e-08
Scas_701.3                                                             55   1e-07
KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces...    54   4e-07
Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement          54   4e-07
Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement         54   5e-07
KLLA0F07799g complement(734889..736463) similar to sp|Q08208 Sac...    51   3e-06
YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1 snRNA-a...    50   5e-06
KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces c...    50   6e-06
KLLA0A08338g 736461..738761 weakly similar to sp|P39684 Saccharo...    50   7e-06
Scas_565.8                                                             49   7e-06
ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH] complement(...    49   9e-06
Sklu_2353.5 YIL061C, Contig c2353 10817-11575                          48   1e-05
Kwal_33.15208                                                          47   1e-05
Sklu_1790.3 YOL041C, Contig c1790 1701-3122                            49   1e-05
AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH] complement...    47   1e-05
ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH] (140625..14...    48   2e-05
YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylate...    49   2e-05
Scas_637.2                                                             48   2e-05
ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH] complement(...    48   2e-05
Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement         49   2e-05
YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein inv...    48   3e-05
Kwal_26.7179                                                           48   3e-05
CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces...    47   4e-05
CAGL0E01947g 193225..194583 some similarities with sp|Q99383 Sac...    47   5e-05
YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein ...    45   6e-05
KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383 S...    47   8e-05
Kwal_23.5864                                                           45   8e-05
Kwal_33.14463                                                          46   9e-05
YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylate...    46   9e-05
CAGL0M03795g complement(428607..430148) highly similar to sp|Q99...    46   9e-05
Scas_635.7                                                             46   1e-04
KLLA0B00847g complement(65983..66792) similar to sp|Q04067 Sacch...    44   2e-04
CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces c...    45   2e-04
YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein ...    45   2e-04
Kwal_55.21960                                                          45   2e-04
AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH] complement(...    45   3e-04
CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces c...    45   3e-04
YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleola...    44   3e-04
Kwal_47.18572                                                          44   3e-04
Scas_696.32                                                            44   4e-04
CAGL0D05236g 499006..500337 weakly similar to sp|P43607 Saccharo...    44   5e-04
CAGL0H04763g 454589..455740 highly similar to sp|Q01560 Saccharo...    44   6e-04
YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein r...    44   6e-04
KLLA0F23650g 2210563..2211501 some similarities with sp|P53927 S...    43   6e-04
YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved i...    44   6e-04
CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces c...    43   7e-04
KLLA0A05346g 485886..488510 some similarities with sp|P53316 Sac...    44   7e-04
AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W (...    44   8e-04
Sklu_2182.3 YDR432W, Contig c2182 3920-5035                            43   8e-04
Scas_316.1                                                             43   8e-04
Scas_666.11                                                            42   8e-04
Kwal_0.250                                                             42   0.001
CAGL0L12672g complement(1359637..1361685) similar to sp|P37838 S...    43   0.001
YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in ...    40   0.001
Kwal_56.24709                                                          43   0.001
CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces c...    42   0.001
AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH] complement(...    41   0.001
KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces...    43   0.001
Kwal_26.7522                                                           42   0.001
AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH] (1446842..1...    42   0.002
Scas_643.16                                                            42   0.002
Scas_621.16                                                            42   0.002
Scas_376.1                                                             42   0.002
Scas_717.41                                                            42   0.002
CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces c...    41   0.002
Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement         41   0.002
Scas_598.1                                                             42   0.002
AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073...    41   0.002
Kwal_27.11832                                                          42   0.003
ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH] complement(...    40   0.003
YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible R...    41   0.003
YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA po...    41   0.004
YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with simila...    41   0.004
KLLA0D13420g complement(1157491..1157991) some similarities with...    39   0.004
Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement       40   0.004
AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH] (736609..7...    40   0.004
CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces...    40   0.005
YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component...    40   0.005
AEL217W [2289] [Homologous to ScYGR250C - SH] complement(225217....    41   0.005
KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces c...    40   0.006
ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH] complement...    40   0.007
CAGL0F01023g complement(108155..109345) similar to tr|Q08208 Sac...    40   0.007
Kwal_26.8458                                                           39   0.007
AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH] complement(6...    40   0.008
KLLA0C05522g 494240..495862 some similarities with sp|P32831 Sac...    40   0.008
Scas_558.1                                                             40   0.009
CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces c...    40   0.009
CAGL0H03861g complement(361189..362520) similar to sp|P38922 Sac...    40   0.010
KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces c...    40   0.011
Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement       39   0.012
CAGL0H10604g complement(1033488..1034738) similar to sp|P32588 S...    39   0.012
CAGL0E03630g complement(335091..337331) weakly similar to sp|P38...    40   0.013
CAGL0A03117g join(315979..316263,317561..317974) highly similar ...    39   0.013
CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces c...    39   0.014
KLLA0E08745g 782800..784227 some similarities with sp|P32588 Sac...    39   0.014
Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement         39   0.017
Scas_671.4                                                             39   0.018
Kwal_55.20972                                                          36   0.027
KLLA0B00979g 77439..78467 some similarities with sp|Q01560 Sacch...    38   0.028
CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces c...    37   0.029
CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces c...    38   0.030
Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement         37   0.031
YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of nu...    37   0.038
ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH] complement...    37   0.039
Sklu_1706.1 YFR023W, Contig c1706 1364-3382                            38   0.042
ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH] (708437..70...    37   0.042
AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH] (639306..64...    38   0.049
Kwal_0.370                                                             37   0.051
Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement         37   0.051
Kwal_27.10364                                                          37   0.056
Kwal_27.11447                                                          37   0.060
CAGL0H04675g complement(447256..448080) highly similar to sp|Q04...    37   0.060
KLLA0C08019g complement(704199..705104) some similarities with s...    37   0.071
Kwal_33.13496                                                          37   0.072
Kwal_27.11096                                                          35   0.098
Kwal_27.12337                                                          35   0.099
YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein wi...    36   0.10 
Sklu_905.1 YMR268C, Contig c905 196-1743                               36   0.11 
YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated ...    36   0.11 
Scas_697.10                                                            36   0.11 
YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for s...    36   0.13 
Scas_709.2*                                                            35   0.13 
CAGL0J01914g complement(189309..189818) similar to sp|P40565 Sac...    35   0.14 
YDR429C (TIF35) [1252] chr4 complement(1324465..1325289) Transla...    35   0.14 
AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH] (1162117.....    36   0.15 
ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH] (1024792..1...    35   0.15 
Kwal_55.20414                                                          35   0.17 
KLLA0F18216g 1677731..1679857 some similarities with sp|P38741 S...    36   0.17 
Scas_714.59                                                            35   0.17 
Kwal_30.12890                                                          35   0.18 
KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4 A...    35   0.18 
Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement         35   0.24 
AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C (G...    35   0.25 
KLLA0D05016g complement(431592..432380) similar to sp|P25555 Sac...    35   0.27 
Scas_607.10                                                            35   0.32 
ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C (R...    34   0.37 
Scas_530.4                                                             35   0.40 
Kwal_55.20903                                                          33   0.43 
Scas_720.2                                                             34   0.44 
CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces c...    34   0.47 
ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH] complement(...    34   0.57 
CAGL0J02200g complement(215042..215476) similar to sp|P40561 Sac...    33   0.59 
YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein wit...    34   0.67 
YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992) P...    33   0.73 
KLLA0B10472g complement(914512..915108) similar to sgd|S0006099 ...    33   0.74 
Kwal_55.21039                                                          31   1.1  
CAGL0H02123g complement(188454..190121) similar to sp|Q00539 Sac...    33   1.3  
KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539 S...    33   1.4  
KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154...    33   1.4  
Scas_241.1                                                             32   1.8  
Scas_632.7*                                                            32   1.8  
KLLA0C07194g 624694..625587 no similarity, hypothetical start          32   2.0  
CAGL0F08217g complement(814508..816544) similar to sp|P53316 Sac...    32   2.0  
Scas_665.4                                                             32   2.2  
YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein a...    32   2.4  
ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH] complement(...    31   2.4  
CAGL0L04290g complement(499514..501778) similar to sp|Q12216 Sac...    32   2.4  
Scas_622.8                                                             31   3.5  
ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH] complement(...    31   4.9  
Scas_591.5*                                                            30   5.3  
YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein...    30   5.5  
KLLA0B11594g complement(1018044..1018388) some similarities with...    29   6.0  
Kwal_55.20154                                                          30   7.4  
Scas_500.6                                                             30   8.2  
Scas_645.14                                                            30   8.5  
YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA...    30   9.2  

>Scas_705.22
          Length = 869

 Score = 1592 bits (4122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 795/869 (91%), Positives = 795/869 (91%)

Query: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY 60
           MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY
Sbjct: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY 60

Query: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEERLLA 120
           HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEERLLA
Sbjct: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEERLLA 120

Query: 121 ESDXXXXXXXXXXRRLSIDAEISKNKQLQEFIETMKPSSQVPSWEKPVSHKNAEEDNEES 180
           ESD          RRLSIDAEISKNKQLQEFIETMKPSSQVPSWEKPVSHKNAEEDNEES
Sbjct: 121 ESDKKKQKVKEKERRLSIDAEISKNKQLQEFIETMKPSSQVPSWEKPVSHKNAEEDNEES 180

Query: 181 SNPLLALLNNGDDDKKPLLKENESDDEYADFNKDQKDEQEDEPMMKLDDLNXXXXXXXXX 240
           SNPLLALLNNGDDDKKPLLKENESDDEYADFNKDQKDEQEDEPMMKLDDLN         
Sbjct: 181 SNPLLALLNNGDDDKKPLLKENESDDEYADFNKDQKDEQEDEPMMKLDDLNTTETTEKKT 240

Query: 241 REDDHLAQDEKVSDLNWFKQRRVRIREGESEAAKPSSLSKEGNTEGNASLKXXXXXXXXX 300
           REDDHLAQDEKVSDLNWFKQRRVRIREGESEAAKPSSLSKEGNTEGNASLK         
Sbjct: 241 REDDHLAQDEKVSDLNWFKQRRVRIREGESEAAKPSSLSKEGNTEGNASLKENTDSENKN 300

Query: 301 XXXXXXXXXXXXXXXXXIAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVAL 360
                            IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVAL
Sbjct: 301 DEEEKKEEQEPQQTPEDIAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVAL 360

Query: 361 DTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLHILPADAKKSHRLDEFDLKNMP 420
           DTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLHILPADAKKSHRLDEFDLKNMP
Sbjct: 361 DTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLHILPADAKKSHRLDEFDLKNMP 420

Query: 421 LKKQRELKKKDNASRQTFSWNSLYMNQDAVLGSVAAKLGLKKSDLIDPESSNSAVKQALA 480
           LKKQRELKKKDNASRQTFSWNSLYMNQDAVLGSVAAKLGLKKSDLIDPESSNSAVKQALA
Sbjct: 421 LKKQRELKKKDNASRQTFSWNSLYMNQDAVLGSVAAKLGLKKSDLIDPESSNSAVKQALA 480

Query: 481 EAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVILVKNFPYGTTREEIGELFLPFGKL 540
           EAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVILVKNFPYGTTREEIGELFLPFGKL
Sbjct: 481 EAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVILVKNFPYGTTREEIGELFLPFGKL 540

Query: 541 KRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIE 600
           KRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIE
Sbjct: 541 KRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIE 600

Query: 601 ADAPEENVVEVKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKR 660
           ADAPEENVVEVKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKR
Sbjct: 601 ADAPEENVVEVKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKR 660

Query: 661 FKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK 720
           FKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK
Sbjct: 661 FKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK 720

Query: 721 LSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS 780
           LSHRQGSSNTT                NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS
Sbjct: 721 LSHRQGSSNTTSSAKGKKIKSGKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS 780

Query: 781 ARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQYXXXXXXXXXXXXXRMTKKVKKQVV 840
           ARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY             RMTKKVKKQVV
Sbjct: 781 ARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQYAQEEAADAEEEIARMTKKVKKQVV 840

Query: 841 SSELAALRNSGGRKKLELEDDENDGLNGF 869
           SSELAALRNSGGRKKLELEDDENDGLNGF
Sbjct: 841 SSELAALRNSGGRKKLELEDDENDGLNGF 869

>YPR112C (MRD1) [5533] chr16 complement(749252..751915) Protein with
           similarity to Pab1p, Pub1p, Nsr1p, Nop4p and other
           RNA-binding proteins, contains multiple RNA-binding
           domains, is required for 35S rRNA processing [2664 bp,
           887 aa]
          Length = 887

 Score = 1120 bits (2896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/905 (65%), Positives = 683/905 (75%), Gaps = 57/905 (6%)

Query: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINS----LITDVKILRNREGESRKFA 56
           MSRIIVKGLP +LTDDNL++HF KRL Q H ++ +N     LITDVKILR+R GESR+F 
Sbjct: 1   MSRIIVKGLPVYLTDDNLREHFTKRLRQKHSHQAVNGSGPDLITDVKILRDRNGESRRFG 60

Query: 57  FIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEE 116
           FIGY NEEDAFDAV YFNGS+INT+K+EVSMAKSFADPRVPQPMKE++REALKRFREKEE
Sbjct: 61  FIGYRNEEDAFDAVEYFNGSFINTSKIEVSMAKSFADPRVPQPMKEKRREALKRFREKEE 120

Query: 117 RLLAESDXXXXXXXXXXRRLSIDAEISKNKQLQEFIETMKPSSQVPSWEKPVSHKNAE-- 174
           +LL E +          +  +ID EI KNKQLQEF+ETMKPSSQV SWEK    K+ E  
Sbjct: 121 KLLQEENRKKKKVDEN-KHSNIDDEIRKNKQLQEFMETMKPSSQVTSWEKVGIDKSIEDE 179

Query: 175 ------EDNEESSNPLLALL-----NNGDDDKKPLLKENESDDEYADFNK----DQKDEQ 219
                 ED+    N LLA        N  D+   L+ ENESDDEY+  N+    DQ+D  
Sbjct: 180 KLKREEEDSSVQGNSLLAHALALKEENNKDEAPNLVIENESDDEYSALNRNRDEDQEDAG 239

Query: 220 EDEPMMKL------------DDLNXXXXXXXXXREDDHLAQDEKVSDLNWFKQRRVRIRE 267
           E+E M+ +            DD N         R   +LAQDEKVSDL+WFKQRRVRI+E
Sbjct: 240 EEEKMISISNLKDTDIGLVNDDANSDEKENEKRR---NLAQDEKVSDLDWFKQRRVRIKE 296

Query: 268 GESEAAKPSSLSKEGNTEGNASLKXXXXXXXXXXXXXXXXXXXXXXXXXXIAMEKISKTG 327
            E+E  + SS      TE N SL                           +A+EKI++TG
Sbjct: 297 SEAETREKSSSYA---TEQNESL--------DTKKEEQPERAVPQKTDEELAIEKINQTG 345

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           RLFLRNILYT+ E+DFRKLF PFGELEEVHVALDTRTG+SKGFAY+LFKD K AV AY+E
Sbjct: 346 RLFLRNILYTSKEEDFRKLFSPFGELEEVHVALDTRTGQSKGFAYVLFKDSKNAVNAYVE 405

Query: 388 LDKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQ 447
           LDKQIFQGRLLHILP + KKSHRLDEFDLKNMPLKKQ+ELK+K  ASRQTFSWNSLYMNQ
Sbjct: 406 LDKQIFQGRLLHILPGEEKKSHRLDEFDLKNMPLKKQKELKRKAAASRQTFSWNSLYMNQ 465

Query: 448 DAVLGSVAAKLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKS 507
           DAVLGSVAAKLGL+KS LID E+S+SAVKQALAEAH+IGDVRKYFESKGVDLTKF+Q KS
Sbjct: 466 DAVLGSVAAKLGLEKSQLIDAENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFSQLKS 525

Query: 508 PEQRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFT 567
             QRD KVILVKNFP+GTTREE+GE+FLP+GKL+RLLMPP+GTIAIV++RDTTS R+AFT
Sbjct: 526 TNQRDDKVILVKNFPFGTTREELGEMFLPYGKLERLLMPPAGTIAIVQFRDTTSARAAFT 585

Query: 568 KLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAP--EENVVEVKDTVKEIM----DS 621
           KL++KRFKDGIIYLE+GPKDCFT+ AE  DLI   +   EEN VEVK +  ++M    D 
Sbjct: 586 KLSYKRFKDGIIYLERGPKDCFTKPAEADDLINNTSAKEEENPVEVKPSSNDLMEANKDV 645

Query: 622 TDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHA 681
           T+ +SN    DE V DGPTVSIFIKNLNF+TT+  L+ RFK F+GFVVAQVKTKPDPKH 
Sbjct: 646 TEGSSNA--HDEDVIDGPTVSIFIKNLNFSTTNQNLTDRFKVFTGFVVAQVKTKPDPKHQ 703

Query: 682 DKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXX 741
            KTLSMGFGF EFRTKEQANAVI+A+DGTVIDGH+IQLKLSHRQ +S +           
Sbjct: 704 GKTLSMGFGFVEFRTKEQANAVIAAMDGTVIDGHKIQLKLSHRQ-ASQSGNTKTKSNKKS 762

Query: 742 XXXXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQ 801
                 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQ
Sbjct: 763 GKIIVKNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQ 822

Query: 802 LQGVHLLGRRLVMQYXXXXXXXXXXXXXRMTKKVKKQVVSSELAALRNSGGRKKLELEDD 861
           L GVHLLGRRLVMQY             RMTKKV+KQV ++E+AALRN GGRKKL+++D+
Sbjct: 823 LHGVHLLGRRLVMQYAEEDAVDAEEEIARMTKKVRKQVATNEMAALRNGGGRKKLDVDDE 882

Query: 862 ENDGL 866
           EN+G 
Sbjct: 883 ENEGF 887

>CAGL0B04169g complement(404713..407298) highly similar to tr|Q06106
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 861

 Score = 1027 bits (2656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/886 (62%), Positives = 661/886 (74%), Gaps = 48/886 (5%)

Query: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY 60
           MSR+IVKGLP +LT+  L++HF KRL  TH    ++ LITD++IL+NREG+SR+FAFIGY
Sbjct: 1   MSRVIVKGLPIYLTEPELQKHFNKRLITTHATSNVDGLITDLRILKNREGKSRRFAFIGY 60

Query: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEERLLA 120
            NE+DA DAVNYF+GS+I T+K+EV MAKSFADPRVP+ MKE+KREALKR   ++E  L 
Sbjct: 61  KNEQDALDAVNYFDGSFIYTSKIEVDMAKSFADPRVPKSMKEKKREALKR-LREKEEKLL 119

Query: 121 ESDXXXXXXXXXXRRLSIDAEISKNKQLQEFIETMKPSSQVPSWEK------PVSHKNAE 174
           E             +++IDAEI K+KQL+EFIETMKPS+Q  SW+K      P S    E
Sbjct: 120 EEKNKKLKVQDTKSKINIDAEIEKDKQLKEFIETMKPSAQTSSWDKITETAEPESGLAEE 179

Query: 175 E--DNEESSN--PLL--AL-LNNGDDDKKPLLKENESDDEYADFN----KDQKDEQ-EDE 222
           +  D+EESSN  PLL  AL +  GD        EN+SDDEY  FN    K   DE  E+E
Sbjct: 180 QELDDEESSNVNPLLKHALSMKKGD--------ENDSDDEYMSFNNADSKAGSDESNEEE 231

Query: 223 PMMKLDDLNXXXXXXXXX-REDDHLAQDEKVSDLNWFKQRRVRIRE-GESEAAKPSSLSK 280
            M+ L +L           +EDD LA++E++SD++W KQRRVRIRE GE    + ++  +
Sbjct: 232 KMISLSELPVQNEESSAEPKEDDGLAKNEEISDMDWIKQRRVRIRENGEKVGEEFATNVQ 291

Query: 281 EGNTEGNASLKXXXXXXXXXXXXXXXXXXXXXXXXXXIAMEKISKTGRLFLRNILYTTTE 340
           +  +E N+                              A+ KI KTGRLFLRNILY++TE
Sbjct: 292 DKESEENSQATPAEELQEEIPDEEQ-------------AIAKIQKTGRLFLRNILYSSTE 338

Query: 341 DDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLHI 400
           DDF+KLF P+GEL+EVHVA+DTRTG SKGFAY+LF  P+EAVQAYIELDKQIFQGRLLHI
Sbjct: 339 DDFKKLFSPYGELKEVHVAVDTRTGNSKGFAYVLFAKPEEAVQAYIELDKQIFQGRLLHI 398

Query: 401 LPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQDAVLGSVAAKLGL 460
           L AD  K HRLDEFDLKNMPLKKQRELKKK  AS+ TFSWNSLYMNQDAVLGSVAAKLG+
Sbjct: 399 LAADEMKDHRLDEFDLKNMPLKKQRELKKKAAASKATFSWNSLYMNQDAVLGSVAAKLGV 458

Query: 461 KKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVILVKN 520
           +K+DLIDPE+SNSAVKQALAEAH+IGDVRKYFE+KGVDLTKF+  KSP QRD +VILVKN
Sbjct: 459 QKADLIDPENSNSAVKQALAEAHVIGDVRKYFETKGVDLTKFSNLKSPSQRDDRVILVKN 518

Query: 521 FPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFKDGIIY 580
           FP+GTTREE+GELF+PFGKL+RLLMPP+GTIAIV++RD  SGRSAF+KLAFKRFK  +IY
Sbjct: 519 FPFGTTREELGELFVPFGKLERLLMPPAGTIAIVQFRDIASGRSAFSKLAFKRFKGTVIY 578

Query: 581 LEKGPKDCFTRDAEPADLIEADAPEENVVEVKDTVKEIMD--STDKTSNEEHEDEHVADG 638
           LEKGPKDCFT+ A   D +E D  E++  E   +  ++++  S+ KT ++E EDE V DG
Sbjct: 579 LEKGPKDCFTKAASNEDAMEHDE-EKSAKEAGPSSADLLESVSSKKTEDKEDEDEQVVDG 637

Query: 639 PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKE 698
           PTVSIFIKNLNF TTS +L+ RFK FSGFVVAQVKTKPDPK  +K LSMGFGF EFRTKE
Sbjct: 638 PTVSIFIKNLNFKTTSQQLTDRFKVFSGFVVAQVKTKPDPKQKNKVLSMGFGFVEFRTKE 697

Query: 699 QANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDV 758
           QA AVISA+DGTVIDGH+IQLKLSHRQG++ +                 NLPFEATRKDV
Sbjct: 698 QATAVISAMDGTVIDGHKIQLKLSHRQGNAGS---QEKKKAKNGKIIVKNLPFEATRKDV 754

Query: 759 FELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQYXX 818
           FELFNSFGQLKSVRVPKKFDKSARGFAFVEF+LPKEAENAMDQLQGVHLLGRRLVMQ   
Sbjct: 755 FELFNSFGQLKSVRVPKKFDKSARGFAFVEFVLPKEAENAMDQLQGVHLLGRRLVMQPAE 814

Query: 819 XXXXXXXXXXXRMTKKVKKQVVSSELAALRNSGGRKKLELEDDEND 864
                      RMTKKV+KQ   SE+AA+  + G++KL++ED+E +
Sbjct: 815 QEAANAEEELERMTKKVRKQAAVSEIAAMTRNAGKRKLDMEDEEEE 860

>KLLA0D14949g complement(1259860..1262496) similar to sgd|S0006316
           Saccharomyces cerevisiae YPR112c MRD1, start by
           similarity
          Length = 878

 Score = 1012 bits (2617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/900 (59%), Positives = 656/900 (72%), Gaps = 54/900 (6%)

Query: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY 60
           MSR+IVKGLP +L +D L+   EKRL Q H++  + S ++DVK+++NR+GESR+FAFIG+
Sbjct: 1   MSRVIVKGLPIYLKEDRLRDLIEKRLTQKHQSTDVQSYLSDVKLMKNRDGESRRFAFIGF 60

Query: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEERLLA 120
            +EEDAFD VNYFNG++++T+K+EVSMAKSFADPRVPQPM+E++REALKR RE+EE LLA
Sbjct: 61  RDEEDAFDCVNYFNGTFVDTSKIEVSMAKSFADPRVPQPMREKRREALKRLREREELLLA 120

Query: 121 ESDXXXXXXXXXX-----RRLSIDAEISKNKQLQEFIETMKPSSQVPSWEKPVSHKNAEE 175
           +                 ++  IDAEI+KNKQLQEFI TMKPSSQV SWE   S K   E
Sbjct: 121 DKKDSQKKQKSDSNNDGGKKHDIDAEIAKNKQLQEFINTMKPSSQVTSWETVQSSKTQGE 180

Query: 176 DNEE--------SSNPLL----ALLNN---GDDDKKPL-LKENESDDEYADFNKDQKDEQ 219
           D E         SSNPLL    AL  N    D+D     L  NESDDEY   N    +  
Sbjct: 181 DEEAADDEVGEMSSNPLLSQALALKGNSRDADEDTDMFKLPGNESDDEYVSLNGGSNNAN 240

Query: 220 EDEP---MMKLDDLNXXXXXXXXXREDDHLAQDEKVSDLNWFKQRRVRIREGESEAAKPS 276
            DEP   MM LD  +            D +A+DE VSDL+W K RRVRI++G   A  P 
Sbjct: 241 TDEPEPQMMSLDTFDTAGPTST-----DDMAKDEAVSDLDWLKNRRVRIKDG---ADTPV 292

Query: 277 SLSKEGNTEGNASLKXXXXXXXXXXXXXXXXXXXXXXXXXXIAMEKISKTGRLFLRNILY 336
           S             K                           +++KI +TGRLFLRNILY
Sbjct: 293 S-------------KQQQQPDTEQQQPEETEVETSQESEEEKSLKKIRETGRLFLRNILY 339

Query: 337 TTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGR 396
           T TEDDFRKLF P+GELEEVH+A+DTRTG+SKGFAY+LFK+   A  A++ELDKQIFQGR
Sbjct: 340 TATEDDFRKLFSPYGELEEVHIAVDTRTGQSKGFAYVLFKNADNAATAFVELDKQIFQGR 399

Query: 397 LLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQDAVLGSVAA 456
           LLHILPADAKKSH+LDEFDLKN+PLKKQRELK+K N+++QTFSWNSLYMNQDAVL SVA 
Sbjct: 400 LLHILPADAKKSHKLDEFDLKNLPLKKQRELKRKANSAQQTFSWNSLYMNQDAVLSSVAD 459

Query: 457 KLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVI 516
           KLG+KKS+LID E+S+SAVKQALAEA +IGDVRK+FE++GVDLTKFAQ K+ E RD +VI
Sbjct: 460 KLGMKKSELIDAENSSSAVKQALAEASVIGDVRKFFETRGVDLTKFAQLKNSE-RDDRVI 518

Query: 517 LVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFKD 576
           LVKNFPYGTTREEI ELFLPFGKL+RLL+PPSGTIAI+++RD  + R+AF+K+++KRFKD
Sbjct: 519 LVKNFPYGTTREEIAELFLPFGKLQRLLLPPSGTIAILQFRDVPAARAAFSKISYKRFKD 578

Query: 577 GIIYLEKGPKDCFTRDAEPADLIEA--DAPEENVVEVKDTVKEIMDSTD------KTSNE 628
           GIIYLEKGP DCFTRDA+  +L+E+  D  +    E K +  +++++           ++
Sbjct: 579 GIIYLEKGPSDCFTRDAQGDELVESETDIQKATAKEAKISGADLLEAQSLPAADKDDHDD 638

Query: 629 EHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMG 688
           + +D+ V  GPTVSIFIKNLNF+TTS +L+++FK F+GFVVAQVKTKPDPK   KTLSMG
Sbjct: 639 DDDDDDVQAGPTVSIFIKNLNFSTTSQQLTEKFKPFNGFVVAQVKTKPDPKQPGKTLSMG 698

Query: 689 FGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXN 748
           FGFAEF+TKEQANAVISA++GT++DGH++QLKLSHRQG+S T                 N
Sbjct: 699 FGFAEFKTKEQANAVISAMEGTILDGHKLQLKLSHRQGTSTTNASSKKKKKNQGKIIVKN 758

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL 808
           LPFEATRKDVFELF+SFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL
Sbjct: 759 LPFEATRKDVFELFSSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL 818

Query: 809 GRRLVMQYXXXXXXXXXXXXXRMTKKVKKQVVSSELAALRNSGGRKKLELEDDENDGLNG 868
           GRRLVM++             +MT+KVKKQV ++++A +RNSG RK    EDDENDGL G
Sbjct: 819 GRRLVMEFVEQDPEDVEQQIEKMTRKVKKQVNTTKIANMRNSGKRKIDLDEDDENDGLQG 878

>Kwal_23.3985
          Length = 876

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/897 (59%), Positives = 643/897 (71%), Gaps = 51/897 (5%)

Query: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY 60
           MSR+IVKG+P +LT+D LK HF KRL   HK E I+  +TDVKIL+NR GESR+FAF+G+
Sbjct: 1   MSRVIVKGIPKYLTEDKLKDHFGKRLATIHKGENISESLTDVKILKNRAGESRRFAFVGF 60

Query: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEERLLA 120
            +EEDAFDAVNYF+ S+I+T+K+EVSMAKSFADPRVPQPM+E++REALKR  E+EE+LL 
Sbjct: 61  KSEEDAFDAVNYFDQSFIDTSKIEVSMAKSFADPRVPQPMREKRREALKRLHEREEQLLE 120

Query: 121 ESDXXXXXXXXXXRRLSIDAEISKNKQLQEFIETMKPSSQVPSWEKPVSHKNAEEDNEES 180
           +             + ++DAEI  N QLQEF++TMKPS+QV SW+       A  D + +
Sbjct: 121 DKKAKKQQQQRGPAKHNLDAEIKSNTQLQEFLDTMKPSAQVTSWDNLGGAVQAANDAQNT 180

Query: 181 -------SNPLLA---LLNNGDDDKKPLLKENESDDEYADFNK-----DQKDEQEDEPMM 225
                   N LLA    +  G+      ++ENESDDEY   N        +D  E+E M+
Sbjct: 181 VSSDAPQGNSLLAQALAMKTGEPSGNFKVQENESDDEYTMLNNKANDGGNEDGGEEEQMV 240

Query: 226 KLDDLNXXXXXXXXXREDDHLAQDEKVSDLNWFKQRRVRIREG---------ESEAAKP- 275
           KLDD           +  +++AQDEKVSD NW KQ R+RI+E          E   A+P 
Sbjct: 241 KLDDFED--------KTKENMAQDEKVSDFNWLKQHRIRIKENTEGTENTDPEGVTARPK 292

Query: 276 SSLSKEGNTEGNASLKXXXXXXXXXXXXXXXXXXXXXXXXXXIAMEKISKTGRLFLRNIL 335
           S + +E N E     +                            ++KI  TGRLFLRNIL
Sbjct: 293 SDIREEDNVESTEDPESTEQQESKLDTTEEEKF-----------IQKIEATGRLFLRNIL 341

Query: 336 YTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQG 395
           YT TEDDFRKLF PFGELEEVHVALDTRTGKSKGFAY++FK+P +A  AY+ELDKQIFQG
Sbjct: 342 YTATEDDFRKLFAPFGELEEVHVALDTRTGKSKGFAYVMFKNPGDAANAYVELDKQIFQG 401

Query: 396 RLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQDAVLGSVA 455
           RLLHILP + KKSHRLDEFDLKN+PLKKQR LK+K NAS  TFSWNSLYMNQDAVLGSVA
Sbjct: 402 RLLHILPGEQKKSHRLDEFDLKNLPLKKQRSLKRKANASHDTFSWNSLYMNQDAVLGSVA 461

Query: 456 AKLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKV 515
           AKLG++KSDLID   +++AVKQALAEAH+IGDVRKYFESKG+DLTKF Q KSP  RD  V
Sbjct: 462 AKLGVQKSDLIDATDASAAVKQALAEAHVIGDVRKYFESKGMDLTKFEQFKSPSDRDDTV 521

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFK 575
           +LVKNFP+GTT  E+ +LFLPFGKL+RLL+PP+ TIA+V+YRD TS R+AF+KL++KRFK
Sbjct: 522 LLVKNFPFGTTHSELADLFLPFGKLQRLLLPPAQTIAVVQYRDATSARAAFSKLSYKRFK 581

Query: 576 DGIIYLEKGPKDCFTRDAEPADLI--EADAPEENVVEVKDTVKEIMDSTDKTSNEEHEDE 633
           DGI+YLEKGPK+CF+R+ E  + +  E  A   NV E + T  EIM +   +  E+   +
Sbjct: 582 DGILYLEKGPKNCFSREPEGDETMVDEIVAQSTNVKEARTTGDEIMQTATASKPEDDGTD 641

Query: 634 HVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAE 693
            V DGPTVSIF+KNLNF+TT  EL+++FKTF GFVVAQVKTKPDPK+++KTLSMGFGFAE
Sbjct: 642 DVVDGPTVSIFVKNLNFSTTGKELTEKFKTFGGFVVAQVKTKPDPKNSNKTLSMGFGFAE 701

Query: 694 FRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEA 753
           F+T+EQA AVI A+DG V+DGHRIQLKLSHR      +                NLPFE 
Sbjct: 702 FKTREQALAVIDAMDGAVLDGHRIQLKLSHR--QGGQSSSSGKSKKGTGKIIVKNLPFEV 759

Query: 754 TRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLV 813
            RK +FELF+SFGQLKSVR+PKKFDKSARGFAFVEFLLPKEAENAM+QLQGVHLLGRRLV
Sbjct: 760 ERKQIFELFSSFGQLKSVRLPKKFDKSARGFAFVEFLLPKEAENAMEQLQGVHLLGRRLV 819

Query: 814 MQYXXXXXXXXXXXXXRMTKKVKKQVVSSELAALRNSGGRKKLELED--DENDGLNG 868
           MQ+             RMTKKV+ QV + E AALRN GGR+K++L+D  DENDGLNG
Sbjct: 820 MQHAEEEPQDAEEQIARMTKKVRSQVTTREHAALRN-GGRRKVDLDDGLDENDGLNG 875

>ADR035C [1776] [Homologous to ScYPR112C (MRD1) - SH]
           (768392..770908) [2517 bp, 838 aa]
          Length = 838

 Score = 1004 bits (2595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/875 (59%), Positives = 637/875 (72%), Gaps = 43/875 (4%)

Query: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY 60
           MSR+IVKGLP +L +  L+ HF KRL Q  +       ITDVKI++++ G SR+FAFIGY
Sbjct: 1   MSRVIVKGLPIYLEEARLRAHFLKRLQQQGRGS--EDQITDVKIVKDKSGNSRRFAFIGY 58

Query: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEERLLA 120
            +E+DAFDA+ YFNGS+I+TA++EV+MAKSFADPRVP PM+E++REALKR RE+E+R+LA
Sbjct: 59  RSEQDAFDAIEYFNGSFIDTARIEVAMAKSFADPRVPTPMREKRREALKRLREREDRILA 118

Query: 121 ESDXXXXXXXXXXRRLSIDAEISKNKQLQEFIETMKPSSQVPSWEKPVSHKNAEEDNEES 180
           E                IDAEISKNKQLQEFIETM P     +     +      +   S
Sbjct: 119 EKRQKQTKPQH-----GIDAEISKNKQLQEFIETMNPKMAAAA----ANPMARAAEQPAS 169

Query: 181 SNPLLALLNNGDDDKKP---LLKENESDDEYADFNKDQKDEQEDE---PMMKLDDLNXXX 234
           +NPLL+ L+  +DD++     L E ESDDEY D ++  +  +EDE   P +  D      
Sbjct: 170 ANPLLSALHGAEDDEEVDMFQLSEQESDDEYTDLHQRPQSAEEDELEEPAVGQD----LD 225

Query: 235 XXXXXXREDDHLAQDEKVSDLNWFKQRRVRIREGESEAAKPSSLSKEGNTEGNASLKXXX 294
                   +D +A +++VSDL W K RR+RIR+GE   A P+   +         +    
Sbjct: 226 AAPAPDAAEDGMATNQEVSDLEWLKNRRIRIRDGEDAEAAPAPQEQAAEEPAEQEVPQED 285

Query: 295 XXXXXXXXXXXXXXXXXXXXXXXIAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELE 354
                                   A+ KI  TGRLFLRNILY  TE+DF++LF P+GELE
Sbjct: 286 EVSAEEA-----------------ALTKIRATGRLFLRNILYDATEEDFKQLFSPYGELE 328

Query: 355 EVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLHILPADAKKSHRLDEF 414
           EVHVA+DTRTG+SKGFAY+LFKDP+ A  AYIELDKQIFQGRLLHILPADAKK+HRLDEF
Sbjct: 329 EVHVAVDTRTGQSKGFAYVLFKDPEHAANAYIELDKQIFQGRLLHILPADAKKTHRLDEF 388

Query: 415 DLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQDAVLGSVAAKLGLKKSDLIDPESSNSA 474
           DLKN+PLKKQRELK+K  A++QTFSWNSL+MNQDAVL SVAAKLG++KS LIDPE+S SA
Sbjct: 389 DLKNLPLKKQRELKRKATAAQQTFSWNSLFMNQDAVLSSVAAKLGMEKSQLIDPENSGSA 448

Query: 475 VKQALAEAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVILVKNFPYGTTREEIGELF 534
           VKQALAEAH+IGDVRKYFE++GVDLT+F + K   +RD ++ILVKNFP+GTTREE+ ELF
Sbjct: 449 VKQALAEAHVIGDVRKYFEARGVDLTQFEKFKKVTERDDRIILVKNFPHGTTREELAELF 508

Query: 535 LPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAE 594
           LPFGK++R+LMPPSGTIAI++YRD  + R AFTKL++KRFK  I+YLEKGPKDCF+R+  
Sbjct: 509 LPFGKIERMLMPPSGTIAIIQYRDVPAARGAFTKLSYKRFKAPILYLEKGPKDCFSREPR 568

Query: 595 PADLIEADAPEENVVEVKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTS 654
             +L+E DA  E+V E+K +V+++MD+  KT + E       DGPTVSIF+KNLNF+TTS
Sbjct: 569 GDELLEGDAAPEDVKEIKKSVEDVMDADSKTPSSEAT---AIDGPTVSIFVKNLNFSTTS 625

Query: 655 VELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDG 714
            +L+++FK FSGFVVAQVKTKPDPK++DK LSMGFGF EFRTKEQA AVI+A+DG VIDG
Sbjct: 626 AQLAEKFKPFSGFVVAQVKTKPDPKNSDKKLSMGFGFIEFRTKEQAGAVIAAMDGAVIDG 685

Query: 715 HRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFELFNSFGQLKSVRVP 774
           H+IQLK+SH+Q S   T                NLPFEATRKDVFELF+SFGQLKSVRVP
Sbjct: 686 HKIQLKISHKQSSLPKT-SKGSKKKISGKIIVKNLPFEATRKDVFELFSSFGQLKSVRVP 744

Query: 775 KKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQYXXXXXXXXXXXXXRMTKK 834
           KKFDKSARGFAFVEFLLP EAENAMDQLQGVHLLGRRLVMQY             +MT K
Sbjct: 745 KKFDKSARGFAFVEFLLPSEAENAMDQLQGVHLLGRRLVMQYAEQESDDVEEQISKMTMK 804

Query: 835 VKKQVVSSELAALRNSGGRKKLELEDDENDGLNGF 869
           +KKQ   S++ ALRNSG R K+++ DDENDGLNGF
Sbjct: 805 MKKQAAVSKMGALRNSGKR-KIDMSDDENDGLNGF 838

>Scas_88.1
          Length = 256

 Score =  391 bits (1004), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 186/245 (75%), Positives = 218/245 (88%), Gaps = 2/245 (0%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           RLF+  I       DF +LF P+GELEEVHVALDTRTG+SKGFAYI+FK+P+ AV AYIE
Sbjct: 2   RLFVHFI--HCKGIDFXQLFSPYGELEEVHVALDTRTGRSKGFAYIMFKNPENAVDAYIE 59

Query: 388 LDKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQ 447
           LDKQIFQGRLLHILPA+AKKSHRLDEFDLKN+PLKKQRELK+K NAS+QTFSWNSLYMNQ
Sbjct: 60  LDKQIFQGRLLHILPAEAKKSHRLDEFDLKNLPLKKQRELKRKANASQQTFSWNSLYMNQ 119

Query: 448 DAVLGSVAAKLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKS 507
           DAVL SVA+KLG++KS+LIDP +S SAVKQALAEAH+IGDVRK+FES+GVDLTKF + KS
Sbjct: 120 DAVLSSVASKLGMEKSELIDPTNSGSAVKQALAEAHVIGDVRKFFESRGVDLTKFVEYKS 179

Query: 508 PEQRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFT 567
           P +RD  V+LVKNFP+GTT+EE+ ELFLPFGKL+RLLMPP+GTIAIV++RD T+ R+AFT
Sbjct: 180 PSERDECVMLVKNFPFGTTKEELAELFLPFGKLQRLLMPPAGTIAIVQFRDMTAARAAFT 239

Query: 568 KLAFK 572
           K+  K
Sbjct: 240 KIPTK 244

>CAGL0E03245g complement(299236..300513) similar to sp|P27476
           Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, start by
           similarity
          Length = 425

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 89/186 (47%), Gaps = 11/186 (5%)

Query: 637 DGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRT 696
           DG   ++F+  L+++     L + F+   G V A+V  +   +  D+  S G+G+ +F  
Sbjct: 172 DGEPATVFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYE---RGTDR--SRGYGYVDFED 226

Query: 697 KEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXX-----XNLPF 751
           K  A   +  + G  IDG  I + +S  + + N                       NL F
Sbjct: 227 KSYAEKAVKEMHGKEIDGRPINVDMSTSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSF 286

Query: 752 EATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLQGVHLLGR 810
            A R +++E+F  FG++ SVR+P   + +  +GF +V++    +A+ A++ LQG ++  R
Sbjct: 287 NADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNR 346

Query: 811 RLVMQY 816
            + + Y
Sbjct: 347 PVRLDY 352

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 3/59 (5%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFK---DPKEAVQA 384
           LFL N+ +    D+  ++FG FGE+  V +     T + KGF Y+ +    D K+A++A
Sbjct: 279 LFLGNLSFNADRDNIYEIFGKFGEIISVRIPTHPETEQPKGFGYVQYTSIDDAKKALEA 337

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 46/107 (42%), Gaps = 10/107 (9%)

Query: 621 STDKTSNEEHEDEH-----VADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTK 675
           ST K +    ED       +   P+ ++F+ NL+F      + + F  F   +  ++   
Sbjct: 252 STSKPTVNPREDRQKRFGDIPSEPSDTLFLGNLSFNADRDNIYEIFGKFGEIISVRI--- 308

Query: 676 PDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLS 722
             P H +     GFG+ ++ + + A   + AL G  ID   ++L  S
Sbjct: 309 --PTHPETEQPKGFGYVQYTSIDDAKKALEALQGEYIDNRPVRLDYS 353

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/72 (20%), Positives = 37/72 (51%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  + ++  ++  ++ F   G +    V  +  T +S+G+ Y+ F+D   A +A  E+
Sbjct: 178 VFVGRLSWSIDDEWLKQEFEHIGGVVAARVMYERGTDRSRGYGYVDFEDKSYAEKAVKEM 237

Query: 389 DKQIFQGRLLHI 400
             +   GR +++
Sbjct: 238 HGKEIDGRPINV 249

>YGR159C (NSR1) [2113] chr7 complement(806415..807659) Nucleolar
           protein involved in processing 20S to 18S rRNA, has 2
           RNA recognition (RRM) domains and is member of GAR
           (glycine/arginine-rich repeats) family of proteins [1245
           bp, 414 aa]
          Length = 414

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 91/197 (46%), Gaps = 16/197 (8%)

Query: 624 KTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADK 683
           K  NEE E+         +IF+  L+++     L K F+   G + A+V  +   +  D+
Sbjct: 158 KQKNEETEE-------PATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYE---RGTDR 207

Query: 684 TLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXX 743
             S G+G+ +F  K  A   I  + G  IDG  I   +S  + + N              
Sbjct: 208 --SRGYGYVDFENKSYAEKAIQEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEP 265

Query: 744 XXX---XNLPFEATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAM 799
                  NL F A R  +FELF   G++ SVR+P   + +  +GF +V+F   ++A+ A+
Sbjct: 266 SDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKAL 325

Query: 800 DQLQGVHLLGRRLVMQY 816
           D LQG ++  R + + +
Sbjct: 326 DALQGEYIDNRPVRLDF 342

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 5/84 (5%)

Query: 639 PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKE 698
           P+ ++F+ NL+F      + + F      V  ++     P H +     GFG+ +F   E
Sbjct: 265 PSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRI-----PTHPETEQPKGFGYVQFSNME 319

Query: 699 QANAVISALDGTVIDGHRIQLKLS 722
            A   + AL G  ID   ++L  S
Sbjct: 320 DAKKALDALQGEYIDNRPVRLDFS 343

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 34/72 (47%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LFL N+ +    D   +LF   GE+  V +     T + KGF Y+ F + ++A +A   L
Sbjct: 269 LFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDAL 328

Query: 389 DKQIFQGRLLHI 400
             +    R + +
Sbjct: 329 QGEYIDNRPVRL 340

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/80 (20%), Positives = 39/80 (48%)

Query: 321 EKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKE 380
           E+  +   +F+  + ++  ++  +K F   G +    V  +  T +S+G+ Y+ F++   
Sbjct: 162 EETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSY 221

Query: 381 AVQAYIELDKQIFQGRLLHI 400
           A +A  E+  +   GR ++ 
Sbjct: 222 AEKAIQEMQGKEIDGRPINC 241

>AFR107W [3299] [Homologous to ScYGR159C (NSR1) - SH]
           complement(628898..630088) [1191 bp, 396 aa]
          Length = 396

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 92/204 (45%), Gaps = 16/204 (7%)

Query: 624 KTSNEEHEDEHVA-----DGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDP 678
           K  + E ED+ VA     DG   +IF+  L+++     L   F    G V A+V  +   
Sbjct: 145 KKRSAESEDDAVAKKQKTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYE--- 201

Query: 679 KHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXX 738
           +  DK  S G+G+ +F     A   +  + G  IDG  I   +S  + +S          
Sbjct: 202 RGTDK--SRGYGYVDFEDVSYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKY 259

Query: 739 XXXXXXXX-----XNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLP 792
                         NL F A R  +FELF+  G + SVR+P   + +  +GF +V++   
Sbjct: 260 GDTPSQPSDTLFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSV 319

Query: 793 KEAENAMDQLQGVHLLGRRLVMQY 816
           +EA+ A+D LQG ++  R + + +
Sbjct: 320 EEAQAALDALQGEYIDNRPVRIDF 343

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 48/107 (44%), Gaps = 10/107 (9%)

Query: 621 STDKTSNEEHEDEHVADG-----PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTK 675
           ST K ++   ED     G     P+ ++F+ NL+F      L + F      +  ++   
Sbjct: 243 STSKPASAPREDRAKKYGDTPSQPSDTLFLGNLSFNADRDALFELFSKHGNVISVRI--- 299

Query: 676 PDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLS 722
             P H +     GFG+ ++ + E+A A + AL G  ID   +++  S
Sbjct: 300 --PTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYIDNRPVRIDFS 344

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 31/72 (43%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LFL N+ +    D   +LF   G +  V +     + + KGF Y+ +   +EA  A   L
Sbjct: 270 LFLGNLSFNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDAL 329

Query: 389 DKQIFQGRLLHI 400
             +    R + I
Sbjct: 330 QGEYIDNRPVRI 341

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  + ++  ++  +  F   G +    V  +  T KS+G+ Y+ F+D   A +A  E+
Sbjct: 169 IFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDVSYAEKAVKEM 228

Query: 389 DKQIFQGRLLHI-----LPADAKKSHRLDEF-DLKNMP 420
             +   GR ++       PA A +  R  ++ D  + P
Sbjct: 229 HGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQP 266

>Scas_621.10
          Length = 415

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 89/185 (48%), Gaps = 10/185 (5%)

Query: 637 DGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRT 696
           +G   +IF+  L+++     L K F+   G V A+V  +   +  D+  S G+G+ +F  
Sbjct: 158 EGEPATIFVGRLSWSIDDEWLKKEFEHIGGVVSARVIME---RGTDR--SRGYGYVDFED 212

Query: 697 KEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXX----NLPFE 752
           K  A   I  + G  IDG  I + +S  + ++                       NL F 
Sbjct: 213 KSYAEKAIKEMQGKEIDGREINVDMSTSKPAAGNNDRAKKFGDVPSEPSETLFLGNLSFN 272

Query: 753 ATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLQGVHLLGRR 811
           A R  + ELF+ +G++ SVR+P   + +  +GF +V++   ++A+ A++ LQG ++  R 
Sbjct: 273 ADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGLQGEYIDNRP 332

Query: 812 LVMQY 816
           + + Y
Sbjct: 333 VRLDY 337

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 5/84 (5%)

Query: 639 PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKE 698
           P+ ++F+ NL+F      +S+ F  +   +  ++     P H +     GFG+ ++   E
Sbjct: 260 PSETLFLGNLSFNADRDAISELFSKYGEIISVRI-----PTHPETEQPKGFGYVQYTNVE 314

Query: 699 QANAVISALDGTVIDGHRIQLKLS 722
            A   +  L G  ID   ++L  S
Sbjct: 315 DAKKALEGLQGEYIDNRPVRLDYS 338

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LFL N+ +    D   +LF  +GE+  V +     T + KGF Y+ + + ++A +A   L
Sbjct: 264 LFLGNLSFNADRDAISELFSKYGEIISVRIPTHPETEQPKGFGYVQYTNVEDAKKALEGL 323

Query: 389 DKQIFQGRLLHI 400
             +    R + +
Sbjct: 324 QGEYIDNRPVRL 335

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 38/72 (52%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  + ++  ++  +K F   G +    V ++  T +S+G+ Y+ F+D   A +A  E+
Sbjct: 164 IFVGRLSWSIDDEWLKKEFEHIGGVVSARVIMERGTDRSRGYGYVDFEDKSYAEKAIKEM 223

Query: 389 DKQIFQGRLLHI 400
             +   GR +++
Sbjct: 224 QGKEIDGREINV 235

>KLLA0C11495g complement(990832..992169) some similarities with
           sp|P27476 Saccharomyces cerevisiae YGR159c NSR1 nuclear
           localization sequence binding protein, hypothetical
           start
          Length = 445

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 85/185 (45%), Gaps = 11/185 (5%)

Query: 638 GPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTK 697
           G   +IF+  L+++     L   F+   G + A+V  +   +  D+  S G+G+ +F  K
Sbjct: 193 GEPATIFVGRLSWSIDDEWLKTEFEPIGGVISARVMYE---RGTDR--SRGYGYVDFEDK 247

Query: 698 EQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXX-----XNLPFE 752
             A   I  + G  IDG  I   +S  + +                         NL FE
Sbjct: 248 SYAEKAIKEMHGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEPSDTLFLGNLSFE 307

Query: 753 ATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLQGVHLLGRR 811
           A R +++E+F  +G++ SVR+P   + +  +GF +V++   ++A  A + LQG ++  R 
Sbjct: 308 ADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGLQGEYINNRP 367

Query: 812 LVMQY 816
           + + Y
Sbjct: 368 VRLDY 372

 Score = 43.1 bits (100), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LFL N+ +    D+  ++FG +GE+  V +     T + KGF Y+ +   ++A +A+  L
Sbjct: 299 LFLGNLSFEADRDNLYEIFGKYGEIVSVRIPTHPETEQPKGFGYVQYGSIEDATKAFEGL 358

Query: 389 DKQIFQGRLLHI 400
             +    R + +
Sbjct: 359 QGEYINNRPVRL 370

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 37/84 (44%), Gaps = 5/84 (5%)

Query: 639 PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKE 698
           P+ ++F+ NL+F      L + F  +   V  ++     P H +     GFG+ ++ + E
Sbjct: 295 PSDTLFLGNLSFEADRDNLYEIFGKYGEIVSVRI-----PTHPETEQPKGFGYVQYGSIE 349

Query: 699 QANAVISALDGTVIDGHRIQLKLS 722
            A      L G  I+   ++L  S
Sbjct: 350 DATKAFEGLQGEYINNRPVRLDYS 373

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 47/98 (47%), Gaps = 6/98 (6%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  + ++  ++  +  F P G +    V  +  T +S+G+ Y+ F+D   A +A  E+
Sbjct: 198 IFVGRLSWSIDDEWLKTEFEPIGGVISARVMYERGTDRSRGYGYVDFEDKSYAEKAIKEM 257

Query: 389 DKQIFQGRLLHI-----LPADAKKSHRLDEF-DLKNMP 420
             +   GR ++       PA A +  R  +F D+ + P
Sbjct: 258 HGKEIDGRPINCDMSTSKPAGAPRDDRAKKFGDVPSEP 295

>YHR015W (MIP6) [2301] chr8 (134546..136525) Protein with similarity
           to Pes4p and Pab1p in the N-terminal region, contains
           four RNA recognition (RRM) domains [1980 bp, 659 aa]
          Length = 659

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 122/295 (41%), Gaps = 41/295 (13%)

Query: 320 MEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPK 379
           + K SKT  LF+ N+  T TE+  RK+F  +   E   V  D  T KS G+ Y+ FKD  
Sbjct: 104 ITKTSKTNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKKSLGYGYLNFKDKN 163

Query: 380 EAVQAYIELDKQIFQGRLLHILPADAKKSHRLD---EFDLKNMPLKKQRELKKKDNASRQ 436
           +A  A  E +  +F G+ + I+P+      R +        N+PL         +N    
Sbjct: 164 DAESARKEFNYTVFFGQEVKIMPSMKNTLFRKNIGTNVFFSNLPL---------ENPQLT 214

Query: 437 TFSWNSLYMNQDAVLGSVAAK---LGLKKSDLIDPESSNSAVK----------QALAEAH 483
           T S+  + +    VL  +  +   +G    D  +  S+ + +K          + +   H
Sbjct: 215 TRSFYLIMIEYGNVLSCLLERRKNIGFVYFD--NDISARNVIKKYNNQEFFGNKIICGLH 272

Query: 484 IIGDVR------KYFESKGVDLTK----FAQTKSPEQRDAKVILVKNFPYGTTREEIGEL 533
              +VR      K  +  G D+       A     +   +K ILVKN P  TT+EE+ + 
Sbjct: 273 FDKEVRTRPEFTKRKKMIGSDIVIEDELLASNNLSDNARSKTILVKNLPSDTTQEEVLDY 332

Query: 534 FLPFGKLKRLLMPP----SGTIAIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKG 584
           F   G +K + +      +   A V Y++    + A   L    FK+  I++  G
Sbjct: 333 FSTIGPIKSVFISEKQANTPHKAFVTYKNEEESKKAQKCLNKTIFKNHTIWVGPG 387

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 68/178 (38%), Gaps = 21/178 (11%)

Query: 640 TVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQ 699
           T S+FI NL  T T   L K FK +  F  A+V      K      S+G+G+  F+ K  
Sbjct: 110 TNSLFIGNLKSTVTEEMLRKIFKRYQSFESAKVCRDFLTKK-----SLGYGYLNFKDKND 164

Query: 700 ANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFE---ATRK 756
           A +     + TV  G  +++  S +    NT                 NLP E    T +
Sbjct: 165 AESARKEFNYTVFFGQEVKIMPSMK----NT----LFRKNIGTNVFFSNLPLENPQLTTR 216

Query: 757 DVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814
             + +   +G + S  + ++     +   FV F     A N + +       G +++ 
Sbjct: 217 SFYLIMIEYGNVLSCLLERR-----KNIGFVYFDNDISARNVIKKYNNQEFFGNKIIC 269

>Sklu_1879.4 YGR159C, Contig c1879 3400-4665 reverse complement
          Length = 421

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 85/185 (45%), Gaps = 11/185 (5%)

Query: 638 GPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTK 697
           G   +IF+  L+++     L   F    G V A+V  +   + +D+  S G+G+ +F  K
Sbjct: 170 GEPATIFVGRLSWSIDDEWLKTEFDHIGGVVSARVIYE---RGSDR--SRGYGYVDFEDK 224

Query: 698 EQANAVISALDGTVIDGHRIQLKLSHRQGSS-----NTTXXXXXXXXXXXXXXXXNLPFE 752
             A   +  + G  IDG  I   +S  + ++                        NL F 
Sbjct: 225 HYAEKAVKEMHGKEIDGRPINCDMSTSKPAAAPRDDRAKKFGDVPSQPSDTLFLGNLSFN 284

Query: 753 ATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLQGVHLLGRR 811
           A R ++FE+F+  G++ SVR+P   + +  +GF +V++    +A+ A + LQG ++  R 
Sbjct: 285 ADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEALQGEYIDNRP 344

Query: 812 LVMQY 816
           + + Y
Sbjct: 345 VRLDY 349

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 5/88 (5%)

Query: 635 VADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEF 694
           V   P+ ++F+ NL+F      L + F      +  ++     P H +     GFG+ ++
Sbjct: 268 VPSQPSDTLFLGNLSFNADRDNLFEIFSQHGEVISVRI-----PTHPETEQPKGFGYVQY 322

Query: 695 RTKEQANAVISALDGTVIDGHRIQLKLS 722
            + + A     AL G  ID   ++L  S
Sbjct: 323 GSIDDAKKAFEALQGEYIDNRPVRLDYS 350

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 34/72 (47%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LFL N+ +    D+  ++F   GE+  V +     T + KGF Y+ +    +A +A+  L
Sbjct: 276 LFLGNLSFNADRDNLFEIFSQHGEVISVRIPTHPETEQPKGFGYVQYGSIDDAKKAFEAL 335

Query: 389 DKQIFQGRLLHI 400
             +    R + +
Sbjct: 336 QGEYIDNRPVRL 347

>CAGL0L11792g 1259275..1261014 highly similar to sp|P04147
           Saccharomyces cerevisiae YER165w PAB1 mRNA
           polyadenylate-binding protein, start by similarity
          Length = 579

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 95/225 (42%), Gaps = 17/225 (7%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           +IFIKNL+    +  L   F  F   + ++V T    K      S GFG+  F   E A+
Sbjct: 124 NIFIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGK------SKGFGYVHFEEDESAS 177

Query: 702 AVISALDGTVIDGHRIQL--KLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVF 759
             I AL+G +++G  I +   LS ++  S                   N+  E T K+  
Sbjct: 178 EAIDALNGMLLNGQEIYVGPHLSKKERES----KFEEMKANFTNVYIKNINTETTDKEFE 233

Query: 760 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM----- 814
           EL   FG+  SV + +  +   +GF FV F+  ++A   +++L      G+ L +     
Sbjct: 234 ELVAKFGKTDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQK 293

Query: 815 QYXXXXXXXXXXXXXRMTKKVKKQVVSSELAALRNSGGRKKLELE 859
           +Y             RM K  K Q ++  +  L +S   KKLE E
Sbjct: 294 KYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDSIDDKKLEEE 338

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 51/93 (54%), Gaps = 3/93 (3%)

Query: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           MEK++K     LF++N+  +  +    + F P+G +    V + T  GKSKGF ++ F  
Sbjct: 310 MEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKV-MTTENGKSKGFGFVCFST 368

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410
           P+EA +A  E ++QI  G+ L++  A  K   R
Sbjct: 369 PEEATKAITEKNQQIVAGKPLYVAIAQRKDVRR 401

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 90/405 (22%), Positives = 157/405 (38%), Gaps = 46/405 (11%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           +  L++ ++  + +E     +F P G +  + V  D  T  S G+AY+ F D   A  A 
Sbjct: 34  SASLYVGDLDPSVSEAHLYDIFSPIGAVSSIRVCRDAITKTSLGYAYVNFNDHDAAKTAI 93

Query: 386 IELDKQIFQGRLLHILPADAKKSHR---LDEFDLKNMPLKKQRELKKKDNASRQTFSWNS 442
            +L+    +G+L  I+ +    S R        +KN+      ++  K  A   TFS   
Sbjct: 94  EKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNIFIKNL----HPDIDNK--ALYDTFSVFG 147

Query: 443 LYMNQDAVLGSVAAKLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKF 502
             ++            G       + ES++ A+  AL    ++     Y    G  L+K 
Sbjct: 148 NILSSKVATDETGKSKGFGYVHFEEDESASEAI-DAL-NGMLLNGQEIYV---GPHLSKK 202

Query: 503 AQTKSPEQRDAKV--ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTT 560
            +    E+  A    + +KN    TT +E  EL   FGK          T ++V  R   
Sbjct: 203 ERESKFEEMKANFTNVYIKNINTETTDKEFEELVAKFGK----------TDSVVLERTPE 252

Query: 561 SGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVVEVKDTVKEIMD 620
                F  + F   +D +  +E+     F    +P  +  A    E   E+K        
Sbjct: 253 GENKGFGFVNFVNHEDAVKCVEELNNTEF--KGQPLYVNRAQKKYERQQELKKQY----- 305

Query: 621 STDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKH 680
                  E    E +A    +++FIKNL+ +    +L + F  +     A+V T  + K 
Sbjct: 306 -------EATRMEKMAKYQGINLFIKNLDDSIDDKKLEEEFAPYGTITSAKVMTTENGK- 357

Query: 681 ADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725
                S GFGF  F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 358 -----SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 83/195 (42%), Gaps = 29/195 (14%)

Query: 626 SNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTL 685
           +NEE++ E V    + S+++ +L+ + +   L   F       V+ ++   D   A    
Sbjct: 24  TNEENQSETV----SASLYVGDLDPSVSEAHLYDIFSPIG--AVSSIRVCRD---AITKT 74

Query: 686 SMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHR------QGSSNTTXXXXXXXX 739
           S+G+ +  F   + A   I  L+ T I G   ++  S R      +G+ N          
Sbjct: 75  SLGYAYVNFNDHDAAKTAIEKLNFTPIKGKLCRIMWSQRDPSLRKKGAGNI--------- 125

Query: 740 XXXXXXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAM 799
                   NL  +   K +++ F+ FG + S +V       ++GF +V F   + A  A+
Sbjct: 126 -----FIKNLHPDIDNKALYDTFSVFGNILSSKVATDETGKSKGFGYVHFEEDESASEAI 180

Query: 800 DQLQGVHLLGRRLVM 814
           D L G+ L G+ + +
Sbjct: 181 DALNGMLLNGQEIYV 195

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 70/182 (38%), Gaps = 14/182 (7%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
            +++IKN+N  TT  E  +    F       ++  P+ ++       GFGF  F   E A
Sbjct: 216 TNVYIKNINTETTDKEFEELVAKFGKTDSVVLERTPEGENK------GFGFVNFVNHEDA 269

Query: 701 NAVISALDGTVIDG-----HRIQLKLSHRQ---GSSNTTXXXXXXXXXXXXXXXXNLPFE 752
              +  L+ T   G     +R Q K   +Q        T                NL   
Sbjct: 270 VKCVEELNNTEFKGQPLYVNRAQKKYERQQELKKQYEATRMEKMAKYQGINLFIKNLDDS 329

Query: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
              K + E F  +G + S +V    +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 330 IDDKKLEEEFAPYGTITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389

Query: 813 VM 814
            +
Sbjct: 390 YV 391

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 40  TDVKIL-RNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAK 89
           TD  +L R  EGE++ F F+ + N EDA   V   N +      L V+ A+
Sbjct: 242 TDSVVLERTPEGENKGFGFVNFVNHEDAVKCVEELNNTEFKGQPLYVNRAQ 292

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (50%)

Query: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAK 89
           IT  K++    G+S+ F F+ +   E+A  A+   N   +    L V++A+
Sbjct: 345 ITSAKVMTTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQ 395

>AGR122C [4433] [Homologous to ScYER165W (PAB1) - SH]
           (978634..980391) [1758 bp, 585 aa]
          Length = 585

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 76/173 (43%), Gaps = 8/173 (4%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           +I+IKNL+    +  L + F TF   +  +V T       +  +S GFGF  F  +  A 
Sbjct: 127 NIYIKNLHPAIDNKSLHETFSTFGNILSCKVATD------ENGVSRGFGFVHFENESDAR 180

Query: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFEL 761
             I A+DG +++   + + L       +                  N+  E ++++  EL
Sbjct: 181 DAIEAVDGMLMNDQEVYVAL--HVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEEL 238

Query: 762 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814
           F  +G++ S  + K  +   RGF FV F     A  A+D+L  +   G++L +
Sbjct: 239 FGKYGKITSAVLEKDSEGKLRGFGFVNFEDHAAAAKAVDELNELEFKGQKLYV 291

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 53/93 (56%), Gaps = 3/93 (3%)

Query: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +EK++K     LF++N+  +  ++  ++ F PFG +    V  D  TG S+GF ++ F  
Sbjct: 313 LEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITSAKVMRD-ETGNSRGFGFVCFST 371

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410
           P+EA +A  E ++QI  G+ L++  A  K+  R
Sbjct: 372 PEEATKAITEKNQQIVAGKPLYVAIAQRKEVRR 404

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 88/417 (21%), Positives = 160/417 (38%), Gaps = 61/417 (14%)

Query: 322 KISKTG-RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKE 380
           K+  +G  L++  +  T +E     +F P G +  + V  D  T  S G+AY+ F D + 
Sbjct: 32  KVETSGASLYVGELEPTVSEALLYDIFSPIGSVSSIRVCRDAITNTSLGYAYVNFHDHEA 91

Query: 381 AVQAYIELDKQIFQGRLLHILPADAKKSHR---LDEFDLKNMPLKKQRELKKKDNAS-RQ 436
             +A  +L+  + +G+   I+ +    S R        +KN+           DN S  +
Sbjct: 92  GPKAIEQLNYTLIKGKPCRIMWSQRDPSLRKKGSGNIYIKNL-------HPAIDNKSLHE 144

Query: 437 TFSWNSLYMNQDAVLGSVAAKLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKG 496
           TFS     ++            G       +   +  A++    +  ++ D   Y     
Sbjct: 145 TFSTFGNILSCKVATDENGVSRGFGFVHFENESDARDAIE--AVDGMLMNDQEVYV---A 199

Query: 497 VDLTKFAQTKSPEQRDAKV--ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSG----- 549
           + ++K  +    E+  AK   + VKN    T++EE  ELF  +GK+   ++         
Sbjct: 200 LHVSKKDRQSKLEEVKAKFTNVYVKNIDQETSQEEFEELFGKYGKITSAVLEKDSEGKLR 259

Query: 550 TIAIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVV 609
               V + D  +   A  +L    FK   +Y+ +  K                   E + 
Sbjct: 260 GFGFVNFEDHAAAAKAVDELNELEFKGQKLYVGRAQKKY-----------------ERLQ 302

Query: 610 EVKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVV 669
           E+K               E    E +A    V++F+KNL+ +    +L + F  F     
Sbjct: 303 ELKKQY------------EAARLEKLAKYQGVNLFVKNLDDSIDDEKLKEEFAPFGTITS 350

Query: 670 AQVKTKPDPKHADKTL-SMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725
           A+V         D+T  S GFGF  F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 351 AKVMR-------DETGNSRGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400

 Score = 37.0 bits (84), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 11/86 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + VK L   + D+ LK+ F           P  + IT  K++R+  G SR F F+ +   
Sbjct: 324 LFVKNLDDSIDDEKLKEEFA----------PFGT-ITSAKVMRDETGNSRGFGFVCFSTP 372

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89
           E+A  A+   N   +    L V++A+
Sbjct: 373 EEATKAITEKNQQIVAGKPLYVAIAQ 398

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%)

Query: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSFAD 93
           I   K+  +  G SR F F+ + NE DA DA+   +G  +N  ++ V++  S  D
Sbjct: 152 ILSCKVATDENGVSRGFGFVHFENESDARDAIEAVDGMLMNDQEVYVALHVSKKD 206

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 760 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAM 799
           E F  FG + S +V +    ++RGF FV F  P+EA  A+
Sbjct: 340 EEFAPFGTITSAKVMRDETGNSRGFGFVCFSTPEEATKAI 379

>Sklu_2442.11 YNL004W, Contig c2442 20113-21507 reverse complement
          Length = 464

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 78/211 (36%), Gaps = 36/211 (17%)

Query: 636 ADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFR 695
           A  P   +FI NL ++     L   FK     + A VK   D        S G+G   ++
Sbjct: 256 ASAPGYEVFIANLPYSVNWQALKDMFKECGDVLRADVKLDRD------GYSRGYGVVYYK 309

Query: 696 TKEQANAVIS-----ALDGTVIDGHRIQLKLS-------------------------HRQ 725
           TKE+    I       L+G V+D H  +L  +                         H  
Sbjct: 310 TKEEVQVAIERYNGYELEGRVLDVHEGKLGPASEHQQQQEQFQPQDDEPVLDFAPQIHES 369

Query: 726 GSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFA 785
            ++  T                NLP+   + D+F+LF + G++    +   ++    G A
Sbjct: 370 LNTEFTEMATGGGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGAA 429

Query: 786 FVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
            VE+  P +AE  + +L   +  GR L + Y
Sbjct: 430 VVEYDNPADAEVCISRLNSYNYGGRDLDISY 460

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 36/176 (20%), Positives = 63/176 (35%), Gaps = 12/176 (6%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           SIF+ NL +     +L + F      V A + T        +    G G  EF   +  +
Sbjct: 163 SIFVGNLTYDCQPEDLKEYFSQIGEVVRADIITS-------RGHHRGMGTVEFTNADDVD 215

Query: 702 AVISALDGTVIDGHRIQLKLSHRQGSS-----NTTXXXXXXXXXXXXXXXXNLPFEATRK 756
             I   DG+ +    I ++  +    S                        NLP+    +
Sbjct: 216 EAIRRFDGSTLLDREIFVRQDNPPPESMRAPPRERRPRIQASAPGYEVFIANLPYSVNWQ 275

Query: 757 DVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
            + ++F   G +    V    D  +RG+  V +   +E + A+++  G  L GR L
Sbjct: 276 ALKDMFKECGDVLRADVKLDRDGYSRGYGVVYYKTKEEVQVAIERYNGYELEGRVL 331

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE- 387
           +F+ N+ Y+      + +F   G++    V LD R G S+G+  + +K  KE VQ  IE 
Sbjct: 263 VFIANLPYSVNWQALKDMFKECGDVLRADVKLD-RDGYSRGYGVVYYK-TKEEVQVAIER 320

Query: 388 LDKQIFQGRLLHI 400
            +    +GR+L +
Sbjct: 321 YNGYELEGRVLDV 333

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 35/76 (46%), Gaps = 7/76 (9%)

Query: 500 TKFAQTKSPEQRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLLM------PPSGTIAI 553
           T+F +  +     +  I V N P+ T + ++ +LF   GK+ R  +       PSG  A+
Sbjct: 372 TEFTEMATGGGDQSSTIFVDNLPWSTAQSDLFDLFETIGKVNRAELKFAYNGKPSGA-AV 430

Query: 554 VEYRDTTSGRSAFTKL 569
           VEY +        ++L
Sbjct: 431 VEYDNPADAEVCISRL 446

>Scas_576.7
          Length = 575

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 75/168 (44%), Gaps = 12/168 (7%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           +IFIKNL+    +  L + F  F   + +++ T    K      S GFGF  F  +  A 
Sbjct: 124 NIFIKNLHPDIDNKALFETFSVFGNILSSKIATDETGK------SKGFGFVHFEHESSAK 177

Query: 702 AVISALDGTVIDGHRIQL--KLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVF 759
             I AL+G +++G  I +   L+ ++  S                   N+  E T ++  
Sbjct: 178 EAIDALNGMLLNGQEIYVAPHLTRKERDSQL----EETKAHFTNVYVKNINLETTDEEFN 233

Query: 760 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           ELF  +G + S  + K  D   +GF FV+F   ++A  A+++L G   
Sbjct: 234 ELFAKYGNVLSSSLEKTEDGKLKGFGFVDFEKHEDAAKAVEELNGTEF 281

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 3/93 (3%)

Query: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +EK++K     LF++N+  +  ++  ++ F P+G +  V V + T  GKSKGF ++ F  
Sbjct: 310 LEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRV-MRTDNGKSKGFGFVCFST 368

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410
           P+EA +A  E ++QI  G+ L++  A  K   R
Sbjct: 369 PEEATKAITEKNQQIVAGKPLYVAIAQRKDVRR 401

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 91/412 (22%), Positives = 159/412 (38%), Gaps = 66/412 (16%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           L++  +  T +E     +F P G +  + V  D  T  S G+AY+ F D +   +A  +L
Sbjct: 37  LYVGELDPTVSEALLYDIFSPIGSVSSIRVCRDAVTKTSLGYAYVNFNDHEAGKKAIEQL 96

Query: 389 DKQIFQGRLLHIL-----PADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSL 443
           +    +GRL  I+     PA  KK        +KN+           D  ++  F   S+
Sbjct: 97  NYTPIKGRLCRIMWSQRDPALRKKGS--GNIFIKNL---------HPDIDNKALFETFSV 145

Query: 444 YMNQDAVLGSVAAKLGLKKS---DLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLT 500
           + N   +L S  A     KS     +  E  +SA +   A   ++ + ++ + +    LT
Sbjct: 146 FGN---ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVAP--HLT 200

Query: 501 KFAQTKSPEQRDAKV--ILVKNFPYGTTREEIGELFLPFGKL--KRLLMPPSGTI---AI 553
           +  +    E+  A    + VKN    TT EE  ELF  +G +    L     G +     
Sbjct: 201 RKERDSQLEETKAHFTNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLKGFGF 260

Query: 554 VEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVVEVKD 613
           V++        A  +L    FKD  +++ +  K                   E + E+K 
Sbjct: 261 VDFEKHEDAAKAVEELNGTEFKDQTLFVSRAQKKY-----------------ERMQELKK 303

Query: 614 TVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVK 673
                         E    E +A    V++F+KNL+ +    +L + F  +      +V 
Sbjct: 304 QY------------EASRLEKMAKYQGVNLFVKNLDDSIDDEKLKEEFAPYGTITSVRV- 350

Query: 674 TKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725
                   D   S GFGF  F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 351 -----MRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 397

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 72/180 (40%), Gaps = 25/180 (13%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
            S+++  L+ T +   L   F       V+ ++   D   A    S+G+ +  F   E  
Sbjct: 35  ASLYVGELDPTVSEALLYDIFSPIGS--VSSIRVCRD---AVTKTSLGYAYVNFNDHEAG 89

Query: 701 NAVISALDGTVIDGHRIQLKLSHR------QGSSNTTXXXXXXXXXXXXXXXXNLPFEAT 754
              I  L+ T I G   ++  S R      +GS N                  NL  +  
Sbjct: 90  KKAIEQLNYTPIKGRLCRIMWSQRDPALRKKGSGNI--------------FIKNLHPDID 135

Query: 755 RKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814
            K +FE F+ FG + S ++       ++GF FV F     A+ A+D L G+ L G+ + +
Sbjct: 136 NKALFETFSVFGNILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYV 195

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 74/182 (40%), Gaps = 14/182 (7%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
            ++++KN+N  TT  E ++ F  +   + + ++   D K        GFGF +F   E A
Sbjct: 216 TNVYVKNINLETTDEEFNELFAKYGNVLSSSLEKTEDGKLK------GFGFVDFEKHEDA 269

Query: 701 NAVISALDGT-----VIDGHRIQLKLSHRQ---GSSNTTXXXXXXXXXXXXXXXXNLPFE 752
              +  L+GT      +   R Q K    Q        +                NL   
Sbjct: 270 AKAVEELNGTEFKDQTLFVSRAQKKYERMQELKKQYEASRLEKMAKYQGVNLFVKNLDDS 329

Query: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
              + + E F  +G + SVRV +  +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 330 IDDEKLKEEFAPYGTITSVRVMRTDNGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 389

Query: 813 VM 814
            +
Sbjct: 390 YV 391

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           +G +F++N+          + F  FG +    +A D  TGKSKGF ++ F+    A +A 
Sbjct: 122 SGNIFIKNLHPDIDNKALFETFSVFGNILSSKIATD-ETGKSKGFGFVHFEHESSAKEAI 180

Query: 386 IELDKQIFQGRLLHILPADAKK 407
             L+  +  G+ +++ P   +K
Sbjct: 181 DALNGMLLNGQEIYVAPHLTRK 202

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 11/86 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + VK L   + D+ LK+ F           P  + IT V+++R   G+S+ F F+ +   
Sbjct: 321 LFVKNLDDSIDDEKLKEEFA----------PYGT-ITSVRVMRTDNGKSKGFGFVCFSTP 369

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89
           E+A  A+   N   +    L V++A+
Sbjct: 370 EEATKAITEKNQQIVAGKPLYVAIAQ 395

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%)

Query: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVS 86
           I   KI  +  G+S+ F F+ + +E  A +A++  NG  +N  ++ V+
Sbjct: 149 ILSSKIATDETGKSKGFGFVHFEHESSAKEAIDALNGMLLNGQEIYVA 196

>Kwal_56.23486
          Length = 587

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 53/93 (56%), Gaps = 3/93 (3%)

Query: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           MEK++K     LF++N+  +  ++  ++ F PFG +  V V  D   G SKGF ++ F  
Sbjct: 315 MEKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFGTITSVKVMRDD-AGSSKGFGFVCFST 373

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410
           P+EA +A  E ++QI  G+ L++  A  K+  R
Sbjct: 374 PEEATKAITEKNQQIVAGKPLYVAIAQRKEVRR 406

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 52/98 (53%), Gaps = 9/98 (9%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++++NI   T +D+F KLF  +G +    +  D   GK +GF ++ F+D   A +A  EL
Sbjct: 223 VYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNE-GKLRGFGFVNFEDHNAAAKAVEEL 281

Query: 389 DKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRE 426
           +   F G+ L++  A  KK  RL E       LKKQ E
Sbjct: 282 NDTDFNGQKLYVGRAQ-KKYERLQE-------LKKQYE 311

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 73/182 (40%), Gaps = 14/182 (7%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
            ++++KN++  T   E  K F  +     A ++T  + K        GFGF  F     A
Sbjct: 221 TNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDNEGK------LRGFGFVNFEDHNAA 274

Query: 701 NAVISALDGTVIDGHRIQL--------KLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFE 752
              +  L+ T  +G ++ +        +L   +    ++                NL   
Sbjct: 275 AKAVEELNDTDFNGQKLYVGRAQKKYERLQELKKQYESSRMEKLAKYQGVNLFVKNLDDS 334

Query: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
              + + E F  FG + SV+V +    S++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 335 IDDEKLQEEFAPFGTITSVKVMRDDAGSSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394

Query: 813 VM 814
            +
Sbjct: 395 YV 396

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%)

Query: 324 SKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQ 383
           + +  L++  +  + TE     LF P G +  + V  D  T  S G+AY+ F D      
Sbjct: 37  ASSASLYVGELDPSVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHNAGTT 96

Query: 384 AYIELDKQIFQGRLLHIL 401
           A  +L+    +GR   I+
Sbjct: 97  AIEKLNYTPIKGRPCRIM 114

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 6/93 (6%)

Query: 633 EHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFA 692
           E +A    V++F+KNL+ +    +L + F  F    +  VK   D    D   S GFGF 
Sbjct: 316 EKLAKYQGVNLFVKNLDDSIDDEKLQEEFAPFG--TITSVKVMRD----DAGSSKGFGFV 369

Query: 693 EFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725
            F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 370 CFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 50/215 (23%), Positives = 81/215 (37%), Gaps = 43/215 (20%)

Query: 618 IMDSTDKTSNEEHEDEHVAD----GPT-------------VSIFIKNLNFTTTSVELSKR 660
           + D TDKT+ E+ E   + D    GPT              S+++  L+ + T   L   
Sbjct: 1   MSDVTDKTA-EQLEQLRIQDEQPTGPTSTDSESTKGEASSASLYVGELDPSVTEALLYDL 59

Query: 661 FKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK 720
           F       V+ ++   D   A    S+G+ +  F         I  L+ T I G   ++ 
Sbjct: 60  FSPIGS--VSSIRVCRD---AITKTSLGYAYVNFHDHNAGTTAIEKLNYTPIKGRPCRIM 114

Query: 721 LSHR------QGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFELFNSFGQLKSVRVP 774
            S R      +GS N                  NL      K + + F+ FG + S ++ 
Sbjct: 115 WSQRDPSLRKKGSGNV--------------FIKNLHPAIDNKALHDTFSVFGNILSCKIA 160

Query: 775 KKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLG 809
                 +R F FV F   + A+ A+D + G+ L G
Sbjct: 161 TDETGKSRKFGFVHFEEEEAAKEAIDAINGMLLNG 195

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 41/86 (47%), Gaps = 11/86 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + VK L   + D+ L++ F           P  + IT VK++R+  G S+ F F+ +   
Sbjct: 326 LFVKNLDDSIDDEKLQEEFA----------PFGT-ITSVKVMRDDAGSSKGFGFVCFSTP 374

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89
           E+A  A+   N   +    L V++A+
Sbjct: 375 EEATKAITEKNQQIVAGKPLYVAIAQ 400

 Score = 33.5 bits (75), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 55/114 (48%), Gaps = 11/114 (9%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           +G +F++N+            F  FG +    +A D  TGKS+ F ++ F++ + A +A 
Sbjct: 127 SGNVFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-ETGKSRKFGFVHFEEEEAAKEAI 185

Query: 386 IELDKQIFQGRLLHILPADAKK--SHRLDEFD-------LKNM-PLKKQRELKK 429
             ++  +  G  +++ P  +KK    +LDE         +KN+ P  KQ E +K
Sbjct: 186 DAINGMLLNGLEVYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEK 239

>YER165W (PAB1) [1593] chr5 (510368..512101) Poly(A)-binding protein
           of cytoplasm and nucleus, part of the 3'-end
           RNA-processing complex (cleavage factor I), involved in
           translation termination with Sup35p, has 4 RNA
           recognition (RRM) domains [1734 bp, 577 aa]
          Length = 577

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 76/175 (43%), Gaps = 12/175 (6%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           +IFIKNL+    +  L   F  F   + +++ T  + K      S GFGF  F  +  A 
Sbjct: 127 NIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENGK------SKGFGFVHFEEEGAAK 180

Query: 702 AVISALDGTVIDGHRIQL--KLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVF 759
             I AL+G +++G  I +   LS ++  S                   N+  E T +   
Sbjct: 181 EAIDALNGMLLNGQEIYVAPHLSRKERDSQL----EETKAHYTNLYVKNINSETTDEQFQ 236

Query: 760 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814
           ELF  FG + S  + K  D   +GF FV +   ++A  A++ L    L G +L +
Sbjct: 237 ELFAKFGPIVSASLEKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYV 291

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 52/93 (55%), Gaps = 3/93 (3%)

Query: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +EK++K     LF++N+  +  ++   + F P+G +    V + T  GKSKGF ++ F  
Sbjct: 313 LEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKV-MRTENGKSKGFGFVCFST 371

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410
           P+EA +A  E ++QI  G+ L++  A  K   R
Sbjct: 372 PEEATKAITEKNQQIVAGKPLYVAIAQRKDVRR 404

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 76/182 (41%), Gaps = 14/182 (7%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
            ++++KN+N  TT  +  + F  F   V A ++     K AD  L  GFGF  +   E A
Sbjct: 219 TNLYVKNINSETTDEQFQELFAKFGPIVSASLE-----KDADGKLK-GFGFVNYEKHEDA 272

Query: 701 NAVISALDGTVIDGHRIQLKLSHRQG--------SSNTTXXXXXXXXXXXXXXXXNLPFE 752
              + AL+ + ++G ++ +  + ++                              NL   
Sbjct: 273 VKAVEALNDSELNGEKLYVGRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDS 332

Query: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
              + + E F  +G + S +V +  +  ++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 333 VDDEKLEEEFAPYGTITSAKVMRTENGKSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 392

Query: 813 VM 814
            +
Sbjct: 393 YV 394

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           +  L++ ++  + +E     +F P G +  + V  D  T  S G+AY+ F D +   +A 
Sbjct: 37  SASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAI 96

Query: 386 IELDKQIFQGRLLHIL 401
            +L+    +GRL  I+
Sbjct: 97  EQLNYTPIKGRLCRIM 112

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 1/82 (1%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           +G +F++N+            F  FG++    +A D   GKSKGF ++ F++   A +A 
Sbjct: 125 SGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATD-ENGKSKGFGFVHFEEEGAAKEAI 183

Query: 386 IELDKQIFQGRLLHILPADAKK 407
             L+  +  G+ +++ P  ++K
Sbjct: 184 DALNGMLLNGQEIYVAPHLSRK 205

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 624 KTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADK 683
           K   E +  E +A    V++F+KNL+ +    +L + F  +     A+V    + K    
Sbjct: 305 KKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENGK---- 360

Query: 684 TLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725
             S GFGF  F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 361 --SKGFGFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 400

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 39/88 (44%), Gaps = 11/88 (12%)

Query: 2   SRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYH 61
           + + VK + S  TD+  ++ F K              I    + ++ +G+ + F F+ Y 
Sbjct: 219 TNLYVKNINSETTDEQFQELFAKF-----------GPIVSASLEKDADGKLKGFGFVNYE 267

Query: 62  NEEDAFDAVNYFNGSYINTAKLEVSMAK 89
             EDA  AV   N S +N  KL V  A+
Sbjct: 268 KHEDAVKAVEALNDSELNGEKLYVGRAQ 295

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 11/86 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + VK L   + D+ L++ F           P  + IT  K++R   G+S+ F F+ +   
Sbjct: 324 LFVKNLDDSVDDEKLEEEFA----------PYGT-ITSAKVMRTENGKSKGFGFVCFSTP 372

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89
           E+A  A+   N   +    L V++A+
Sbjct: 373 EEATKAITEKNQQIVAGKPLYVAIAQ 398

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 758 VFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGR 810
           ++++F+  G + S+RV +    K++ G+A+V F   +    A++QL    + GR
Sbjct: 54  LYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAIEQLNYTPIKGR 107

>Scas_701.3
          Length = 321

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 40/60 (66%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  + Y TTE + +KLF  FGE+E++ +  D  T KSKG+A+I+F DP  +  A+ E+
Sbjct: 108 IFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEI 167

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 43/70 (61%), Gaps = 4/70 (5%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQL---QG 804
           LP++ T  ++ +LF  FG+++ +R+ + K    ++G+AF+ FL P  ++ A  ++   +G
Sbjct: 113 LPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFKEIGVHRG 172

Query: 805 VHLLGRRLVM 814
           + + GR  ++
Sbjct: 173 IDIKGRTCIV 182

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 514 KVILVKNFPYGTTREEIGELFLPFGKLKRL------LMPPSGTIAIVEYRDTTSGRSAFT 567
           + I +   PY TT  E+ +LF+ FG+++++      L   S   A + + D  S + AF 
Sbjct: 106 RTIFIGRLPYDTTELELQKLFVKFGEIEKIRIVRDKLTNKSKGYAFIVFLDPMSSKMAFK 165

Query: 568 KLAFKR 573
           ++   R
Sbjct: 166 EIGVHR 171

>KLLA0C17600g 1553322..1555100 similar to sp|P04147 Saccharomyces
           cerevisiae YER165w PAB1 mRNA polyadenylate-binding
           protein, start by similarity
          Length = 592

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 74/163 (45%), Gaps = 8/163 (4%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           +IFIKNL+    +  L + F TF   +  +V         +   S GFGF  F+ +  A 
Sbjct: 139 NIFIKNLHPAIDNKALHETFSTFGEVLSCKVALD------ENGNSRGFGFVHFKEESDAK 192

Query: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFEL 761
             I A++G +++G  +++ ++      +                  N+  E T ++  +L
Sbjct: 193 DAIEAVNGMLMNG--LEVYVAMHVPKKDRISKLEEAKANFTNIYVKNIDVETTDEEFEQL 250

Query: 762 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQG 804
           F+ +G++ S  + K  +   +GF FV F+    A  A+++L G
Sbjct: 251 FSQYGEIVSAALEKDAEGKPKGFGFVNFVDHNAAAKAVEELNG 293

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 52/93 (55%), Gaps = 3/93 (3%)

Query: 320 MEKISK--TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +EK++K     LF++N+  +  ++  ++ F P+G +    V  D + G SKGF ++ F  
Sbjct: 325 LEKLAKFQGVNLFIKNLDDSIDDEKLKEEFAPYGTITSARVMRD-QEGNSKGFGFVCFSS 383

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410
           P+EA +A  E ++QI  G+ L++  A  K   R
Sbjct: 384 PEEATKAMTEKNQQIVAGKPLYVAIAQRKDVRR 416

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 91/415 (21%), Positives = 157/415 (37%), Gaps = 72/415 (17%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           L++  +    TE     +F P G +  + V  D  T  S G+AY+ + D +   +A  EL
Sbjct: 52  LYVGELDPNITEALLYDVFSPLGPISSIRVCRDAVTKASLGYAYVNYTDYEAGKKAIQEL 111

Query: 389 DKQIFQGRLLHIL-----PADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSL 443
           +     GR   I+     PA  KK        +KN+           + A  +TFS    
Sbjct: 112 NYAEINGRPCRIMWSERDPAIRKKGS--GNIFIKNL------HPAIDNKALHETFSTFGE 163

Query: 444 YMNQDAVLGSVAAKLGL------KKSDLIDP-ESSNSAVKQALAEAHIIGDVRKYFESKG 496
            ++    L       G       ++SD  D  E+ N  +   L E ++   V      K 
Sbjct: 164 VLSCKVALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGL-EVYVAMHV-----PKK 217

Query: 497 VDLTKFAQTKSPEQRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLLM------PPSGT 550
             ++K  + K+    +   I VKN    TT EE  +LF  +G++    +       P G 
Sbjct: 218 DRISKLEEAKA----NFTNIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGKPKG- 272

Query: 551 IAIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVVE 610
              V + D  +   A  +L  K FK   +Y+ +  K                   E   E
Sbjct: 273 FGFVNFVDHNAAAKAVEELNGKEFKSQALYVGRAQKKY-----------------ERAEE 315

Query: 611 VKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVA 670
           +K               E++  E +A    V++FIKNL+ +    +L + F  +     A
Sbjct: 316 LKKQY------------EQYRLEKLAKFQGVNLFIKNLDDSIDDEKLKEEFAPYGTITSA 363

Query: 671 QVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725
           +V    +        S GFGF  F + E+A   ++  +  ++ G  + + ++ R+
Sbjct: 364 RVMRDQEGN------SKGFGFVCFSSPEEATKAMTEKNQQIVAGKPLYVAIAQRK 412

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFK---DPKEAV 382
           +G +F++N+          + F  FGE+    VALD   G S+GF ++ FK   D K+A+
Sbjct: 137 SGNIFIKNLHPAIDNKALHETFSTFGEVLSCKVALD-ENGNSRGFGFVHFKEESDAKDAI 195

Query: 383 QA 384
           +A
Sbjct: 196 EA 197

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 38/182 (20%), Positives = 69/182 (37%), Gaps = 14/182 (7%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
            +I++KN++  TT  E  + F  +   V A ++   + K        GFGF  F     A
Sbjct: 231 TNIYVKNIDVETTDEEFEQLFSQYGEIVSAALEKDAEGK------PKGFGFVNFVDHNAA 284

Query: 701 NAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXX--------XNLPFE 752
              +  L+G       + +  + ++                              NL   
Sbjct: 285 AKAVEELNGKEFKSQALYVGRAQKKYERAEELKKQYEQYRLEKLAKFQGVNLFIKNLDDS 344

Query: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
              + + E F  +G + S RV +  + +++GF FV F  P+EA  AM +     + G+ L
Sbjct: 345 IDDEKLKEEFAPYGTITSARVMRDQEGNSKGFGFVCFSSPEEATKAMTEKNQQIVAGKPL 404

Query: 813 VM 814
            +
Sbjct: 405 YV 406

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSM 87
           +   K+  +  G SR F F+ +  E DA DA+   NG  +N  ++ V+M
Sbjct: 164 VLSCKVALDENGNSRGFGFVHFKEESDAKDAIEAVNGMLMNGLEVYVAM 212

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 11/86 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + +K L   + D+ LK+ F           P  + IT  +++R++EG S+ F F+ + + 
Sbjct: 336 LFIKNLDDSIDDEKLKEEFA----------PYGT-ITSARVMRDQEGNSKGFGFVCFSSP 384

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89
           E+A  A+   N   +    L V++A+
Sbjct: 385 EEATKAMTEKNQQIVAGKPLYVAIAQ 410

>Sklu_1715.1 YNL175C, Contig c1715 382-1572 reverse complement
          Length = 396

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           IAM K   +  LF+ N+ + TT++  RK F   GE+ +V +A    +GK KGFA+I FKD
Sbjct: 220 IAMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKD 279

Query: 378 PKEAVQAYIELDKQIFQGRLLHI 400
            K   +A  +   +   GR L +
Sbjct: 280 EKGPTEALTDKSCRKIAGRPLRM 302

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 59/132 (44%), Gaps = 4/132 (3%)

Query: 688 GFGFAEFRTKEQANAVISALDGTVIDGHRIQLK-LSHRQGSSNTTXXXXXXXXXXXXXX- 745
           GF + +F+ KEQ NAVI  L  + ++G  + +K  S  +G  +                 
Sbjct: 174 GFAYMDFKNKEQMNAVI-GLSESQLNGRNMLIKNSSSYEGRPDKNDLIAMSKNPPSRILF 232

Query: 746 XXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLQG 804
             NL F+ T + + + F   G++  VR+    D    +GFAF++F   K    A+     
Sbjct: 233 VGNLSFDTTDELLRKHFQHCGEIVKVRMATFQDSGKCKGFAFIDFKDEKGPTEALTDKSC 292

Query: 805 VHLLGRRLVMQY 816
             + GR L M++
Sbjct: 293 RKIAGRPLRMEF 304

>Sklu_1838.3 YER165W, Contig c1838 2462-4231 reverse complement
          Length = 589

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 50/93 (53%), Gaps = 3/93 (3%)

Query: 320 MEKISKTG--RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +EK++K     LF++N+  +  ++  R  F PFG +    V  D   G SKGF ++ F  
Sbjct: 315 LEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVMRDD-AGNSKGFGFVCFST 373

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410
           P+EA +A  E ++QI  G+ L++  A  K   R
Sbjct: 374 PEEATKAITEKNQQIVAGKPLYVAIAQRKDVRR 406

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 72/173 (41%), Gaps = 8/173 (4%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           +IFIKNL+    +  L   F  F   +  ++ T       +   S GFGF  F  +  A 
Sbjct: 129 NIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD------EAGNSKGFGFVHFEEEYSAK 182

Query: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFEL 761
             + A++G +++G  +   ++      +                  N+  E T+++   L
Sbjct: 183 EAVDAINGMLLNGQEV--YVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEAL 240

Query: 762 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814
           F  FG++ S  + +  +   RGF F+ F   + A  A+D+L       +RL +
Sbjct: 241 FTQFGKITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYV 293

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 57/101 (56%), Gaps = 9/101 (8%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++++NI   TT+++F  LF  FG++    +  D+  GK +GF +I F+D + A +A  EL
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSE-GKPRGFGFINFEDHESAAKAVDEL 281

Query: 389 DKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKK 429
           +   F+ + L++  A  KK  RL E       L+KQ E+ +
Sbjct: 282 NDTDFKSQRLYVGRAQ-KKYERLQE-------LRKQYEVSR 314

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 82/216 (37%), Gaps = 42/216 (19%)

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLM------PPSGTIAIVEYRDTTSGRSAFTKL 569
           I VKN    TT+EE   LF  FGK+   ++       P G    + + D  S   A  +L
Sbjct: 223 IYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGKPRG-FGFINFEDHESAAKAVDEL 281

Query: 570 AFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVVEVKDTVKEIMDSTDKTSNEE 629
               FK   +Y+ +  K                   E + E++               E 
Sbjct: 282 NDTDFKSQRLYVGRAQKKY-----------------ERLQELRKQY------------EV 312

Query: 630 HEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGF 689
              E +A    V++F+KNL+ +    +L   F  F     A+V         D   S GF
Sbjct: 313 SRLEKLAKYQGVNLFVKNLDDSIDDEKLRDEFAPFGAITSAKVM------RDDAGNSKGF 366

Query: 690 GFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQ 725
           GF  F T E+A   I+  +  ++ G  + + ++ R+
Sbjct: 367 GFVCFSTPEEATKAITEKNQQIVAGKPLYVAIAQRK 402

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%)

Query: 324 SKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQ 383
           + +  L++  +  T TE     LF P G +  + V  D  T  S G+AY+ F D      
Sbjct: 37  TSSASLYVGELDPTVTEALLYDLFSPIGSVSSIRVCRDAITKTSLGYAYVNFHDHDAGRT 96

Query: 384 AYIELDKQIFQGRLLHIL 401
           A  +L+    +GR   I+
Sbjct: 97  AIQKLNYTTIKGRPCRIM 114

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           +G +F++N+            F  FG +    +A D   G SKGF ++ F++   A +A 
Sbjct: 127 SGNIFIKNLHPAIDNKALHDTFSVFGNILSCKIATD-EAGNSKGFGFVHFEEEYSAKEAV 185

Query: 386 IELDKQIFQGRLLHILPADAKK 407
             ++  +  G+ +++ P  +KK
Sbjct: 186 DAINGMLLNGQEVYVAPHVSKK 207

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 39/182 (21%), Positives = 69/182 (37%), Gaps = 14/182 (7%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
            +I++KN++  TT  E    F  F     A ++   + K        GFGF  F   E A
Sbjct: 221 TNIYVKNIDLETTQEEFEALFTQFGKITSAVLERDSEGK------PRGFGFINFEDHESA 274

Query: 701 NAVISALDGTVIDGHRIQL--------KLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFE 752
              +  L+ T     R+ +        +L   +     +                NL   
Sbjct: 275 AKAVDELNDTDFKSQRLYVGRAQKKYERLQELRKQYEVSRLEKLAKYQGVNLFVKNLDDS 334

Query: 753 ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
              + + + F  FG + S +V +    +++GF FV F  P+EA  A+ +     + G+ L
Sbjct: 335 IDDEKLRDEFAPFGAITSAKVMRDDAGNSKGFGFVCFSTPEEATKAITEKNQQIVAGKPL 394

Query: 813 VM 814
            +
Sbjct: 395 YV 396

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 11/86 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + VK L   + D+ L+  F           P  + IT  K++R+  G S+ F F+ +   
Sbjct: 326 LFVKNLDDSIDDEKLRDEFA----------PFGA-ITSAKVMRDDAGNSKGFGFVCFSTP 374

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89
           E+A  A+   N   +    L V++A+
Sbjct: 375 EEATKAITEKNQQIVAGKPLYVAIAQ 400

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAK 89
           IT   + R+ EG+ R F FI + + E A  AV+  N +   + +L V  A+
Sbjct: 247 ITSAVLERDSEGKPRGFGFINFEDHESAAKAVDELNDTDFKSQRLYVGRAQ 297

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVS 86
           I   KI  +  G S+ F F+ +  E  A +AV+  NG  +N  ++ V+
Sbjct: 154 ILSCKIATDEAGNSKGFGFVHFEEEYSAKEAVDAINGMLLNGQEVYVA 201

>KLLA0F07799g complement(734889..736463) similar to sp|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, start by
           similarity
          Length = 524

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 3/103 (2%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ N+ +   E+   K F P G++E V +  D++T   KGFAY+ FKD +   +A +  
Sbjct: 361 VFVGNLDFEEVEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDFQSVSKALLLH 420

Query: 389 DKQIFQG---RLLHILPADAKKSHRLDEFDLKNMPLKKQRELK 428
           +K+I +G   R L I      +  + ++  L+N  L  Q+  K
Sbjct: 421 EKKIHEGKKARKLRISRCKNMRKAQGNQSSLQNNKLNDQQRTK 463

>YIL061C (SNP1) [2610] chr9 complement(244654..245556) U1
           snRNA-associated protein with RNA recognition (RRM)
           domain, homologous to human 70 kDa U1 snRNP protein [903
           bp, 300 aa]
          Length = 300

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  + Y   E + +K F  FGE+E++ +  D  T KSKG+A+I+FKDP  +  A+ E+
Sbjct: 109 IFIGRLPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI 168

 Score = 33.1 bits (74), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           LP++    ++ + F  FG+++ +R+ K K  + ++G+AF+ F  P  ++ A  ++ GVH
Sbjct: 114 LPYDLDEIELQKYFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEI-GVH 171

>KLLA0D08206g 700152..701327 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 391

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (58%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           LF+ N+ + TTED  RK F   GE+  + +A    TGK KGFA+I FKD   A  A
Sbjct: 229 LFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAFIDFKDETGATNA 284

 Score = 37.0 bits (84), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 84/210 (40%), Gaps = 32/210 (15%)

Query: 631 EDEHVADGPT----VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVK------------- 673
           E+E +   P       +++ N+ F T   ++ +       F+VA+ K             
Sbjct: 101 EEEKITSKPNKEKKFGVWVGNMAFDTVKEDIIR-------FIVAKTKENDEGGAITEKDI 153

Query: 674 ---TKPDPKHADKTL-SMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK--LSHRQGS 727
                P  K+ +K L + GF + +F+T++Q  AV+  L  + ++G  + +K   S+    
Sbjct: 154 VRINMPLTKNDNKKLRNKGFAYIDFKTEKQMEAVV-GLSESALNGRNLLIKNAGSYEGRP 212

Query: 728 SNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAF 786
                               NL F+ T   + + F   G++  +R+    D    +GFAF
Sbjct: 213 DKNDLVAASKNPPSRILFVGNLSFDTTEDLLRKHFQHCGEIMRIRMATFEDTGKCKGFAF 272

Query: 787 VEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
           ++F     A NA+       +  R + M+Y
Sbjct: 273 IDFKDETGATNALKDKSCRKIASRPIRMEY 302

 Score = 30.0 bits (66), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 14/100 (14%)

Query: 330 FLRNILYTTTEDDFRKLFGPFGELEEVHVAL-----DTRTGKSKGFAYILFKDPKEAVQA 384
            +R I+  T E+D     G   E + V + +     D +  ++KGFAYI FK  K+ ++A
Sbjct: 131 IIRFIVAKTKEND---EGGAITEKDIVRINMPLTKNDNKKLRNKGFAYIDFKTEKQ-MEA 186

Query: 385 YIELDKQIFQGRLLHILPADAKKSHRLDEFDL----KNMP 420
            + L +    GR L I  A + +  R D+ DL    KN P
Sbjct: 187 VVGLSESALNGRNLLIKNAGSYEG-RPDKNDLVAASKNPP 225

>KLLA0A08338g 736461..738761 weakly similar to sp|P39684
           Saccharomyces cerevisiae YFR023w PES4 DNA-directed DNA
           polymerase epsilon suppressor, start by similarity
          Length = 766

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%)

Query: 322 KISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEA 381
           K  K   LF+ ++    TED    +F  F     V + +D+ T KS G+ Y+ F DPK+A
Sbjct: 133 KSEKQTALFIGDLPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDA 192

Query: 382 VQAYIELDKQIFQGRLLHILPA 403
             A  E +     GR + ++P+
Sbjct: 193 ENAVDEYNYMPIFGREIRMMPS 214

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFD-KSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           LP   T   +  +FN F    SV++    + K + G+ ++ F  PK+AENA+D+   + +
Sbjct: 145 LPGNVTEDMLHNIFNKFKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEYNYMPI 204

Query: 808 LGRRLVM 814
            GR + M
Sbjct: 205 FGREIRM 211

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVP--KKFDKSARGFAFVEFLLPKEAENAMDQLQGV 805
           NLP   +  ++   F+  G +KSV      KFD S   +AF+ +   ++ + A+++L G 
Sbjct: 392 NLPINPSHDNLLNFFSKIGPVKSVYTSDVSKFDSS---WAFITYKRIQDTKTAIEKLNGC 448

Query: 806 HLLGRRL 812
             + R +
Sbjct: 449 KYMKRTI 455

>Scas_565.8
          Length = 322

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 7/83 (8%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTG------KSKGFAYILFKDPK 379
           T +L   N+ + T++ +  +L  PFG++  V    ++  G       S G+AY++F+ P+
Sbjct: 16  THKLVFTNVRFNTSDAELEELLKPFGKVS-VLTPTESLFGFRGTKVVSIGYAYVIFETPQ 74

Query: 380 EAVQAYIELDKQIFQGRLLHILP 402
            A  A+ EL K  F+GR L+I P
Sbjct: 75  LAATAFNELHKTEFKGRTLYIKP 97

>ADL063W [1678] [Homologous to ScYIL061C (SNP1) - SH]
           complement(569855..569857,569915..570874) [963 bp, 320
           aa]
          Length = 320

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 38/60 (63%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  + Y   E + +K F  FGE+E V +  D  T K +G+A++LF+DP+ + +AY E+
Sbjct: 109 IFVGRLHYDVDELELQKHFIKFGEIERVRIVRDKITNKPRGYAFVLFRDPECSKKAYREI 168

>Sklu_2353.5 YIL061C, Contig c2353 10817-11575
          Length = 252

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +F+  + Y  TE + +K F  FGE+E+V V  D  T KS+G+A+I+F+D
Sbjct: 59  VFIGRLPYEVTEVELQKHFSRFGEIEKVRVVRDKSTSKSRGYAFIVFRD 107

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 43/73 (58%), Gaps = 10/73 (13%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLQGV 805
           LP+E T  ++ + F+ FG+++ VRV +  DKS   +RG+AF+ F     +  A  ++ GV
Sbjct: 64  LPYEVTEVELQKHFSRFGEIEKVRVVR--DKSTSKSRGYAFIVFRDETGSRAACKEI-GV 120

Query: 806 H----LLGRRLVM 814
           H    + GR +++
Sbjct: 121 HRGLDIQGRSVIV 133

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 34/77 (44%), Gaps = 6/77 (7%)

Query: 632 DEHV-ADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFG 690
           DEH+    P  ++FI  L +  T VEL K F  F    + +V+   D      + S G+ 
Sbjct: 47  DEHIKGTDPFRTVFIGRLPYEVTEVELQKHFSRFG--EIEKVRVVRD---KSTSKSRGYA 101

Query: 691 FAEFRTKEQANAVISAL 707
           F  FR +  + A    +
Sbjct: 102 FIVFRDETGSRAACKEI 118

>Kwal_33.15208
          Length = 186

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 326 TGRLFLRNILYTTTEDDFRKLF-GPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           T  +F+ NI  + T ++ + LF      +  V + ++   G +KGFAY+ F  PK+ V A
Sbjct: 52  TRSVFVGNISQSITAEELQLLFKDVVSCVNRVEIQVNRVNGLTKGFAYVEFAQPKD-VTA 110

Query: 385 YIELDKQIFQGRLLHILP 402
            +ELD   F GR L ++P
Sbjct: 111 AVELDNVDFHGRRLRVVP 128

>Sklu_1790.3 YOL041C, Contig c1790 1701-3122
          Length = 473

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (58%), Gaps = 1/73 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ N+ +   E++  K F P GE+E + +  D++T   KGFAY+ FKD +   +A +  
Sbjct: 309 VFIGNLDFEELEENLWKNFSPCGEVEYIRIIRDSKTNMGKGFAYVQFKDFQSVNKALLLN 368

Query: 389 DKQI-FQGRLLHI 400
           +K+I   GR L +
Sbjct: 369 EKKINGNGRKLRV 381

>AFL224W [2971] [Homologous to ScYNL110C (NOP15) - SH]
           complement(18862..19482) [621 bp, 206 aa]
          Length = 206

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 42/75 (56%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           +G +++  + +   E +    F  FG+L++V +A + +TG S+ +A+I F +P +AV A 
Sbjct: 77  SGIIYISRLPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQ 136

Query: 386 IELDKQIFQGRLLHI 400
             +   +  G LL +
Sbjct: 137 ETMHNYLLMGHLLQV 151

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 1/65 (1%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           LP     +++   F  FG LK VR+ + K   ++R +AF+EF  P +A  A + +    L
Sbjct: 85  LPHGFHERELSTYFAQFGDLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETMHNYLL 144

Query: 808 LGRRL 812
           +G  L
Sbjct: 145 MGHLL 149

>ABL134C [458] [Homologous to ScYNL175C (NOP13) - SH]
           (140625..141752) [1128 bp, 375 aa]
          Length = 375

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           I+M K   +  LF+ N+ + TT++  +K F   GE+ ++ +A    +GK KGFA++ F+D
Sbjct: 207 ISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRD 266

Query: 378 PKEAVQAYIELDKQIFQGRLLHI 400
              A  A  +   +   GR L +
Sbjct: 267 EAGATAALTDRSCRAIAGRPLRM 289

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 78/187 (41%), Gaps = 15/187 (8%)

Query: 643 IFIKNLNFTTTSVELSKRF--KTFSGFVVAQVK-------TKPDPKHADKTL-SMGFGFA 692
           ++I N+ F TT  EL +RF     +G    +V          P  K+  K + + GF + 
Sbjct: 107 VWIGNMAFDTTQEEL-RRFVVSKTAGMEAGEVTDADIVRVNMPLAKNDGKQIKNKGFAYV 165

Query: 693 EFRTKEQANAVISALDGTVIDGHRIQLK--LSHRQGSSNTTXXXXXXXXXXXXXXXXNLP 750
           +F T  Q +AVI  L    ++G  + +K   S+    +                   NL 
Sbjct: 166 DFATSAQMDAVI-GLSEAQLNGRNLLIKNAKSYDGRPAKNDLISMSKNPPSRILFVGNLS 224

Query: 751 FEATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLQGVHLLG 809
           F+ T + + + F   G++  +R+    D    +GFAFV+F     A  A+       + G
Sbjct: 225 FDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFRDEAGATAALTDRSCRAIAG 284

Query: 810 RRLVMQY 816
           R L M+Y
Sbjct: 285 RPLRMEY 291

 Score = 34.7 bits (78), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 5/81 (6%)

Query: 639 PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKE 698
           P+  +F+ NL+F TT   L K F+     V  ++ T       D     GF F +FR + 
Sbjct: 214 PSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMAT-----FQDSGKCKGFAFVDFRDEA 268

Query: 699 QANAVISALDGTVIDGHRIQL 719
            A A ++      I G  +++
Sbjct: 269 GATAALTDRSCRAIAGRPLRM 289

>YOL123W (HRP1) [4700] chr15 (87843..89447) Nuclear polyadenylated
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           [1605 bp, 534 aa]
          Length = 534

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 41/69 (59%), Gaps = 3/69 (4%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPK---EAVQA 384
           ++F+  + + TTED+ R+ FG +G + ++ +  D  TG+S+GF ++ F+ P    E V+ 
Sbjct: 160 KMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKT 219

Query: 385 YIELDKQIF 393
              LD ++ 
Sbjct: 220 QHILDGKVI 228

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           I  ++  KTG++F+  I       +F + F  +G + +  + LD  TG+S+GF ++ + D
Sbjct: 234 IPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTY-D 292

Query: 378 PKEAV 382
             +AV
Sbjct: 293 SADAV 297

>Scas_637.2
          Length = 377

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/171 (24%), Positives = 63/171 (36%), Gaps = 7/171 (4%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
            IFI NL+F  T  +L   F      V A+V +        +  S G G  EF     A 
Sbjct: 79  GIFIGNLSFDATEEDLRDFFSQVGEVVNAEVMSY-------RGRSKGMGTVEFTNPADAE 131

Query: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFEL 761
             I   +G    G  I +K       S                   NLP+  T +++ ++
Sbjct: 132 EAIRQYNGVPFMGRDIFVKQDQPPPGSRQEFKSSEPTQQGYEAFVVNLPYSITWQNLKDI 191

Query: 762 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
           F   G +    V   ++  +RGF  V +   ++   A+D   G  L GR L
Sbjct: 192 FRECGDVIRADVELDYNGYSRGFGSVIYANEEDMFKAIDSFNGAELEGRIL 242

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           NL F+AT +D+ + F+  G++ +  V   +   ++G   VEF  P +AE A+ Q  GV  
Sbjct: 84  NLSFDATEEDLRDFFSQVGEVVNAEV-MSYRGRSKGMGTVEFTNPADAEEAIRQYNGVPF 142

Query: 808 LGRRLVMQ 815
           +GR + ++
Sbjct: 143 MGRDIFVK 150

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 319 AMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDP 378
            +EK  + G +F+ N+ +  TE+D R  F   GE+  V+  + +  G+SKG   + F +P
Sbjct: 71  GVEKHHENG-IFIGNLSFDATEEDLRDFFSQVGEV--VNAEVMSYRGRSKGMGTVEFTNP 127

Query: 379 KEAVQAYIELDKQIFQGRLLHI 400
            +A +A  + +   F GR + +
Sbjct: 128 ADAEEAIRQYNGVPFMGRDIFV 149

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           NLP   T  D+++LF S G++    +      ++ G A VE+     A+  +++L G + 
Sbjct: 305 NLPLSTTVPDLYDLFGSVGEIAMAELVYDETGTSTGAAVVEYASQDAADVCINKLNGYNY 364

Query: 808 LGRRLVMQY 816
            GR L + Y
Sbjct: 365 GGRDLHITY 373

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 5   IVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNEE 64
            V  LP  +T  NLK  F          E  + +  DV++  N  G SR F  + Y NEE
Sbjct: 175 FVVNLPYSITWQNLKDIFR---------ECGDVIRADVELDYN--GYSRGFGSVIYANEE 223

Query: 65  DAFDAVNYFNGSYINTAKLEVSMAK 89
           D F A++ FNG+ +    LEV   K
Sbjct: 224 DMFKAIDSFNGAELEGRILEVREGK 248

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++  N+  +TT  D   LFG  GE+    +  D  TG S G A + +     A     +L
Sbjct: 301 VYCNNLPLSTTVPDLYDLFGSVGEIAMAELVYD-ETGTSTGAAVVEYASQDAADVCINKL 359

Query: 389 DKQIFQGRLLHI 400
           +   + GR LHI
Sbjct: 360 NGYNYGGRDLHI 371

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 330 FLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELD 389
           F+ N+ Y+ T  + + +F   G++    V LD   G S+GF  +++ + ++  +A    +
Sbjct: 175 FVVNLPYSITWQNLKDIFRECGDVIRADVELDY-NGYSRGFGSVIYANEEDMFKAIDSFN 233

Query: 390 KQIFQGRLLHI 400
               +GR+L +
Sbjct: 234 GAELEGRILEV 244

>ADL160W [1581] [Homologous to ScYOL123W (HRP1) - SH]
           complement(408687..410267) [1581 bp, 526 aa]
          Length = 526

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           ++F+  + + TTED+ R+ F  +G + EV +  D  TG+S+GF ++ F D
Sbjct: 164 KMFIGGLNWETTEDNLREYFSKYGNVTEVKIMRDGTTGRSRGFGFLSFAD 213

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 325 KTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           K G++F+  I       +F + F  +G + +  + LD  TG+S+GF +I +  P +AV  
Sbjct: 245 KAGKIFVAGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDSP-DAVDR 303

Query: 385 YIELDKQIFQGRLLHILPADAKK 407
             +     F+G+ + I  A+ ++
Sbjct: 304 VCQNKFIEFKGKRIEIKRAEPRQ 326

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 12/61 (19%)

Query: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRN-REGESRKFAFIG 59
           ++++ + GL    T+DNL+++F K  N           +T+VKI+R+   G SR F F+ 
Sbjct: 162 INKMFIGGLNWETTEDNLREYFSKYGN-----------VTEVKIMRDGTTGRSRGFGFLS 210

Query: 60  Y 60
           +
Sbjct: 211 F 211

>Sklu_2307.2 YPL043W, Contig c2307 2080-4173 reverse complement
          Length = 697

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 52/102 (50%), Gaps = 18/102 (17%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE- 387
           +F+RN+ Y  T++     FG FG ++     LD  TG +KG A++ FK  +EA    ++ 
Sbjct: 300 IFVRNVPYDATQESLESHFGKFGPVKYALPVLDKETGLAKGTAFVAFK-TEEAFSECVDN 358

Query: 388 ---------------LDKQIFQGRLLHILPA-DAKKSHRLDE 413
                          L + +++GR+L I P+ D + ++R+ E
Sbjct: 359 APSAASTSLLISDDVLPQYVYEGRILSITPSLDRESANRMAE 400

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 34/65 (52%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           ++PF+A  ++  + F+ F  +K   + K  +K +RGF FV F +  + + A+ Q +    
Sbjct: 32  SIPFDANDEEFADFFSQFAPIKHSVIVKDSEKQSRGFGFVSFAVEDDTKEALAQARKAKF 91

Query: 808 LGRRL 812
             R L
Sbjct: 92  KNRLL 96

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+R+I +   +++F   F  F  ++   +  D+   +S+GF ++ F    +  +A  + 
Sbjct: 28  LFVRSIPFDANDEEFADFFSQFAPIKHSVIVKDSEK-QSRGFGFVSFAVEDDTKEALAQA 86

Query: 389 DKQIFQGRLLHI 400
            K  F+ RLL I
Sbjct: 87  RKAKFKNRLLRI 98

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/189 (18%), Positives = 73/189 (38%), Gaps = 20/189 (10%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           ++F++++ F     E +  F  F     A +K     K ++K  S GFGF  F  ++   
Sbjct: 27  TLFVRSIPFDANDEEFADFFSQF-----APIKHSVIVKDSEKQ-SRGFGFVSFAVEDDTK 80

Query: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXX-------------N 748
             ++           +++ ++ R+  S                                N
Sbjct: 81  EALAQARKAKFKNRLLRIDIAKRRERSKRNEPRQESEHKSYKESNEEELMKGKPKLIIRN 140

Query: 749 LPFEATRKDVFE-LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           +P+      V + LF+ FG +   ++PKK      GFAFV        + A+++ + + +
Sbjct: 141 MPWSCRDAAVLKKLFSRFGTVVEAKIPKKAGGKLCGFAFVTMKKLSACKRAIEEGKDMKI 200

Query: 808 LGRRLVMQY 816
            GR++ + +
Sbjct: 201 DGRQVAIDF 209

>YCL011C (GBP2) [527] chr3 complement(102074..103357) Protein
           involved in mRNA export, binds poly(A)+ RNA and
           single-stranded G-strand telomere sequence, has three
           RNA recognition (RRM) domains [1284 bp, 427 aa]
          Length = 427

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 65/174 (37%), Gaps = 10/174 (5%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           SIF++NL F  T  +L + F T    V A + T        K    G G  EF   E   
Sbjct: 123 SIFVRNLTFDCTPEDLKELFGTVGEVVEADIITS-------KGHHRGMGTVEFTKNESVQ 175

Query: 702 AVISALDGTVIDGHRIQLKLSH---RQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDV 758
             IS  DG +    ++ ++  +         +                 NLP+    + +
Sbjct: 176 DAISKFDGALFMDRKLMVRQDNPPPEAAKEFSKKATREEIDNGFEVFIINLPYSMNWQSL 235

Query: 759 FELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
            ++F   G +    V   F+  +RGF  V +    E   A+D   G+ + GR L
Sbjct: 236 KDMFKECGHVLRADVELDFNGFSRGFGSVIYPTEDEMIRAIDTFNGMEVEGRVL 289

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/257 (21%), Positives = 92/257 (35%), Gaps = 68/257 (26%)

Query: 321 EKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKE 380
           E+I     +F+ N+ Y+      + +F   G +    V LD   G S+GF  +++    E
Sbjct: 213 EEIDNGFEVFIINLPYSMNWQSLKDMFKECGHVLRADVELDF-NGFSRGFGSVIYPTEDE 271

Query: 381 AVQAYIELDKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSW 440
            ++A    +    +GR+L +                      ++    K+ N  R     
Sbjct: 272 MIRAIDTFNGMEVEGRVLEV----------------------REGRFNKRKNNDR----- 304

Query: 441 NSLYMNQDAVLGSVAAKLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLT 500
                NQ             ++ DL D   +   + Q  A  HI             D T
Sbjct: 305 ----YNQ-------------RREDLEDTRGTEPGLAQDAA-VHI-------------DET 333

Query: 501 --KFAQTKSPEQRDAKVILVKNFPYGTTREEIGELFLPFGKLKRL-LMP-----PSGTIA 552
             KF +  +P       I   N P+ T R ++ +LF P GK+    L P     P+G +A
Sbjct: 334 AAKFTEGVNPGGDRNCFIYCSNLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTG-VA 392

Query: 553 IVEYRDTTSGRSAFTKL 569
           +VEY +         KL
Sbjct: 393 VVEYENLVDADFCIQKL 409

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+RN+ +  T +D ++LFG  GE+ E  +   T  G  +G   + F   +    A  + 
Sbjct: 124 IFVRNLTFDCTPEDLKELFGTVGEVVEADII--TSKGHHRGMGTVEFTKNESVQDAISKF 181

Query: 389 DKQIFQGRLLHI 400
           D  +F  R L +
Sbjct: 182 DGALFMDRKLMV 193

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           NLPF   R D+F+LF   G++ +  +  + +    G A VE+    +A+  + +L   + 
Sbjct: 355 NLPFSTARSDLFDLFGPIGKINNAELKPQENGQPTGVAVVEYENLVDADFCIQKLNNYNY 414

Query: 808 LGRRLVMQY 816
            G  L + Y
Sbjct: 415 GGCSLQISY 423

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           NL F+ T +D+ ELF + G++    +        RG   VEF   +  ++A+ +  G   
Sbjct: 128 NLTFDCTPEDLKELFGTVGEVVEADIITS-KGHHRGMGTVEFTKNESVQDAISKFDGALF 186

Query: 808 LGRRLVMQ 815
           + R+L+++
Sbjct: 187 MDRKLMVR 194

>Kwal_26.7179
          Length = 456

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 48/84 (57%), Gaps = 4/84 (4%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ N+ +  TE++  K FG  G++E V +  D++T   KGFAY+ F+D +   +A + L
Sbjct: 295 VFVGNLDFEETEENLWKHFGKSGDIEYVRLIRDSKTNMGKGFAYVQFRDFQTVNKALL-L 353

Query: 389 DKQIFQ--GRLLHILPA-DAKKSH 409
           D Q     GR L +    + KK+H
Sbjct: 354 DGQKLNGTGRKLRVTRCKNMKKTH 377

>CAGL0J11154g 1083613..1084755 similar to sp|P53883 Saccharomyces
           cerevisiae YNL175c NOP13, start by similarity
          Length = 380

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 46/83 (55%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           ++M K   +  LF+ N+ + TT++  RK F   GE+ ++ +A    +GK KGFA++ FK+
Sbjct: 214 VSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKN 273

Query: 378 PKEAVQAYIELDKQIFQGRLLHI 400
            + A  A  +   +   GR L +
Sbjct: 274 EEGATNALKDKSCRKIAGRPLRM 296

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 91/215 (42%), Gaps = 27/215 (12%)

Query: 620 DSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVK------ 673
           D   K S +E E   V D     ++I NL+F TT  ++++       F+V + K      
Sbjct: 93  DGESKDSAKESES-SVKDSRKNGVWIGNLSFDTTKEDITR-------FIVGKTKGTDVEI 144

Query: 674 --------TKPDPKHADKTL-SMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK--LS 722
                     P  K+  K + + GF + +F+T+EQ  A I  L  + ++G  + +K   S
Sbjct: 145 TEEDLVRVNMPLAKNDGKQIKNKGFCYVDFKTQEQVEAAIK-LSESQLNGRNLLIKNSKS 203

Query: 723 HRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS-A 781
           +      T                 NL F+ T + + + F   G++  +R+    D    
Sbjct: 204 YEGRPDKTDLVSMSKNPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKC 263

Query: 782 RGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
           +GFAFV+F   + A NA+       + GR L M++
Sbjct: 264 KGFAFVDFKNEEGATNALKDKSCRKIAGRPLRMEF 298

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 57/111 (51%), Gaps = 15/111 (13%)

Query: 322 KISKTGRLFLRNILYTTTEDDFRKLF-----GPFGELEE-----VHVAL---DTRTGKSK 368
           K S+   +++ N+ + TT++D  +       G   E+ E     V++ L   D +  K+K
Sbjct: 108 KDSRKNGVWIGNLSFDTTKEDITRFIVGKTKGTDVEITEEDLVRVNMPLAKNDGKQIKNK 167

Query: 369 GFAYILFKDPKEAVQAYIELDKQIFQGRLLHILPADAKKSHRLDEFDLKNM 419
           GF Y+ FK  +E V+A I+L +    GR L I  + + +  R D+ DL +M
Sbjct: 168 GFCYVDFK-TQEQVEAAIKLSESQLNGRNLLIKNSKSYEG-RPDKTDLVSM 216

>CAGL0E01947g 193225..194583 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 452

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 32/49 (65%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFK 376
           ++F+  + + TTED  R  F  +G++EE+ +  D  TG+S+GF ++ F+
Sbjct: 123 KMFIGGLNWETTEDGLRDYFSKYGKVEELKIMKDPATGRSRGFGFLTFE 171

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           I  E+  KTG++F+  I       +F + F  +G + +  + LD  TG+S+GF +I +  
Sbjct: 197 IPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLDKDTGRSRGFGFITYDT 256

Query: 378 PKEAVQAYIELDKQIFQGRLLHI 400
           P +AV    +     F+GR + I
Sbjct: 257 P-DAVDKVCQNKFIDFKGRKIEI 278

>YNL110C (NOP15) [4483] chr14 complement(417826..418488) Protein
           that may be involved in coping with heat stresses,
           contains one RNA recognition (RRM) domain [663 bp, 220
           aa]
          Length = 220

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 47/83 (56%), Gaps = 2/83 (2%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           +G +++  + +   E +  K F  FG+L+EV +A + +TG S+ + ++ F + ++A+ A 
Sbjct: 90  SGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQ 149

Query: 386 IELDKQIFQGRLLH--ILPADAK 406
             ++  +  G LL   +LP  AK
Sbjct: 150 ESMNNYLLMGHLLQVRVLPKGAK 172

 Score = 32.7 bits (73), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           LP     K++ + F  FG LK VR+ + K   ++R + F+EF+  ++A  A + +    L
Sbjct: 98  LPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLL 157

Query: 808 LGRRL 812
           +G  L
Sbjct: 158 MGHLL 162

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 5/79 (6%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           I++  L       ELSK F  F    + +V+   + K  +   S  +GF EF  KE A  
Sbjct: 93  IYVSRLPHGFHEKELSKYFAQFGD--LKEVRLARNKKTGN---SRHYGFLEFVNKEDAMI 147

Query: 703 VISALDGTVIDGHRIQLKL 721
              +++  ++ GH +Q+++
Sbjct: 148 AQESMNNYLLMGHLLQVRV 166

>KLLA0C12925g 1094574..1096286 some similarities with sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1 CF Ib (RNA3
           Cleavage factor Ib), hypothetical start
          Length = 570

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 32/50 (64%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           ++F+  + + TTE+  R  F  +G + EV +  DT TG+S+GF ++ F++
Sbjct: 187 KMFIGGLNWETTEEGLRDYFSKYGAVAEVKIMKDTATGRSRGFGFLTFEN 236

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 1/90 (1%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           I  E+  KTG++F+  I       +F + F  +G + +  + LD  TG+S+GF +I +  
Sbjct: 261 IPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGSIIDAQLMLDKDTGRSRGFGFITYDT 320

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKK 407
           P +AV    +     F+G+ + I  A+ ++
Sbjct: 321 P-DAVDRVCQNKFIEFKGKQIEIKRAEPRQ 349

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 42/88 (47%), Gaps = 7/88 (7%)

Query: 39  ITDVKILRNRE-GESRKFAFIGYHNEEDAFDAVNY-----FNGSYINTAKLEVSMAKSFA 92
           I D +++ +++ G SR F FI Y +  DA D V       F G  I   + E    +   
Sbjct: 296 IIDAQLMLDKDTGRSRGFGFITY-DTPDAVDRVCQNKFIEFKGKQIEIKRAEPRQLQKQK 354

Query: 93  DPRVPQPMKERKREALKRFREKEERLLA 120
            P++ QPM +     +++++  +  ++A
Sbjct: 355 QPQMTQPMGQNMSNPMQQYQMFQNPMMA 382

>Kwal_23.5864
          Length = 278

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 33/49 (67%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +F+  + YT TE + +K F  FGE+E+V V  D  + KS+G+ +I+FK+
Sbjct: 103 VFVGRLPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKE 151

 Score = 33.5 bits (75), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEF---LLPKEAENAMDQLQG 804
           LP+  T  ++ + F  FG+++ VRV + K    +RG+ F+ F   L  + A   +   +G
Sbjct: 108 LPYTVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKEELFARTACREIGVHRG 167

Query: 805 VHLLGRRLVM 814
           V + GR +++
Sbjct: 168 VEIGGRPVIV 177

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 5/61 (8%)

Query: 635 VADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEF 694
           V   P  ++F+  L +T T VEL K F  F    + +V+   D K ++K  S G+GF  F
Sbjct: 95  VGSDPYRTVFVGRLPYTVTEVELQKEFVRFGE--IEKVRVVRD-KTSNK--SRGYGFIMF 149

Query: 695 R 695
           +
Sbjct: 150 K 150

>Kwal_33.14463
          Length = 393

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           I+M K   +  LF+ N+ + TT++  +K F   G++ ++ +A    TGK KGFA++ FKD
Sbjct: 226 ISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKD 285

Query: 378 PKEAVQAYIELDKQIFQGRLLHI 400
            +    A  +   +   GR L +
Sbjct: 286 EEGPTNALKDKTCRKIAGRPLRM 308

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 97/239 (40%), Gaps = 41/239 (17%)

Query: 611 VKDTVKEIMDSTD-------KTSNEEHEDEHVADG------PTVSIFIKNLNFTTTSVEL 657
           VK+  KEI   T+        T + E ED   ++G          ++I NL+F T+  +L
Sbjct: 80  VKEYKKEIEQKTEGDDETAGSTKDGEGEDNKSSNGQKPKKDKKFGVWIGNLSFDTSKEDL 139

Query: 658 SKRFKTFSGFVVAQVK----------------TKPDPKHADKTL-SMGFGFAEFRTKEQA 700
            +       F VA+ K                  P  ++  K + + GF    F+T+EQ 
Sbjct: 140 CR-------FFVAKTKELDESCRIEESDIVRVNLPLAQNDGKQIKNKGFAHMNFKTQEQM 192

Query: 701 NAVISALDGTVIDGHRIQLKLSHR-QGSSNTTXXXXXXXXXXXXXX-XXNLPFEATRKDV 758
           NAV+ AL  + ++G  + +K S    G  +                   NL F+ T + +
Sbjct: 193 NAVV-ALSESHLNGRNLLIKDSSSFDGRPDKNDLISMSKNPPSRILFVGNLSFDTTDELL 251

Query: 759 FELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
            + F   G +  +R+    D    +GFAFV+F   +   NA+       + GR L M++
Sbjct: 252 KKHFQHCGDIVKIRMATFQDTGKCKGFAFVDFKDEEGPTNALKDKTCRKIAGRPLRMEF 310

>YNL016W (PUB1) [4570] chr14 (602905..604266) Major polyadenylated
           RNA-binding protein of nucleus and cytoplasm, contains
           three RNA recognition (RRM) domains and three
           Gln/Asn-rich regions [1362 bp, 453 aa]
          Length = 453

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 76/176 (43%), Gaps = 17/176 (9%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           +++ NL+   T   L + F+   G  +A +K   D  + +    + + F E+     AN 
Sbjct: 77  LYVGNLDKAITEDILKQYFQV--GGPIANIKIMIDKNNKN----VNYAFVEYHQSHDANI 130

Query: 703 VISALDGTVIDGH--RIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFE 760
            +  L+G  I+ +  +I      +Q SS+ T                    + T ++ F+
Sbjct: 131 ALQTLNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVD-------DETLRNAFK 183

Query: 761 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
            F S+  L    +      S+RG+ FV F    +A+NAMD +QG  L GR L + +
Sbjct: 184 DFPSY--LSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINW 237

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 33/75 (44%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           T  LF+ ++     ++  R  F  F      HV  D +TG S+G+ ++ F    +A  A 
Sbjct: 161 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAM 220

Query: 386 IELDKQIFQGRLLHI 400
             +  Q   GR L I
Sbjct: 221 DSMQGQDLNGRPLRI 235

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 42/85 (49%), Gaps = 11/85 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + V  L   +T+D LKQ+F+           +   I ++KI+ ++  ++  +AF+ YH  
Sbjct: 77  LYVGNLDKAITEDILKQYFQ-----------VGGPIANIKIMIDKNNKNVNYAFVEYHQS 125

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMA 88
            DA  A+   NG  I    ++++ A
Sbjct: 126 HDANIALQTLNGKQIENNIVKINWA 150

>CAGL0M03795g complement(428607..430148) highly similar to sp|Q99383
           Saccharomyces cerevisiae YOL123w HRP1, start by
           similarity
          Length = 513

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPK---EAVQA 384
           ++F+  + + TTED  R+ F  +G + E+ +  D  TG+S+GF ++ F  P    E V+ 
Sbjct: 131 KMFIGGLNWETTEDGLREYFSKYGNVVELKIMKDPNTGRSRGFGFLSFDAPSSVDEVVKT 190

Query: 385 YIELDKQIF 393
              LD ++ 
Sbjct: 191 QHILDGKVI 199

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 48/93 (51%), Gaps = 1/93 (1%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           I  E+  KTG++F+  +       +F + F  +G + +  + LD  TG+S+GF ++ +  
Sbjct: 205 IPREEQDKTGKIFVGGLGTDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFGFVTYDS 264

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410
           P +A +   E   + F+G+ + I  A+ +   +
Sbjct: 265 P-DAAEKVCESRYREFKGKQIEIKRAEPRHQQK 296

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 8/79 (10%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
             +FI  LN+ TT   L + F  +   V  ++K   DP   +   S GFGF  F      
Sbjct: 130 CKMFIGGLNWETTEDGLREYFSKYGNVV--ELKIMKDP---NTGRSRGFGFLSFDAPSSV 184

Query: 701 NAVISA---LDGTVIDGHR 716
           + V+     LDG VID  R
Sbjct: 185 DEVVKTQHILDGKVIDPKR 203

>Scas_635.7
          Length = 581

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 39/69 (56%), Gaps = 3/69 (4%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPK---EAVQA 384
           ++F+  + + TTED  +  F  +G + E+ +  D  TG+S+GF ++ F++P    E V+ 
Sbjct: 197 KMFIGGLNWETTEDGLKNYFSKYGNVVELKIMKDGATGRSRGFGFLTFENPSSVDEVVKT 256

Query: 385 YIELDKQIF 393
              LD ++ 
Sbjct: 257 QHILDGKVI 265

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 1/93 (1%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           I  E+  KTG++F+  I       +F   F  +G + +  + LD  TG+S+GF ++ + D
Sbjct: 271 IPREEQDKTGKIFVGGIGTDVRPKEFEDFFAQYGTIIDAQLMLDKDTGRSRGFGFVTY-D 329

Query: 378 PKEAVQAYIELDKQIFQGRLLHILPADAKKSHR 410
             +AV    +     F+G+ + I  A+ + + R
Sbjct: 330 SGDAVDRVCQNKYIEFKGKQIEIKRAEPRHNQR 362

>KLLA0B00847g complement(65983..66792) similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35 translation
           initiation factor eIF3 (p33 subunit) singleton, start by
           similarity
          Length = 269

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 344 RKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLH 399
           R+L  PFGE+  V V  +  TG+S+G AY+ F+  + A QA   L+ + F   +LH
Sbjct: 202 RELLFPFGEIPRVFVVKNPETGRSRGVAYVTFQTEEIAAQALKLLEGRGFMNFMLH 257

>CAGL0K06655g 648082..650490 similar to sp|P32831 Saccharomyces
           cerevisiae YBR212w Negative growth regulatory protein,
           hypothetical start
          Length = 802

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 1/81 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGP-FGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           LF+ ++  T TE D   LF   F  ++ V V  D  TG S+ F ++ F + +E  +A IE
Sbjct: 236 LFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIE 295

Query: 388 LDKQIFQGRLLHILPADAKKS 408
           ++   FQGR L +  A  + +
Sbjct: 296 MNGVHFQGRTLRVAYATPRST 316

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 753 ATRKDVFELFNS-FGQLKSVRV-PKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGR 810
           AT  D+  LF + F  +K+VRV       ++R F FV F   +E   A+ ++ GVH  GR
Sbjct: 245 ATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFGNEEERRRALIEMNGVHFQGR 304

Query: 811 RLVMQY 816
            L + Y
Sbjct: 305 TLRVAY 310

>YOL041C (NOP12) [4777] chr15 complement(251265..252644) Protein
           important for the synthesis of 25S pre-rRNA [1380 bp,
           459 aa]
          Length = 459

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYI 386
           +F+ N+ +   E+   K F P G++E V +  D++T   KGFAY+ FKD +   +A +
Sbjct: 281 IFVGNLDFEEIEESLWKHFEPCGDIEYVRIIRDSKTNMGKGFAYVQFKDLQSVNKALL 338

>Kwal_55.21960
          Length = 597

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 43/83 (51%), Gaps = 1/83 (1%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           I  E+  KTG++F+  I       +F + F  +G + +  + LD  TG+S+GF +I +  
Sbjct: 284 IPREEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGRSRGFGFITYDT 343

Query: 378 PKEAVQAYIELDKQIFQGRLLHI 400
           P +AV    E     F+G+ + I
Sbjct: 344 P-DAVDRVCENKFIEFKGKRIEI 365

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 31/48 (64%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILF 375
           ++F+  + + TTED+ +  F  +G++ ++ +  D  TG+S+GF ++ F
Sbjct: 210 KMFIGGLNWETTEDNLKDYFSKYGQVTDLKIMRDNATGRSRGFGFLTF 257

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 12/61 (19%)

Query: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILR-NREGESRKFAFIG 59
           + ++ + GL    T+DNLK +F K              +TD+KI+R N  G SR F F+ 
Sbjct: 208 ICKMFIGGLNWETTEDNLKDYFSKY-----------GQVTDLKIMRDNATGRSRGFGFLT 256

Query: 60  Y 60
           +
Sbjct: 257 F 257

>AGL250W [4062] [Homologous to ScYPL043W (NOP4) - SH]
           complement(232080..234269) [2190 bp, 729 aa]
          Length = 729

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           N+PF+AT  ++ + F+ F  +K   + K    S+RGF FV F +  + + A+D+ +    
Sbjct: 22  NIPFDATDAELTDFFSQFAPIKHAVIVKDNAGSSRGFGFVSFAVESDTQAALDKGRKTQF 81

Query: 808 LGRRL 812
            GR L
Sbjct: 82  KGRLL 86

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/200 (19%), Positives = 71/200 (35%), Gaps = 36/200 (18%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHA-----DKTLSMGFGFAEFRT 696
           ++F++N+ F  T  EL+  F  F+             KHA     +   S GFGF  F  
Sbjct: 17  TLFVRNIPFDATDAELTDFFSQFAPI-----------KHAVIVKDNAGSSRGFGFVSFAV 65

Query: 697 KEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXX--------- 747
           +    A +     T   G  +++ ++ R+  S                            
Sbjct: 66  ESDTQAALDKGRKTQFKGRLLRVDVAKRRERSKKGDEAEAQTSAEDAEKPTTAPEGDEAL 125

Query: 748 ----------NLPFEATRKDVFE-LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAE 796
                     N+P+        + +F  FG +    +P+K D    GFAFV         
Sbjct: 126 MRGKPKLIIRNMPWSCRDPTKLKKIFGRFGVVAEASIPRKADGKLCGFAFVTMKKLSNCR 185

Query: 797 NAMDQLQGVHLLGRRLVMQY 816
            A+++ +G+ + GR + + +
Sbjct: 186 KAIEECKGLKIDGREVAVDF 205

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 16/101 (15%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPK---EAVQAY 385
           +F+RN+ Y  T++     F  FG ++      D  TG  KG A++ FKD       V   
Sbjct: 290 VFVRNVPYDATQETLEAHFSKFGPVKYALPVQDKETGLPKGTAFVAFKDESTFDTCVANA 349

Query: 386 IELDKQ------------IFQGRLLHILPA-DAKKSHRLDE 413
             +D +            +++GR+L I P  D + ++R+ E
Sbjct: 350 PVVDSKSLLISDDVAPEYVYEGRILAITPTLDRETANRISE 390

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+RNI +  T+ +    F  F  ++   +  D   G S+GF ++ F    +   A  + 
Sbjct: 18  LFVRNIPFDATDAELTDFFSQFAPIKHAVIVKDN-AGSSRGFGFVSFAVESDTQAALDKG 76

Query: 389 DKQIFQGRLLHI 400
            K  F+GRLL +
Sbjct: 77  RKTQFKGRLLRV 88

>CAGL0I08943g 867396..869204 similar to sp|P39684 Saccharomyces
           cerevisiae YFR023w PES4 DNA-directed DNA polymerase
           epsilon suppressor, hypothetical start
          Length = 602

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 70/172 (40%), Gaps = 21/172 (12%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
           +++F+ NL    TS  L++ FK +  F+ A+V T     +AD   S+G G+  F  KE A
Sbjct: 64  IALFVGNLAEEITSERLTEMFKVYKSFISAKVCT-----NADDNRSLGHGYINFGNKEDA 118

Query: 701 NAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFE---ATRKD 757
                  +   I G  I++  S R                       NLP +    T + 
Sbjct: 119 ERATEDFNYNKIMGKEIRIMPSIRDS--------VYRKNFGTNIFFSNLPLQKEKLTHRM 170

Query: 758 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLG 809
            +++F  +G + SV++      S++   FV F     A + + +      LG
Sbjct: 171 FYDIFRKYGNVLSVKL-----DSSKNIGFVYFEDDTIARDVIKEFNNKEFLG 217

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 53/272 (19%), Positives = 102/272 (37%), Gaps = 36/272 (13%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+ N+    T +   ++F  +       V  +    +S G  YI F + ++A +A  + 
Sbjct: 66  LFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDNRSLGHGYINFGNKEDAERATEDF 125

Query: 389 DKQIFQGRLLHILPADAKKSHRLD---EFDLKNMPLKKQR-------------------E 426
           +     G+ + I+P+     +R +        N+PL+K++                   +
Sbjct: 126 NYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFSNLPLQKEKLTHRMFYDIFRKYGNVLSVK 185

Query: 427 LKKKDNASRQTFSWNSLY------MNQDAVLGSVAAKLGLKKSDLIDPESSNSAVKQALA 480
           L    N     F  +++        N    LG++ +  GL     +  + +       L 
Sbjct: 186 LDSSKNIGFVYFEDDTIARDVIKEFNNKEFLGNIIS-CGLHFDKELRKKPNFDKQISKLD 244

Query: 481 EAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVILVKNFPYGTTREEIGELFLPFGKL 540
           +  II   ++ F+S  V++       +  Q +   I +KN P  T   EI  +F   G +
Sbjct: 245 DDIIIEKEKEIFDSNKVEIKIDKDKVAIIQPNG--IFIKNLPLDTNNNEILAIFSEVGPI 302

Query: 541 KRLLMPPSG-----TIAIVEYRDTTSGRSAFT 567
           K + + P         A V Y+D  S   A +
Sbjct: 303 KSVFLSPLNESREYLWAFVTYKDKASVEKAIS 334

>YNL175C (NOP13) [4424] chr14 complement(307401..308612) Nucleolar
           protein with similarity to Nsr1p, has two RNA
           recognition (RRM) domains [1212 bp, 403 aa]
          Length = 403

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +AM K   +  LF+ N+ +  T+D  RK F   G++ ++ +A    +GK KGFA+I FK+
Sbjct: 230 VAMSKNPPSRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKN 289

Query: 378 PKEAVQAYIELDKQIFQGRLLHI 400
            + +     +   +   GR L +
Sbjct: 290 EEGSTNELKDKSCRKIAGRPLRM 312

 Score = 33.5 bits (75), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 78/197 (39%), Gaps = 32/197 (16%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPK----HADKT-LSM---------- 687
           ++I NL+F TT  +L +       F +A+ K   D K      D T LSM          
Sbjct: 127 VWIGNLSFDTTKDDLVR-------FFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNA 179

Query: 688 ----GFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGS--SNTTXXXXXXXXXX 741
               GF +  F+  EQ  AV+  L  + ++G  + +K S                     
Sbjct: 180 MKNKGFCYMFFKNVEQMKAVLE-LSESHLNGRNMLIKDSENYSGRPDKDDLVAMSKNPPS 238

Query: 742 XXXXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS--ARGFAFVEFLLPKEAENAM 799
                 NL F+ T   + + F   G +  +R+   F+ S   +GFAF++F   + + N +
Sbjct: 239 RILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMAT-FEDSGKCKGFAFIDFKNEEGSTNEL 297

Query: 800 DQLQGVHLLGRRLVMQY 816
                  + GR L M+Y
Sbjct: 298 KDKSCRKIAGRPLRMEY 314

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 19/108 (17%)

Query: 329 LFLRNILYTTTEDDFRKLF---GPFGELEEVHV--------------ALDTRTGKSKGFA 371
           +++ N+ + TT+DD  + F       E E+  V              A ++   K+KGF 
Sbjct: 127 VWIGNLSFDTTKDDLVRFFIAKTKDNEDEKSRVTEQDITRLSMPRVAAKNSNAMKNKGFC 186

Query: 372 YILFKDPKEAVQAYIELDKQIFQGRLLHILPADAKKSHRLDEFDLKNM 419
           Y+ FK+  E ++A +EL +    GR + I  ++   S R D+ DL  M
Sbjct: 187 YMFFKNV-EQMKAVLELSESHLNGRNMLIKDSE-NYSGRPDKDDLVAM 232

>Kwal_47.18572
          Length = 363

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           T RLF+R   +   + +  ++FGPFG ++EV +          GFA++ F++   A +A 
Sbjct: 81  TTRLFVRPFPFDVQDSELNEIFGPFGPMKEVKIL--------NGFAFVEFEEADSAARAI 132

Query: 386 IELDKQIFQGRLLHIL 401
            E++ + F  + L ++
Sbjct: 133 EEVNGKTFANQPLEVV 148

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL 808
            PF+    ++ E+F  FG +K V++         GFAFVEF     A  A++++ G    
Sbjct: 89  FPFDVQDSELNEIFGPFGPMKEVKI-------LNGFAFVEFEEADSAARAIEEVNGKTFA 141

Query: 809 GRRLVMQY 816
            + L + Y
Sbjct: 142 NQPLEVVY 149

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFK 575
           + V+ FP+     E+ E+F PFG +K + +      A VE+ +  S   A  ++  K F 
Sbjct: 84  LFVRPFPFDVQDSELNEIFGPFGPMKEVKI--LNGFAFVEFEEADSAARAIEEVNGKTFA 141

Query: 576 D 576
           +
Sbjct: 142 N 142

>Scas_696.32
          Length = 445

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 64/306 (20%), Positives = 114/306 (37%), Gaps = 64/306 (20%)

Query: 499 LTKFAQTKSPEQRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRD 558
           L K   +K    R+   +LVKN P  T +  + + F   G LK            V+  D
Sbjct: 20  LVKKQDSKPTRNRELTTVLVKNLPKSTNQNRLRKFFQDCGPLKH-----------VDIVD 68

Query: 559 TTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVVEVKDTVKEI 618
           T    S   +L F+ F D    L K  K                                
Sbjct: 69  TLDKSSRVARLEFENFLDASSALTKTFK-------------------------------- 96

Query: 619 MDSTDKTSNEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDP 678
                K  N E E   V+     ++++ N   T TS EL   F  +    ++ V+     
Sbjct: 97  -----KLGNNEIE---VSWLKNCTVWLTNFPPTFTSRELKSLFTEYDCLPIS-VRLPSLR 147

Query: 679 KHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXX 738
            +A++     F + +  T  +A  +++ L+   ID +++  K+S     S  +       
Sbjct: 148 FNANRR----FAYVDVCTSNEATNMVNNLNNKEIDNYKLVAKMS---DPSQRSKRSDAAA 200

Query: 739 XXXXXXXXXNL-PFEATRKDVFELFNSFGQLKSVRVPKKFDKSA----RGFAFVEFLLPK 793
                    NL P      ++  +F + G+++S+ +PKK ++++     G AF+ FL   
Sbjct: 201 IERRELIIRNLDPSSIDEGELRNMFGTLGEIESINIPKKQEENSNQYTNGVAFITFLNSD 260

Query: 794 EAENAM 799
           +A +A+
Sbjct: 261 DAHSAL 266

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/82 (25%), Positives = 42/82 (51%), Gaps = 5/82 (6%)

Query: 329 LFLRNILYTTT-EDDFRKLFGPFGELEEVHVAL---DTRTGKSKGFAYILFKDPKEAVQA 384
           L +RN+  ++  E + R +FG  GE+E +++     +     + G A+I F +  +A  A
Sbjct: 206 LIIRNLDPSSIDEGELRNMFGTLGEIESINIPKKQEENSNQYTNGVAFITFLNSDDAHSA 265

Query: 385 YIELDKQIFQGRLLHILPADAK 406
            ++L+      R++ +  AD K
Sbjct: 266 -LKLNNSKINDRIITVSLADQK 286

>CAGL0D05236g 499006..500337 weakly similar to sp|P43607
           Saccharomyces cerevisiae YFR032c, hypothetical start
          Length = 443

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPF---GELEEVHVALDTRTGKSK--GFAYILFKDPKEAV 382
           R+++ N+ Y+++E+D R+    F     L   H     R  +++  G AY+ F   +EAV
Sbjct: 5   RIYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRRNEARSFGIAYVDFTSSEEAV 64

Query: 383 QAYIELDKQIFQGRLLHI 400
           +A  EL+ + F GR+L +
Sbjct: 65  RAVEELNGKEFGGRVLRV 82

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 38  LITDVKILRNREGESRKF--AFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPR 95
           LI    + R R  E+R F  A++ + + E+A  AV   NG       L V     +  P+
Sbjct: 33  LIPCHTVRRFRRNEARSFGIAYVDFTSSEEAVRAVEELNGKEFGGRVLRVRTHNPYQPPK 92

Query: 96  VPQPMKER---KREALKRFREKEE 116
              P+KER   K + LK+F + E+
Sbjct: 93  ---PIKERFGTKLQQLKKFAKYED 113

>CAGL0H04763g 454589..455740 highly similar to sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3, hypothetical
           start
          Length = 383

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 60/119 (50%), Gaps = 14/119 (11%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           RLF+R       E +  ++FGPFG ++EV +          GFA++ F++ + A +A  E
Sbjct: 106 RLFVRPFPLDVQESELNEIFGPFGAMKEVKIL--------NGFAFVEFEEAESASKAIEE 157

Query: 388 LDKQIFQGRLLHILPADAKKSHRLDEFDLKNMP----LKKQRELKKKDNASRQTFSWNS 442
           ++ + F  + L ++   +K   +     LKN+P     ++ ++L +++N      S NS
Sbjct: 158 VNGKTFANQPLEVM--FSKMPVKRFRITLKNLPEGCSWQELKDLARENNLETTFSSVNS 214

 Score = 33.5 bits (75), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 22/90 (24%)

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSA---------- 565
           + V+ FP      E+ E+F PFG +K + +      A VE+ +  S   A          
Sbjct: 107 LFVRPFPLDVQESELNEIFGPFGAMKEVKI--LNGFAFVEFEEAESASKAIEEVNGKTFA 164

Query: 566 -------FTKLAFKRFKDGIIYLEKGPKDC 588
                  F+K+  KRF+   I L+  P+ C
Sbjct: 165 NQPLEVMFSKMPVKRFR---ITLKNLPEGC 191

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQG 804
            P +    ++ E+F  FG +K V++         GFAFVEF   + A  A++++ G
Sbjct: 112 FPLDVQESELNEIFGPFGAMKEVKI-------LNGFAFVEFEEAESASKAIEEVNG 160

>YPL043W (NOP4) [5396] chr16 (469934..471991) Nucleolar protein
           required for ribosome biogenesis, contains three
           canonical RNA recognition motif (RRM) domains and one
           degenerate RNA recognition motif (RRM) domain [2058 bp,
           685 aa]
          Length = 685

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 15/89 (16%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD----------- 377
           +F+RN+ Y  TE+     F  FG ++     +D  TG +KG A++ FKD           
Sbjct: 292 VFVRNVPYDATEESLAPHFSKFGSVKYALPVIDKSTGLAKGTAFVAFKDQYTYNECIKNA 351

Query: 378 PKEAVQAYIELD----KQIFQGRLLHILP 402
           P     + +  D    + +++GR+L I P
Sbjct: 352 PAAGSTSLLIGDDVMPEYVYEGRVLSITP 380

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/204 (17%), Positives = 75/204 (36%), Gaps = 37/204 (18%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           ++F++++    T  +L+  F  F+    A V    + +      S GFGF  F  ++   
Sbjct: 27  TLFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDTNKR------SRGFGFVSFAVEDDTK 80

Query: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXX-------------- 747
             ++    T  +GH +++ ++ R+  S  T                              
Sbjct: 81  EALAKARKTKFNGHILRVDIAKRRDRSKKTSEVVEKSTPESSEKITGQNNEDEDDADGED 140

Query: 748 ------------NLPFEATRKDVFEL---FNSFGQLKSVRVPKKFDKSARGFAFVEFLLP 792
                       N+P+    +D  +L   F  +G +    +P+K D    GFAFV     
Sbjct: 141 SMLKGKPKLIIRNMPWSC--RDPVKLKKIFGRYGTVVEATIPRKRDGKLCGFAFVTMKKI 198

Query: 793 KEAENAMDQLQGVHLLGRRLVMQY 816
                A++  + + + GR++ + +
Sbjct: 199 SNCRIALENTKDLKIDGRKVAVDF 222

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+R+I    T++     F  F  ++   V  DT   +S+GF ++ F    +  +A  + 
Sbjct: 28  LFVRSIPQDVTDEQLADFFSNFAPIKHAVVVKDT-NKRSRGFGFVSFAVEDDTKEALAKA 86

Query: 389 DKQIFQGRLLHI 400
            K  F G +L +
Sbjct: 87  RKTKFNGHILRV 98

>KLLA0F23650g 2210563..2211501 some similarities with sp|P53927
           Saccharomyces cerevisiae YNL110c singleton, hypothetical
           start
          Length = 312

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 42/75 (56%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           +G L++  +     E +  K F  FG+L++V +A + +TG S+ +A++ + +  +AV A 
Sbjct: 182 SGILYISRLPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQ 241

Query: 386 IELDKQIFQGRLLHI 400
             ++  +  G LL +
Sbjct: 242 ESMNNYLLMGHLLKV 256

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           LP     +++ + F+ FG LK VR+ + K   ++R +AF+E++   +A  A + +    L
Sbjct: 190 LPQGFKERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFLEYINKDDAVVAQESMNNYLL 249

Query: 808 LGRRL 812
           +G  L
Sbjct: 250 MGHLL 254

>YDR432W (NPL3) [1254] chr4 (1328771..1330015) Protein involved in
           18S and 25S rRNA processing, export of RNA from the
           nucleus, import of proteins into the nucleus, associated
           with U1 snRNP, has 2 RNA recognition (RRM) domains [1245
           bp, 414 aa]
          Length = 414

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 18/97 (18%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           RLF+R       E +  ++FGPFG ++EV +          GFA++ F++ + A +A  E
Sbjct: 126 RLFVRPFPLDVQESELNEIFGPFGPMKEVKIL--------NGFAFVEFEEAESAAKAIEE 177

Query: 388 LDKQIFQGRLLHI----LPADAKKSHRLDEFDLKNMP 420
           +  + F  + L +    LPA   K +R+    +KN+P
Sbjct: 178 VHGKSFANQPLEVVYSKLPA---KRYRI---TMKNLP 208

 Score = 36.6 bits (83), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 10/58 (17%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
            P +    ++ E+F  FG +K V++         GFAFVEF   +EAE+A   ++ VH
Sbjct: 132 FPLDVQESELNEIFGPFGPMKEVKI-------LNGFAFVEF---EEAESAAKAIEEVH 179

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 22/94 (23%)

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSA---------- 565
           + V+ FP      E+ E+F PFG +K + +      A VE+ +  S   A          
Sbjct: 127 LFVRPFPLDVQESELNEIFGPFGPMKEVKI--LNGFAFVEFEEAESAAKAIEEVHGKSFA 184

Query: 566 -------FTKLAFKRFKDGIIYLEKGPKDCFTRD 592
                  ++KL  KR++   I ++  P+ C  +D
Sbjct: 185 NQPLEVVYSKLPAKRYR---ITMKNLPEGCSWQD 215

>CAGL0B04807g 460721..461980 similar to sp|P25555 Saccharomyces
           cerevisiae YCL011c GBP2 or sp|P38922 Saccharomyces
           cerevisiae YNL004w HRB1, hypothetical start
          Length = 419

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 76/204 (37%), Gaps = 34/204 (16%)

Query: 639 PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKE 698
           P   +FI NL ++ T   L   F+     + A ++            S GFG   + T+E
Sbjct: 220 PMFEVFIVNLPYSMTWQTLKDLFREAGDVIRADIELD------RNGFSRGFGTVFYGTQE 273

Query: 699 QANAVISALDGTVIDGHRIQLK------------------------LSHRQGSSNTTXXX 734
           +    I   +G  +DG  +Q++                        +    G S  T   
Sbjct: 274 EMFNAIERFNGFDVDGRILQVREGKNSTGYQAPYQAPPPPQEQEIEMEPPTGPSQFTENV 333

Query: 735 XXXXXXXXXXXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA--RGFAFVEFLLP 792
                        NLP      D+++LF + G+++   +  KFD+S    G A +E+   
Sbjct: 334 VGGGERSTLIYCSNLPLTTATGDLYDLFETIGRVRHAEL--KFDESGAPTGIAVIEYENV 391

Query: 793 KEAENAMDQLQGVHLLGRRLVMQY 816
           ++A+  + +L   +  G  L + Y
Sbjct: 392 EDADFCIQRLNNYNYGGCDLDISY 415

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           NL F+AT +D+ + F   G++    +     +  RG   VEF  P+  +NA+    GV  
Sbjct: 125 NLSFDATPEDLHDFFGQAGEVLRADIITSRGRH-RGMGTVEFTSPEGVDNAIRDFNGVEF 183

Query: 808 LGRRLVMQ 815
           +GR L ++
Sbjct: 184 MGRPLFVR 191

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 11/90 (12%)

Query: 1   MSRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGY 60
           M  + +  LP  +T   LK  F          E  + +  D+++ RN  G SR F  + Y
Sbjct: 221 MFEVFIVNLPYSMTWQTLKDLFR---------EAGDVIRADIELDRN--GFSRGFGTVFY 269

Query: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKS 90
             +E+ F+A+  FNG  ++   L+V   K+
Sbjct: 270 GTQEEMFNAIERFNGFDVDGRILQVREGKN 299

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ N+ Y+ T    + LF   G++    + LD R G S+GF  + +   +E   A    
Sbjct: 224 VFIVNLPYSMTWQTLKDLFREAGDVIRADIELD-RNGFSRGFGTVFYGTQEEMFNAIERF 282

Query: 389 DKQIFQGRLLHI 400
           +     GR+L +
Sbjct: 283 NGFDVDGRILQV 294

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 2/72 (2%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ N+ +  T +D    FG  GE+  +   + T  G+ +G   + F  P+    A  + 
Sbjct: 121 IFIGNLSFDATPEDLHDFFGQAGEV--LRADIITSRGRHRGMGTVEFTSPEGVDNAIRDF 178

Query: 389 DKQIFQGRLLHI 400
           +   F GR L +
Sbjct: 179 NGVEFMGRPLFV 190

>KLLA0A05346g 485886..488510 some similarities with sp|P53316
           Saccharomyces cerevisiae YGR250c singleton, hypothetical
           start
          Length = 874

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 39/78 (50%)

Query: 323 ISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAV 382
           ++  G L++R I    T++D   +F  FG +  + + LD+ T +S GF ++ +    +A 
Sbjct: 187 LNHPGNLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILDSNTNESMGFGFVSYALGSQAS 246

Query: 383 QAYIELDKQIFQGRLLHI 400
               EL+  +  G  L +
Sbjct: 247 NCIKELNGNLMNGSPLFV 264

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 6/84 (7%)

Query: 631 EDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFG 690
           E+ H  + P  +++++ +    T  +L   F  F   +V ++        ++   SMGFG
Sbjct: 182 ENPHALNHPG-NLYVRGIPKNLTKEDLVPIFAKFGPILVLKIILD-----SNTNESMGFG 235

Query: 691 FAEFRTKEQANAVISALDGTVIDG 714
           F  +    QA+  I  L+G +++G
Sbjct: 236 FVSYALGSQASNCIKELNGNLMNG 259

 Score = 30.8 bits (68), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 15/76 (19%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVAL---------------DTRTGKSKGFAYI 373
           L+++++     ++D  + F  FGE+    +                 D   GKSKG+ ++
Sbjct: 732 LYVKHLPLDWRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYGFV 791

Query: 374 LFKDPKEAVQAYIELD 389
            F++P +A +A    D
Sbjct: 792 CFQNPLDASRAMYHTD 807

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 52/113 (46%), Gaps = 19/113 (16%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + V+G+P  LT ++L   F K         PI  L+  + IL +   ES  F F+ Y   
Sbjct: 193 LYVRGIPKNLTKEDLVPIFAKF-------GPI--LVLKI-ILDSNTNESMGFGFVSYALG 242

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKEE 116
             A + +   NG+ +N + L       F +  V +  KER+R    ++++ E+
Sbjct: 243 SQASNCIKELNGNLMNGSPL-------FVNYHVER--KERERIHFDQWKQNEQ 286

>AEL016C [2490] [Homologous to ScYFR023W (PES4) - SH; ScYHR015W
           (MIP6) - SH] (605004..607040) [2037 bp, 678 aa]
          Length = 678

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 73/187 (39%), Gaps = 27/187 (14%)

Query: 637 DGPT------VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFG 690
           D PT      V++FI +L+   T   L   F  F  FV A++    + K      S+G+G
Sbjct: 106 DSPTLTSKKLVALFIGDLDEKVTEKNLRDTFNKFDSFVSAKICIDSNTKK-----SLGYG 160

Query: 691 FAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLP 750
           +  F  +E A  VI   +   I G  +++  S R                       NLP
Sbjct: 161 YLNFSNEEDAERVIEEFNYIPIFGREVRIMPSLRNS--------FYRKNIGTNVFFSNLP 212

Query: 751 FE---ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
            E    T +  ++ F  FG++ S ++ ++     +   FV F     A+ A+ +  G   
Sbjct: 213 LENLALTTRVFYDAFKKFGKILSCKLDRR-----KNIGFVYFEKDSAAKQAIAEYNGKEF 267

Query: 808 LGRRLVM 814
            G  ++ 
Sbjct: 268 FGNNILC 274

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           NLP       + + F+  G +KS+       K +  +AF+ F    +A++A+D L    L
Sbjct: 331 NLPLNPDSDLLLDYFSQIGPVKSI-FTSNVSKLSSAWAFITFQKGSDAQDAIDNLNHSQL 389

Query: 808 LGR 810
           LGR
Sbjct: 390 LGR 392

>Sklu_2182.3 YDR432W, Contig c2182 3920-5035
          Length = 371

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           T RLF+R   +   E +  ++F PFG ++EV +          GFA++ F++ + A +A 
Sbjct: 74  TTRLFVRPFPFDVQESELNEIFSPFGPMKEVKIL--------NGFAFVEFEESESAAKAI 125

Query: 386 IELDKQIFQGRLLHIL 401
            E++ + F  + L ++
Sbjct: 126 DEVNGKTFANQPLEVV 141

 Score = 38.5 bits (88), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 35/68 (51%), Gaps = 7/68 (10%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL 808
            PF+    ++ E+F+ FG +K V++         GFAFVEF   + A  A+D++ G    
Sbjct: 82  FPFDVQESELNEIFSPFGPMKEVKI-------LNGFAFVEFEESESAAKAIDEVNGKTFA 134

Query: 809 GRRLVMQY 816
            + L + Y
Sbjct: 135 NQPLEVVY 142

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 2/61 (3%)

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFK 575
           + V+ FP+     E+ E+F PFG +K + +      A VE+ ++ S   A  ++  K F 
Sbjct: 77  LFVRPFPFDVQESELNEIFSPFGPMKEVKI--LNGFAFVEFEESESAAKAIDEVNGKTFA 134

Query: 576 D 576
           +
Sbjct: 135 N 135

>Scas_316.1
          Length = 483

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 15/89 (16%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD----------- 377
           +F+RN+ Y  TE+     F  FG+++     +D  TG +KG A++ F+D           
Sbjct: 244 IFVRNVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAFRDHMTYKYCIDNA 303

Query: 378 PKEAVQAYI----ELDKQIFQGRLLHILP 402
           P     + +     L + +++GR+L I P
Sbjct: 304 PAAGSTSLLIGDDVLPEYVYEGRVLSISP 332

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/152 (17%), Positives = 53/152 (34%), Gaps = 23/152 (15%)

Query: 688 GFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXX 747
           GFGF  F  ++     +       + GH +++ ++ R+  SN                  
Sbjct: 6   GFGFVSFAVEDDTKEALKQARKAKLKGHLLRVDIAKRRDRSNKPGEGDKPEKKTRTDTIA 65

Query: 748 ----------------------NLPFEATRKDVFE-LFNSFGQLKSVRVPKKFDKSARGF 784
                                 N+P+     +  + +F+ FG +    +PKK D    GF
Sbjct: 66  RDENEEVDEESLLKGKPKLIIRNMPWSCRDPNQLKKIFSRFGTVVEASIPKKRDGKLCGF 125

Query: 785 AFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
           AFV          A++  + + + GR + + +
Sbjct: 126 AFVTMKKLSNCTIALENTKDLKIDGRSVAVDF 157

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 12/65 (18%)

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFK 575
           I V+N PY  T E +   F  FG++K  L        ++   D T+G +  T  AF  F+
Sbjct: 244 IFVRNVPYDATEESLAAHFSKFGQVKYAL-------PVI---DRTTGLAKGT--AFVAFR 291

Query: 576 DGIIY 580
           D + Y
Sbjct: 292 DHMTY 296

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 748 NLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEF 789
           N+P++AT + +   F+ FGQ+K ++ V  +    A+G AFV F
Sbjct: 248 NVPYDATEESLAAHFSKFGQVKYALPVIDRTTGLAKGTAFVAF 290

>Scas_666.11
          Length = 224

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 11/109 (10%)

Query: 333 NILYTTT------EDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYI 386
           +ILY +       E +  K F  FG+L+EV +A + +TG S+ + +I F +  +A  A  
Sbjct: 94  SILYVSRLPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQD 153

Query: 387 ELDKQIFQGRLLHI--LPADAK--KSHRLDEFDLKNMPLKKQ-RELKKK 430
            ++  +  G LL +  LP  AK  K ++  +     M +KK  +ELK++
Sbjct: 154 AMNNYLVMGHLLQVRLLPKGAKIEKLYKYKKRAFTQMKIKKTAKELKER 202

 Score = 34.3 bits (77), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%), Gaps = 5/66 (7%)

Query: 656 ELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGH 715
           ELSK F  F    + +V+   + K  +   S  +GF EF  K+ AN    A++  ++ GH
Sbjct: 109 ELSKYFSQFGD--LKEVRLARNKKTGN---SRHYGFIEFANKDDANIAQDAMNNYLVMGH 163

Query: 716 RIQLKL 721
            +Q++L
Sbjct: 164 LLQVRL 169

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGV-- 805
           LP     +++ + F+ FG LK VR+ + K   ++R + F+EF    +A  A D +     
Sbjct: 101 LPQGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFIEFANKDDANIAQDAMNNYLV 160

Query: 806 --HLLGRRLV 813
             HLL  RL+
Sbjct: 161 MGHLLQVRLL 170

>Kwal_0.250
          Length = 216

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 1/83 (1%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           + +E+      +F+ N+ Y+T+    + LF   G      V LD R G+SKGF  ++F+ 
Sbjct: 51  LTLERFHPGYEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLD-RNGRSKGFGTVIFET 109

Query: 378 PKEAVQAYIELDKQIFQGRLLHI 400
             EA  A  +      +GR+L +
Sbjct: 110 IDEARTALDKFQHFDLEGRILEL 132

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 37/167 (22%), Positives = 63/167 (37%), Gaps = 24/167 (14%)

Query: 639 PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKE 698
           P   IFI NL ++T+   L   FK       A VK   + +      S GFG   F T +
Sbjct: 58  PGYEIFIANLPYSTSWQSLKDLFKACGNPTRADVKLDRNGR------SKGFGTVIFETID 111

Query: 699 QANAVISALDGTVIDGHRIQLKLSHRQGS--------------SNTTXXXXXXXXXXXXX 744
           +A   +       ++G  ++LK  +                  +  T             
Sbjct: 112 EARTALDKFQHFDLEGRILELKRGYGPWEEEPSPVSADVSTTIAPQTENASGEGHKSNTI 171

Query: 745 XXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSAR--GFAFVEF 789
              NLP+   + D+++LF + G ++  R   K+D+  +  G A V +
Sbjct: 172 YVDNLPYATAQSDLYDLFETIGVVE--RAELKYDRKVKPTGAAIVSY 216

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 50/134 (37%), Gaps = 10/134 (7%)

Query: 690 GFAEFRTKEQANAVISALDGTVIDGHRIQLK------LSHRQGSSNTTXXXXXXXXXXXX 743
           G  EF   E  +  I   DG    G  + ++       S R   S               
Sbjct: 2   GTVEFSNTEGVSKAIQKFDGFTFMGRELFVREDKPPPGSMRSEESGAKKLTLERFHPGYE 61

Query: 744 XXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSAR--GFAFVEFLLPKEAENAMDQ 801
               NLP+  + + + +LF + G     R   K D++ R  GF  V F    EA  A+D+
Sbjct: 62  IFIANLPYSTSWQSLKDLFKACGN--PTRADVKLDRNGRSKGFGTVIFETIDEARTALDK 119

Query: 802 LQGVHLLGRRLVMQ 815
            Q   L GR L ++
Sbjct: 120 FQHFDLEGRILELK 133

>CAGL0L12672g complement(1359637..1361685) similar to sp|P37838
           Saccharomyces cerevisiae YPL043w nucleolar protein,
           start by similarity
          Length = 682

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 15/89 (16%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD----------- 377
           +F+RN+ Y  TE+     F  FG ++     +D  TG +KG A++ FKD           
Sbjct: 292 VFVRNVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAFKDEKTYKYCVDNS 351

Query: 378 PKEAVQAYI----ELDKQIFQGRLLHILP 402
           P+    + +     L + +++GR+L + P
Sbjct: 352 PQTGATSLLIGDDVLPEYVYEGRVLAVTP 380

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 36/203 (17%), Positives = 77/203 (37%), Gaps = 34/203 (16%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           ++F++++  + T  +L+  F  F+    A V    + K      S GFGF  F  ++   
Sbjct: 23  TLFVRSIPESVTDEQLADFFSNFAPIRHAVVVKDVNKK------SRGFGFVSFAVEDDTK 76

Query: 702 AVISALDGTVIDGHRIQLKLSHRQ------------------------GSSNTTXXXXXX 737
             +     T +DG ++++ ++ R+                        G  NT       
Sbjct: 77  IALKEARKTKLDGAQLKVDIARRRDRSGKNEDKSAQKEIDRNSSKRSYGDENTEGGEEDE 136

Query: 738 XXXXXXXXX---XNLPFEATR-KDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPK 793
                        N+P+       + ++F  +G +    +P+K D    GFAFV      
Sbjct: 137 SSLLKGKPKLIIRNMPWSCRDPTKLKKIFGKYGVVVDASIPRKRDGKLCGFAFVTMNKIS 196

Query: 794 EAENAMDQLQGVHLLGRRLVMQY 816
             + A++  + + + GR++ + +
Sbjct: 197 NCKKALEDTKNLTIDGRKVAVDF 219

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 748 NLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEF 789
           N+P++AT + +F+ F+ FG +K ++ V  K    A+G AFV F
Sbjct: 296 NVPYDATEESLFDHFSKFGPVKYALPVIDKNTGLAKGTAFVAF 338

>YIR005W (IST3) [2670] chr9 (364886..365332) Protein involved in
           splicing and spliceosome assembly, has a role in sodium
           tolerance [447 bp, 148 aa]
          Length = 148

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +++ N+    TE D   +F  +G   +V ++ D  TG+S+GFAY+ ++D +  + A   L
Sbjct: 33  IYIGNLNRELTEGDILTVFSEYGVPVDVILSRDENTGESQGFAYLKYEDQRSTILAVDNL 92

Query: 389 DKQIFQGRLLHI 400
           +     GR L I
Sbjct: 93  NGFKIGGRALKI 104

>Kwal_56.24709
          Length = 828

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 39/83 (46%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +    ++  G L++R I    T DD   +F  FG +  + +  D+ +G S G+ ++ +  
Sbjct: 232 VNAHALTHPGNLYVRGIPKDLTIDDLVPVFSKFGPVLSLKIICDSHSGDSLGYGFLSYPL 291

Query: 378 PKEAVQAYIELDKQIFQGRLLHI 400
             +A +   EL+  +  G  L I
Sbjct: 292 GSQASRCIKELNGNLMNGSALFI 314

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/91 (19%), Positives = 43/91 (47%), Gaps = 19/91 (20%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVAL------------------DTRTGKSKGF 370
           L+++++  +  ++DF + +  FGE+    +                    +   G SKG+
Sbjct: 612 LYVKHLPMSWRDEDFFQFYENFGEIISAKIITVGGSKNDGIGEDGAAKQSEPALGSSKGY 671

Query: 371 AYILFKDPKEAVQAYIELDK-QIFQGRLLHI 400
            ++ FK+P +A +A +  D+ Q+ +   L++
Sbjct: 672 GFVCFKNPLDASRAMMITDRYQVDENHTLYV 702

>CAGL0L03806g 438388..439155 similar to sp|P53927 Saccharomyces
           cerevisiae YNL110c, hypothetical start
          Length = 255

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 2/69 (2%)

Query: 340 EDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLH 399
           E +  K F  FG+L+EV +A + +TG S+ + ++ F +  ++  AY  ++  +  G LL 
Sbjct: 138 ERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTMNNYLLMGHLLQ 197

Query: 400 I--LPADAK 406
           +  LP  +K
Sbjct: 198 VRLLPKGSK 206

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           LP     +++ + F+ FG LK VR+ + K   ++R + FV+F+   ++  A D +    L
Sbjct: 132 LPKGFHERELSKYFSQFGDLKEVRLARNKKTGNSRHYGFVQFVNTDDSRVAYDTMNNYLL 191

Query: 808 LGRRL 812
           +G  L
Sbjct: 192 MGHLL 196

>AFL050W [3143] [Homologous to ScYPL178W (CBC2) - SH]
           complement(345624..346280) [657 bp, 218 aa]
          Length = 218

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 39/71 (54%)

Query: 320 MEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPK 379
           + K   +  +++ N+ + T+E+   +LF   G +E++ + LD       GF +I+++ P+
Sbjct: 39  LRKSMTSATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQ 98

Query: 380 EAVQAYIELDK 390
           EA+ A   L K
Sbjct: 99  EALAALKYLSK 109

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           NL F  + + ++ELF+  G ++ + +   +F  +  GF F+ +  P+EA  A+  L    
Sbjct: 52  NLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALAALKYLSKTK 111

Query: 807 LLGRRLVM 814
           L  R + +
Sbjct: 112 LDDREITI 119

>KLLA0D11792g 1005079..1007136 similar to sp|P37838 Saccharomyces
           cerevisiae YPL043w NOP4 nucleolar protein, start by
           similarity
          Length = 685

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL 808
           +PFE+T ++    F+ F  +K   + K  + ++RGF FV F +  + + A++Q +    +
Sbjct: 22  VPFESTDEEFGNFFSQFSPIKHAVIVKDGEGASRGFGFVSFAVEDDTKTALNQARKTKFM 81

Query: 809 GRRL 812
           GR L
Sbjct: 82  GRLL 85

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 43/89 (48%), Gaps = 15/89 (16%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD----------- 377
           +F+RN+ Y  T++   + FG FG ++     +D  TG +KG A++ F+            
Sbjct: 298 IFVRNVPYDATQESLERHFGVFGPVKYALPVIDKETGLAKGTAFVAFRSEDAYNDCLNNA 357

Query: 378 PKEAVQAYIELD----KQIFQGRLLHILP 402
           P     + +  D    + +++GR+L I P
Sbjct: 358 PATGSTSLLISDDVSPEYVYEGRVLAISP 386

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+R + + +T+++F   F  F  ++   +  D   G S+GF ++ F    +   A  + 
Sbjct: 17  LFVRGVPFESTDEEFGNFFSQFSPIKHAVIVKDG-EGASRGFGFVSFAVEDDTKTALNQA 75

Query: 389 DKQIFQGRLLHI 400
            K  F GRLL I
Sbjct: 76  RKTKFMGRLLRI 87

>Kwal_26.7522
          Length = 262

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++L +I Y  TE+    L    G +  + +  D +TGKSKG+A++ +KD + +  A   L
Sbjct: 14  VYLGSIPYDQTEEQILDLCSNVGPVVNLKMMFDPQTGKSKGYAFVEYKDLEASASAVRNL 73

Query: 389 DKQIFQGRLL 398
           +      RLL
Sbjct: 74  NGYQLGNRLL 83

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 41/69 (59%), Gaps = 6/69 (8%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLQG 804
           ++P++ T + + +L ++ G + ++++   FD     ++G+AFVE+   + + +A+  L G
Sbjct: 18  SIPYDQTEEQILDLCSNVGPVVNLKM--MFDPQTGKSKGYAFVEYKDLEASASAVRNLNG 75

Query: 805 VHLLGRRLV 813
              LG RL+
Sbjct: 76  YQ-LGNRLL 83

>AGR390C [4701] [Homologous to ScYNL016W (PUB1) - SH]
           (1446842..1447978) [1137 bp, 378 aa]
          Length = 378

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 77/182 (42%), Gaps = 29/182 (15%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           +++ NL+ T     L + F+   G  +A VK   D  + +      + F E+R    AN 
Sbjct: 37  LYVGNLDKTINEATLKQYFQV--GGPIANVKVLVDKNNEEAN----YAFVEYRQPRDANV 90

Query: 703 VISALDGTVIDGHRIQLKLS--HRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFE 760
               LDG  I+ + I++  +   +Q SS+ T                    + T    F+
Sbjct: 91  AFQTLDGKQIENNVIKINWAFQSQQVSSDDTFNLFVGDLNVDVD-------DETLSSTFK 143

Query: 761 LFNSFGQ------LKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814
            F +F Q      ++S R        +RG+ FV F   +EA+ AMD  QG +L GR + +
Sbjct: 144 EFPTFIQAHVMWDMQSGR--------SRGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRV 195

Query: 815 QY 816
            +
Sbjct: 196 NW 197

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 46/105 (43%), Gaps = 5/105 (4%)

Query: 627 NEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLS 686
           N   + + V+   T ++F+ +LN       LS  FK F  F+ A V             S
Sbjct: 108 NWAFQSQQVSSDDTFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWD-----MQSGRS 162

Query: 687 MGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTT 731
            G+GF  F  +E+A   + A  G  ++G  I++  + ++ S +  
Sbjct: 163 RGYGFVSFGEQEEAQKAMDAKQGFNLNGRAIRVNWAAKRESQHAA 207

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 31/59 (52%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           T  LF+ ++     ++     F  F    + HV  D ++G+S+G+ ++ F + +EA +A
Sbjct: 121 TFNLFVGDLNVDVDDETLSSTFKEFPTFIQAHVMWDMQSGRSRGYGFVSFGEQEEAQKA 179

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 39/87 (44%), Gaps = 12/87 (13%)

Query: 3   RIIVKG-LPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYH 61
           RI+  G L   + +  LKQ+F+           +   I +VK+L ++  E   +AF+ Y 
Sbjct: 35  RILYVGNLDKTINEATLKQYFQ-----------VGGPIANVKVLVDKNNEEANYAFVEYR 83

Query: 62  NEEDAFDAVNYFNGSYINTAKLEVSMA 88
              DA  A    +G  I    ++++ A
Sbjct: 84  QPRDANVAFQTLDGKQIENNVIKINWA 110

>Scas_643.16
          Length = 448

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 11/131 (8%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ N+ +   E++    F   GE+E V +  D +T   KGFAY+ FK+ +   +A +  
Sbjct: 277 IFVGNLDFEEDEENLWNHFKSCGEIEYVRIIRDPKTNMGKGFAYVQFKELESVNKALLLN 336

Query: 389 DKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQD 448
           +KQ+ +   +     + KK  +L     KNM        +K +N      + N L  +Q 
Sbjct: 337 EKQMTK---IKTDKDNKKKGRKLRVTRCKNM--------RKSNNTVSNIKNNNKLSESQR 385

Query: 449 AVLGSVAAKLG 459
             +G     LG
Sbjct: 386 TKVGRAQKVLG 396

>Scas_621.16
          Length = 314

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++L +I Y  TE+    L    G +  + +  D +TGKSKG+A+I FKD + +  A   L
Sbjct: 46  VYLGSIPYDQTEEQILDLCNNVGPVINLKMMFDPQTGKSKGYAFIEFKDLETSASAIRNL 105

Query: 389 DKQIFQGRLL 398
           +      R L
Sbjct: 106 NGYQLGSRFL 115

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 5/71 (7%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLQGV 805
           +P++ T + + +L N+ G + ++++   FD     ++G+AF+EF   + + +A+  L G 
Sbjct: 51  IPYDQTEEQILDLCNNVGPVINLKM--MFDPQTGKSKGYAFIEFKDLETSASAIRNLNGY 108

Query: 806 HLLGRRLVMQY 816
            L  R L   Y
Sbjct: 109 QLGSRFLKCGY 119

>Scas_376.1
          Length = 404

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 79/186 (42%), Gaps = 13/186 (6%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFS-----GFVVAQ--VKTKPDPKHAD--KTLSMGFGFAE 693
           ++I NL F TT  EL K F   +     G V  +  V+      H D  K  + GF + +
Sbjct: 129 VWIGNLTFDTTKEELIKLFTAKTRENEVGKVTEEDIVRVHMPLAHNDGKKIKNKGFCYMD 188

Query: 694 FRTKEQANAVISALDGTVIDGHRIQLK--LSHRQGSSNTTXXXXXXXXXXXXXXXXNLPF 751
           F+T EQ  ++I  L  + ++G  + +K   S+                        NL F
Sbjct: 189 FKTNEQMESIIK-LSESQLNGRNMLIKDSKSYEGRPDKNDLVSLSKNPPSRILFVGNLSF 247

Query: 752 EATRKDVFELFNSFGQLKSVRVPKKFDKS-ARGFAFVEFLLPKEAENAMDQLQGVHLLGR 810
           + T + + + F   G++  +R+    D    +GFAF++F   + A NA+       +  R
Sbjct: 248 DTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNALKDKTCRKIAAR 307

Query: 811 RLVMQY 816
            + M+Y
Sbjct: 308 PIRMEY 313

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           LF+ N+ + TT++  +K F   GE+ ++ +A    +GK KGFA+I F+  + A  A
Sbjct: 240 LFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDSGKCKGFAFIDFRSEEGATNA 295

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 5/66 (7%)

Query: 639 PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKE 698
           P+  +F+ NL+F TT   L K F+     V  ++ T       D     GF F +FR++E
Sbjct: 236 PSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMAT-----FQDSGKCKGFAFIDFRSEE 290

Query: 699 QANAVI 704
            A   +
Sbjct: 291 GATNAL 296

>Scas_717.41
          Length = 379

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 50/99 (50%), Gaps = 18/99 (18%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           T RLF+R   +   E +  ++F PFG ++EV +          GFA++ F++   A +A 
Sbjct: 82  TTRLFVRPFPFDVQEAELNEIFTPFGPMKEVKIL--------NGFAFVEFEEADSAAKAI 133

Query: 386 IELDKQIFQGRLLHI----LPADAKKSHRLDEFDLKNMP 420
            E++ + F  + L +    LP    K +RL    L+N+P
Sbjct: 134 EEVNGKTFANQPLEVVYSKLPV---KRYRL---TLRNLP 166

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL 808
            PF+    ++ E+F  FG +K V++         GFAFVEF     A  A++++ G    
Sbjct: 90  FPFDVQEAELNEIFTPFGPMKEVKI-------LNGFAFVEFEEADSAAKAIEEVNGKTFA 142

Query: 809 GRRLVMQY 816
            + L + Y
Sbjct: 143 NQPLEVVY 150

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFK 575
           + V+ FP+     E+ E+F PFG +K + +      A VE+ +  S   A  ++  K F 
Sbjct: 85  LFVRPFPFDVQEAELNEIFTPFGPMKEVKI--LNGFAFVEFEEADSAAKAIEEVNGKTFA 142

Query: 576 D 576
           +
Sbjct: 143 N 143

>CAGL0I09900g 946717..947352 similar to sp|Q99181 Saccharomyces
           cerevisiae YOR319w essential yeast splicing factor,
           hypothetical start
          Length = 211

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQL 802
           N+  + T++ ++ELF   GQ+K V+ PK K  +  +GFAF+EF    +A+  ++ +
Sbjct: 12  NIDTKVTKELLYELFTQVGQVKKVKYPKDKISQEYQGFAFIEFFSTADADYVLNVM 67

>Sklu_2407.3 YNL110C, Contig c2407 3664-4329 reverse complement
          Length = 221

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 37/62 (59%)

Query: 340 EDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLH 399
           E +  K F  FG+L++V +A + +TG S+ +A+I F +  +A+ A   ++  +  G LL 
Sbjct: 105 ERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQDTMNNYLILGHLLK 164

Query: 400 IL 401
           ++
Sbjct: 165 VV 166

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           LP     +++ + F+ FG LK VR+ + K   ++R +AF+EF+   +A  A D +    +
Sbjct: 99  LPQGFHERELSKYFSQFGDLKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQDTMNNYLI 158

Query: 808 LGRRL 812
           LG  L
Sbjct: 159 LGHLL 163

 Score = 29.6 bits (65), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 39  ITDVKILRNRE-GESRKFAFIGYHNEEDAFDAVNYFNGSYI 78
           +  V++ RN++ G SR +AFI + N++DA  A +  N   I
Sbjct: 118 LKQVRLARNKKTGNSRHYAFIEFVNKDDALVAQDTMNNYLI 158

>Scas_598.1
          Length = 516

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 30/49 (61%)

Query: 328 RLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFK 376
           +LF+  + + TTED  +  F  +G + ++ +  D  TG+S+GF ++ F+
Sbjct: 201 KLFIGGLNWETTEDKLKDYFSKYGNVVDLKIMKDNATGRSRGFGFLTFE 249

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVAL---DTRTGKSKGFAYIL 374
           I  E+  KTG++F+  I       +F + F  +G + +  + L   D  TG+S+GF +I 
Sbjct: 275 IPREEQDKTGKIFVGGIGPDVRPKEFEEFFAQWGTIIDAQLMLLMLDKDTGRSRGFGFIT 334

Query: 375 FKDPKEAVQAYIELDKQIFQGRLLHI 400
           + D  EAV    +     F+G+ + I
Sbjct: 335 Y-DSSEAVDRVCQNKYIDFKGKQIEI 359

>AFR649W [3842] [Homologous to NOHBY] complement(1619141..1620073)
           [933 bp, 310 aa]
          Length = 310

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           +F+  LN  T + +L+  F  F       V +    +  D   S+G+GF EF TK     
Sbjct: 232 LFVCKLNPLTRAADLATVFAQF-----GHVNSVEIIRDRDSGRSLGYGFVEFATKAACEL 286

Query: 703 VISALDGTVIDGHRIQLKLSH 723
             + +DG +ID  R+ +  S 
Sbjct: 287 AYTKMDGALIDDRRVHVDFSQ 307

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+  +   T   D   +F  FG +  V +  D  +G+S G+ ++ F        AY ++
Sbjct: 232 LFVCKLNPLTRAADLATVFAQFGHVNSVEIIRDRDSGRSLGYGFVEFATKAACELAYTKM 291

Query: 389 DKQIFQGRLLHI 400
           D  +   R +H+
Sbjct: 292 DGALIDDRRVHV 303

>Kwal_27.11832
          Length = 686

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/190 (20%), Positives = 79/190 (41%), Gaps = 21/190 (11%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           ++F++++ F  T  EL+  F   +    A V  K D K+     S GFGF  F  ++   
Sbjct: 22  TLFVRSIPFDATDEELANYFSNLAPIKHA-VIVKDDQKN-----SRGFGFVSFAVEDDTK 75

Query: 702 AVISALDGTVIDGHRIQLKLSHRQ-----------GSSNTTXXXXXXXX---XXXXXXXX 747
             +     T   G  +++ ++ R+           GS +T+                   
Sbjct: 76  DALDKARKTKFKGRLLRVDIAKRRDRTKKDQNAAAGSEDTSGPQDKEDELLGGKPKLIVR 135

Query: 748 NLPFEATRKDVFE-LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           N+P+     D  + +F  +G +   ++PK+ D    GFAFV        + A+++ + + 
Sbjct: 136 NMPWSVRNPDELKKIFMRYGTVVEAKIPKRPDGKLCGFAFVTMKKLASCKIAIEESKSLK 195

Query: 807 LLGRRLVMQY 816
           + GR++ + +
Sbjct: 196 IGGRQVAVDF 205

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 15/90 (16%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD----------- 377
           +F+RN+ Y  T++   + F  FG ++      D  TG +KG A+++F+            
Sbjct: 293 VFVRNVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVFQTQEAFDECVNNA 352

Query: 378 PKEAVQAYIELD----KQIFQGRLLHILPA 403
           P     + +  D    + ++ GR+L I PA
Sbjct: 353 PASGTTSLLISDDVPYRYVYDGRILSIAPA 382

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+R+I +  T+++    F     ++   +  D +   S+GF ++ F    +   A  + 
Sbjct: 23  LFVRSIPFDATDEELANYFSNLAPIKHAVIVKDDQKN-SRGFGFVSFAVEDDTKDALDKA 81

Query: 389 DKQIFQGRLLHI 400
            K  F+GRLL +
Sbjct: 82  RKTKFKGRLLRV 93

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 748 NLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEF 789
           N+P++AT++ + E FN FG +K ++ V  K    A+G AFV F
Sbjct: 297 NVPYDATQESLEEHFNKFGPVKYALPVQDKETGLAKGSAFVVF 339

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 508 PEQRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLL 544
           P +++   + V+N PY  T+E + E F  FG +K  L
Sbjct: 285 PNKKEQLAVFVRNVPYDATQESLEEHFNKFGPVKYAL 321

>ADR017W [1758] [Homologous to ScYIR005W (IST3) - SH]
           complement(734486..735007) [522 bp, 173 aa]
          Length = 173

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 56/118 (47%), Gaps = 11/118 (9%)

Query: 40  TDVKILRNRE-GESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQ 98
           TD+K++R+RE GESR F F+ Y ++     AV+  NG  +N     + +   F +PR   
Sbjct: 61  TDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNG--VNLCGRVLKVDHCFYEPR--- 115

Query: 99  PMKERKREALKRFREKEERLLAESDXXXXXXXXXXRRLSIDAEISKNKQLQEFIETMK 156
              +     +K  RE+  R L + +            L+ DAE++    + EF+ + K
Sbjct: 116 ---DEDEAYVKTVREELARDLVDVEVGTTAPIQGKITLTEDAELA--DPMGEFLSSKK 168

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%)

Query: 339 TEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLL 398
           TE D   +F  FG   ++ +  D  TG+S+GF ++ ++D +  V A   L+     GR+L
Sbjct: 46  TEGDILTVFSQFGVPTDLKLVRDRETGESRGFGFLKYEDQRSTVLAVDNLNGVNLCGRVL 105

Query: 399 HI 400
            +
Sbjct: 106 KV 107

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 748 NLPFEATRKDVFELFNSFG---QLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQG 804
            L  E T  D+  +F+ FG    LK VR   +    +RGF F+++   +    A+D L G
Sbjct: 40  GLNVELTEGDILTVFSQFGVPTDLKLVR--DRETGESRGFGFLKYEDQRSTVLAVDNLNG 97

Query: 805 VHLLGRRL 812
           V+L GR L
Sbjct: 98  VNLCGRVL 105

>YBR212W (NGR1) [393] chr2 (647843..649861) Glucose-repressible
           RNA-binding protein, has 2 RNA recognition (RRM) domains
           and a glutamine-rich region [2019 bp, 672 aa]
          Length = 672

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 98/229 (42%), Gaps = 21/229 (9%)

Query: 329 LFLRNILYTTTEDDFRKLFGP-FGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           LF+ ++  T TE D   LF   F  ++ V V  D  TG S+ F ++ F D  E  +A IE
Sbjct: 194 LFVGDLSPTATEADLLSLFQTRFKSVKTVRVMTDPLTGSSRCFGFVRFGDEDERRRALIE 253

Query: 388 LDKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQ 447
           +  + FQGR L +  A  +           NM + + +E +++    +Q         N 
Sbjct: 254 MSGKWFQGRALRVAYATPRN----------NM-MLQLQEQQQQQQQLQQQHQQLDQEDNN 302

Query: 448 DAVLGSVAAKLGLKKSDLIDPESSNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKS 507
             +L   A  L    S+++   + ++A    L E  I  ++R       V+ +  + T +
Sbjct: 303 GPLLIKTANNLIQNNSNMLPLNALHNAPPMHLNEGGI-SNMR-------VNDSLPSNTYN 354

Query: 508 PEQRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEY 556
            +  +  V +    P  TT  ++  LF PFG +  + +P       V++
Sbjct: 355 TDPTNTTVFVGGLVP-KTTEFQLRSLFKPFGPILNVRIPNGKNCGFVKF 402

>YFR023W (PES4) [1703] chr6 (199862..201697) Suppressor of DNA
           polymerase epsilon mutation, contains four RNA
           recognition motif (RRM) domains [1836 bp, 611 aa]
          Length = 611

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 73/174 (41%), Gaps = 15/174 (8%)

Query: 641 VSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQA 700
           V +FI +L+ T T   L   FK +  FV A+V      K      S+G G+  F  KE+A
Sbjct: 91  VPLFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKK-----SLGHGYLNFEDKEEA 145

Query: 701 NAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFE 760
              +  L+ T ++G  I++  S R    NTT                N P   TR   ++
Sbjct: 146 EKAMEELNYTKVNGKEIRIMPSLR----NTTFRKNFGTNVFFSNLPLNNPLLTTRV-FYD 200

Query: 761 LFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814
            F+ +G++ S ++      S +   FV F   K A N +         G++++ 
Sbjct: 201 TFSRYGKILSCKL-----DSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILC 249

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 127/308 (41%), Gaps = 46/308 (14%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+ ++  T TE+  + +F  +       V LD+ T KS G  Y+ F+D +EA +A  EL
Sbjct: 93  LFIGDLHETVTEETLKGIFKKYPSFVSAKVCLDSVTKKSLGHGYLNFEDKEEAEKAMEEL 152

Query: 389 DKQIFQGRLLHILPADAKKSHRLD---EFDLKNMPLKKQRELKKKDNASRQTFSWN---- 441
           +     G+ + I+P+    + R +        N+PL       +       TFS      
Sbjct: 153 NYTKVNGKEIRIMPSLRNTTFRKNFGTNVFFSNLPLNNPLLTTR---VFYDTFSRYGKIL 209

Query: 442 SLYMNQDAVLGSVAAKLGLKKSDLIDPESSNSAV-KQALAEAHIIGDVRKY--FESKGVD 498
           S  ++    +G V  +      ++I   ++ S   K+ L   H   +VR    FE++   
Sbjct: 210 SCKLDSRKDIGFVYFEDEKTARNVIKMYNNTSFFGKKILCGIHFDKEVRSVPNFETQKSR 269

Query: 499 L---TKFAQTKSPEQRDAK---------------VILVKNFPYGTTREEIGELFLPFGKL 540
           L   T   + +S  ++ +K                I +KN P  TTR++I   F   G +
Sbjct: 270 LDAETIIEKEQSLNEKHSKGNDKESKNIYSSSQNSIFIKNLPTITTRDDILNFFSEVGPI 329

Query: 541 KRLLMPPSGTI----AIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCFTR---DA 593
           K + +  +  +    A V Y++++         A KR+ +   +  +G K   TR     
Sbjct: 330 KSIYLSNATKVKYLWAFVTYKNSSDSEK-----AIKRYNN---FYFRGKKLLVTRAQDKE 381

Query: 594 EPADLIEA 601
           E A  IE+
Sbjct: 382 ERAKFIES 389

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           NLP   TR D+   F+  G +KS+ +     K    +AFV +    ++E A+ +    + 
Sbjct: 309 NLPTITTRDDILNFFSEVGPIKSIYLSNA-TKVKYLWAFVTYKNSSDSEKAIKRYNNFYF 367

Query: 808 LGRRLVM 814
            G++L++
Sbjct: 368 RGKKLLV 374

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 12/86 (13%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           I +K LP+  T D++       LN   +  PI S+      L N       +AF+ Y N 
Sbjct: 305 IFIKNLPTITTRDDI-------LNFFSEVGPIKSIY-----LSNATKVKYLWAFVTYKNS 352

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89
            D+  A+  +N  Y    KL V+ A+
Sbjct: 353 SDSEKAIKRYNNFYFRGKKLLVTRAQ 378

>YNL004W (HRB1) [4581] chr14 (623331..624620) Protein with
           similarity to Rlf6p, contains three RNA recognition
           motif (RRM) domains [1290 bp, 429 aa]
          Length = 429

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 66/325 (20%), Positives = 118/325 (36%), Gaps = 61/325 (18%)

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRL-LMPPSG---TIAIVEYRDTTSGRSAFTKLAF 571
           I V N  Y +T E++ E F   GK+ R  ++   G    +  VE+ ++          A 
Sbjct: 138 IFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRGHHRGMGTVEFTNSDD-----VDRAI 192

Query: 572 KRFKDGIIYLEKGPKDCFTRDAEPADLIEADAPEENVVEVKDTVKEIMDSTDKTSNEEHE 631
           +++ DG  ++++     F R   P        P  N+ E K   +  +    KT    HE
Sbjct: 193 RQY-DGAFFMDR---KIFVRQDNPP-------PSNNIKERKALDRGELRHNRKT----HE 237

Query: 632 DEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGF 691
                      + +KNL  +     L   FK       A V+   D       +S G G 
Sbjct: 238 -----------VIVKNLPASVNWQALKDIFKECGNVAHADVELDGD------GVSTGSGT 280

Query: 692 AEFRTKEQANAVISALDGTVIDGHRIQLK-----LSHRQG---------------SSNTT 731
             F   +  +  I   +G  I+G+ + +K      +H  G               +   T
Sbjct: 281 VSFYDIKDLHRAIEKYNGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVNEEARKFT 340

Query: 732 XXXXXXXXXXXXXXXXNLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLL 791
                           NLPF   + D+++LF + G++ +  +      +  G A VE+  
Sbjct: 341 ENVVGGGERNRLIYCSNLPFSTAKSDLYDLFETIGKVNNAELRYDSKGAPTGIAVVEYDN 400

Query: 792 PKEAENAMDQLQGVHLLGRRLVMQY 816
             +A+  +++L   +  G  L + Y
Sbjct: 401 VDDADVCIERLNNYNYGGCDLDISY 425

>KLLA0D13420g complement(1157491..1157991) some similarities with
           sp|P40565 Saccharomyces cerevisiae YIR005w IST3
           singleton, hypothetical start
          Length = 166

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%)

Query: 339 TEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLL 398
           TE D   +F  +G   ++ +  D  TGKSKGF ++ ++D +  + A   L+     GRL+
Sbjct: 46  TEADILTIFSQYGCPVDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLI 105

Query: 399 HI 400
            +
Sbjct: 106 RV 107

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 40  TDVKILRNRE-GESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPR 95
            D+K++R++  G+S+ F F+ Y ++     AV+  NG+ +    + V  A  F  PR
Sbjct: 61  VDIKLVRDQTTGKSKGFGFLKYEDQRSTILAVDNLNGAKVCGRLIRVDHA--FYRPR 115

>Sklu_2221.8 YDR429C, Contig c2221 11550-12395 reverse complement
          Length = 281

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 344 RKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLH 399
           ++L  PFG + +V V  +T TG+S+G +YI F+  + A  A   LD + F   +LH
Sbjct: 216 QELLFPFGRIPKVVVVRNTETGRSRGISYITFETEEIAETALNFLDGRGFMNLILH 271

>AGR010C [4320] [Homologous to ScYGL044C (RNA15) - SH]
           (736609..737409) [801 bp, 266 aa]
          Length = 266

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 34/72 (47%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++L +I Y  TE     L    G +  + +  D +TGKSKG+A+I FKD   +  A   L
Sbjct: 13  VYLGSIPYDQTEQQILDLCSNVGPVTGLKMMFDPQTGKSKGYAFIEFKDLATSSSAVRNL 72

Query: 389 DKQIFQGRLLHI 400
           +      R L  
Sbjct: 73  NGYALGNRTLKC 84

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLQG 804
           ++P++ T + + +L ++ G +  +++   FD     ++G+AF+EF     + +A+  L G
Sbjct: 17  SIPYDQTEQQILDLCSNVGPVTGLKM--MFDPQTGKSKGYAFIEFKDLATSSSAVRNLNG 74

Query: 805 VHLLGRRLVMQY 816
             L  R L   Y
Sbjct: 75  YALGNRTLKCGY 86

>CAGL0M12573g 1246128..1247027 similar to sp|Q00916 Saccharomyces
           cerevisiae YIL061c SNP1 U1 small nuclear
           ribonucleoprotein, hypothetical start
          Length = 299

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           +F+  + Y T E   +K+F  +GE+  V V  D +  KS+G+A++LFK+
Sbjct: 117 VFVGRLPYDTDEVQLQKVFAKYGEIVRVRVVRD-KQNKSRGYAFVLFKE 164

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 9/72 (12%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENA------MDQL 802
           LP++     + ++F  +G++  VRV +     +RG+AFV F   KE ++A      +   
Sbjct: 122 LPYDTDEVQLQKVFAKYGEIVRVRVVRDKQNKSRGYAFVLF---KETDSARVCTRDIGVH 178

Query: 803 QGVHLLGRRLVM 814
           +G+ + GRR ++
Sbjct: 179 RGIQINGRRCIV 190

>YGL044C (RNA15) [1933] chr7 complement(416148..417038) Component of
           pre-mRNA cleavage and polyadenylation factor I (CFI),
           involved in poly(A) site choice, interacts with Rna14p,
           Pap1p, and Pcf11p, contains one RNA recognition (RRM)
           domain [891 bp, 296 aa]
          Length = 296

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++L +I Y  TE+    L    G +  + +  D +TG+SKG+A+I F+D + +  A   L
Sbjct: 20  VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNL 79

Query: 389 DKQIFQGRLL 398
           +      R L
Sbjct: 80  NGYQLGSRFL 89

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLQG 804
           ++P++ T + + +L ++ G + ++++   FD     ++G+AF+EF   + + +A+  L G
Sbjct: 24  SIPYDQTEEQILDLCSNVGPVINLKM--MFDPQTGRSKGYAFIEFRDLESSASAVRNLNG 81

Query: 805 VHLLGRRLVMQY 816
             L  R L   Y
Sbjct: 82  YQLGSRFLKCGY 93

>AEL217W [2289] [Homologous to ScYGR250C - SH]
           complement(225217..227721) [2505 bp, 834 aa]
          Length = 834

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 38/78 (48%)

Query: 323 ISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAV 382
           ++  G L++R I    + DD   +F  FG +  + + +D  T +S G+ +I +    +A 
Sbjct: 213 LTHPGNLYIRGIPKDLSVDDLIPIFSKFGTVLSLKIIIDGNTRESLGYGFISYPLGSQAA 272

Query: 383 QAYIELDKQIFQGRLLHI 400
           +   EL+  +  G  L I
Sbjct: 273 RCIKELNGNLMNGSPLFI 290

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 42/88 (47%), Gaps = 17/88 (19%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHV--------------AL-DTRTGKSKGFAYI 373
           L++++I  +  ++D    +  +GE+    +              AL D   G S+G+ ++
Sbjct: 601 LYVKHIPLSWRDEDLNDFYSQYGEIISAKIITVGGSKNEIGESKALEDVPVGTSRGYGFV 660

Query: 374 LFKDPKEAVQAYIELDKQIFQGRLLHIL 401
            FK+P +A +A +  D+  FQ    H+L
Sbjct: 661 CFKNPLDASRAMMATDR--FQVGTNHVL 686

>KLLA0F09383g 865710..866486 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I singleton, hypothetical start
          Length = 258

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 33/70 (47%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++L +I Y  TE     L    G +  + +  D  TGKSKG+A+I FKD   +  A   L
Sbjct: 10  VYLGSIPYDQTEQQILDLCQTIGPVTAMKMMFDPTTGKSKGYAFIEFKDLATSASAVRNL 69

Query: 389 DKQIFQGRLL 398
           +      R L
Sbjct: 70  NGYTLGSRSL 79

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLQG 804
           ++P++ T + + +L  + G + ++++   FD +   ++G+AF+EF     + +A+  L G
Sbjct: 14  SIPYDQTEQQILDLCQTIGPVTAMKM--MFDPTTGKSKGYAFIEFKDLATSASAVRNLNG 71

Query: 805 VHLLGRRLVMQY 816
             L  R L   Y
Sbjct: 72  YTLGSRSLKCGY 83

>ACR274W [1321] [Homologous to ScYOL041C (NOP12) - SH]
           complement(854587..855867) [1281 bp, 426 aa]
          Length = 426

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ N+ +  +E+   K F   G +E V +  D +T   KGFAY+ F D     +A +  
Sbjct: 261 VFVGNLDFEESEESLWKHFMSCGPIEYVRIVRDPKTNVGKGFAYVQFADLVSVNKALLLN 320

Query: 389 DKQ--IFQGRLLHI 400
           DK+  + +GR L +
Sbjct: 321 DKKMAVGKGRKLRV 334

>CAGL0F01023g complement(108155..109345) similar to tr|Q08208
           Saccharomyces cerevisiae YOL041c NOP12, hypothetical
           start
          Length = 396

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYI 386
           +F+ N+ +   E+   K FG  G +E V +  D +T   KGFAY+ F + +   +A +
Sbjct: 230 VFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQFNELQSVSKALL 287

>Kwal_26.8458
          Length = 219

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 331 LRNILYTTT------EDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           L  I+Y +       E +  K F  FG+L EV +A + +TG S+ + ++ F + +++  A
Sbjct: 88  LSGIIYVSRLPKGFHERELAKYFSQFGDLREVRLARNKKTGNSRHYGFVEFVNKEDSFVA 147

Query: 385 YIELDKQIFQGRLLHIL 401
              +   +  G LL ++
Sbjct: 148 QETMHNYLLMGHLLQVV 164

>AAR151W [339] [Homologous to ScYBR212W (NGR1) - SH]
           complement(617434..618879) [1446 bp, 481 aa]
          Length = 481

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGP-FGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           LF+ ++  T TE     LF   F  ++ V V  D  TG S+ F ++ F D KE  +A  E
Sbjct: 164 LFVGDLSPTATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAE 223

Query: 388 LDKQIFQGRLLHI 400
           ++    QGR L +
Sbjct: 224 MNGVWCQGRQLRV 236

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 753 ATRKDVFELFNS-FGQLKSVRV-PKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGR 810
           AT   +  LF + F  +K+VRV       ++R F FV F   KE   A+ ++ GV   GR
Sbjct: 173 ATEAHLLSLFQTKFKSVKTVRVMTDPITGASRCFGFVRFADEKERRRALAEMNGVWCQGR 232

Query: 811 RLVMQY 816
           +L + Y
Sbjct: 233 QLRVAY 238

>KLLA0C05522g 494240..495862 some similarities with sp|P32831
           Saccharomyces cerevisiae YBR212w NGR1
           glucose-repressible RNA-binding protein, hypothetical
           start
          Length = 540

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGP-FGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           LF+ ++    TE D   LF   +  ++ V V  D  TG S+ F ++ F +  E   A IE
Sbjct: 161 LFVGDLSPFATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALIE 220

Query: 388 LDKQIFQGRLLHI 400
           ++   FQGR L +
Sbjct: 221 MNGVQFQGRQLRV 233

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 750 PFEATRKDVFELFNS-FGQLKSVRV-PKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           PF AT  D+  LF + +  +K+VRV       ++R F FV F    E  NA+ ++ GV  
Sbjct: 168 PF-ATEADLLSLFQTKYNSVKTVRVMTDPITGASRCFGFVRFANETERRNALIEMNGVQF 226

Query: 808 LGRRLVMQY 816
            GR+L + Y
Sbjct: 227 QGRQLRVAY 235

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 5/59 (8%)

Query: 758 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
           +FELF  FG +  V++P       +   FV++    EAE A++ LQG  ++G  + + +
Sbjct: 461 LFELFKPFGTITDVKIPP-----GKQCGFVKYNERLEAEAAINGLQGFIIMGSPIRLSW 514

>Scas_558.1
          Length = 435

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 40/71 (56%), Gaps = 4/71 (5%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSAR--GFAFVEFLLPKEAENAMDQLQGV 805
           NLP    R D+++LF S G++++  +  K+D++    G A VEF+   +A+  +++L   
Sbjct: 363 NLPPSTARSDLYDLFESIGKVRNAEL--KYDRNGETTGVAIVEFISQDDADVCIERLNKY 420

Query: 806 HLLGRRLVMQY 816
           +  G  L + Y
Sbjct: 421 NYGGCDLEISY 431

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 8/71 (11%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILF---KDPKEAVQAY 385
           +F+ N+ Y  T +D R  F   GE+  V   + T  G  +G   + F   +D +EA++ Y
Sbjct: 107 IFVGNLTYDCTPEDLRDYFSGIGEV--VRADIITSKGHHRGMGTVEFTNSRDVEEAIRQY 164

Query: 386 IE---LDKQIF 393
                +D+QIF
Sbjct: 165 DSSYFMDRQIF 175

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 46/99 (46%), Gaps = 6/99 (6%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ N+ Y+      + +F   G++    V LD R G+S+GF  ++F+   +  +A    
Sbjct: 223 IFVANLPYSINWQALKDMFKECGDVMRADVELD-RAGRSRGFGTVIFRTRDDMERAIDRY 281

Query: 389 DKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQREL 427
           ++    GR L     D ++ H  +  D  N+  + Q  +
Sbjct: 282 NRFEVDGRTL-----DVREGHSNNRNDDMNIQHQTQNAM 315

>CAGL0H03267g 306150..308477 similar to sp|P38996 Saccharomyces
           cerevisiae YPL190c NAB3 polyadenylated RNA-binding
           protein, hypothetical start
          Length = 775

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 10/73 (13%)

Query: 320 MEKISKTGRLFLRNI-LYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDP 378
           M  I    RLF+ N+ L   ++ D  +LF PFG + ++++           F +I + +P
Sbjct: 323 MHSIPPKSRLFIGNLPLKNVSKQDLFRLFSPFGHILQINI--------KNAFGFIQYDNP 374

Query: 379 KEAVQAYIELDKQ 391
           K +V+A IE + Q
Sbjct: 375 K-SVRAAIECESQ 386

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 748 NLPFE-ATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           NLP +  +++D+F LF+ FG +  + +          F F+++  PK    A++      
Sbjct: 336 NLPLKNVSKQDLFRLFSPFGHILQINI-------KNAFGFIQYDNPKSVRAAIECESQEI 388

Query: 807 LLGRRLVMQ 815
             G++L+++
Sbjct: 389 NFGKKLILE 397

>CAGL0H03861g complement(361189..362520) similar to sp|P38922
           Saccharomyces cerevisiae YNL004w HRB1, start by
           similarity
          Length = 443

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 95/216 (43%), Gaps = 49/216 (22%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           L + N+ Y+ +    + +F  FG++ + +V +D+ TG S G   ++FK+ ++ V+AY   
Sbjct: 219 LMILNLPYSISWQTLKTMFKEFGDVLKANVEVDS-TGMSIGVGNVIFKNQEDMVKAYEHF 277

Query: 389 DKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSLYMNQD 448
           +    +G++L +                     + Q     + +++R+T   + L +NQD
Sbjct: 278 NGFEIEGKVLEV---------------------RGQIPDPTQISSTRKT---DDLTVNQD 313

Query: 449 AVLGSVAAKLGLKKSDL-IDPESSNSAVKQAL-AEAHIIGDVRKYFESKGVDLTKFAQTK 506
                          D+ +D +++    ++AL A+    G  R           KF+   
Sbjct: 314 -------------NEDIEMDIDTAEGGDEKALKADVSSDGGARA--------QNKFSSDD 352

Query: 507 SPEQRD-AKVILVKNFPYGTTREEIGELFLPFGKLK 541
             +  D +K+IL  N P  TT  ++ +LF   GK+K
Sbjct: 353 YVKTEDKSKIILCDNLPGATTEGDLYDLFETLGKVK 388

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLQGVH 806
           NL ++ T +D+ + F+  G++  VR      +   RG   VEF   +E + A+ +  G +
Sbjct: 113 NLTYDCTPEDLKDFFSQVGKV--VRADIITSRGHHRGMGTVEFTSGEEVDEAIRKFDGAY 170

Query: 807 LLGRRLVMQ 815
           L+ R++ ++
Sbjct: 171 LMNRQIFVR 179

>KLLA0E11011g 968674..969972 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor
           singleton, start by similarity
          Length = 432

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 323 ISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVAL--DTRTGKSKGFAYILFKDPKE 380
           IS    + ++N+    T DD  K+F  FG+ E+  +    +T  G+   +A+I FK+   
Sbjct: 203 ISDGREIIVKNLPDDITIDDLIKMFNEFGDTEKARIVTGDETNPGRHSRYAFITFKNKAS 262

Query: 381 AVQAYIELDKQIFQGRLLHI 400
           A  A + L+  +  G+ LH+
Sbjct: 263 ADNA-LSLNGAVMNGKPLHV 281

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 9/128 (7%)

Query: 689 FGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXN 748
           F + +  + E A    + L+G  I+ +++  K+S+    +  T                N
Sbjct: 157 FAYVDLVSPEVAKKATNRLNGIEINNYKLVAKISN---VNERTERTDNAISDGREIIVKN 213

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARG----FAFVEFLLPKEAENAMDQLQG 804
           LP + T  D+ ++FN FG  +  R+    D++  G    +AF+ F     A+NA+  L G
Sbjct: 214 LPDDITIDDLIKMFNEFGDTEKARIVTG-DETNPGRHSRYAFITFKNKASADNAL-SLNG 271

Query: 805 VHLLGRRL 812
             + G+ L
Sbjct: 272 AVMNGKPL 279

 Score = 33.1 bits (74), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 28/46 (60%)

Query: 770 SVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQ 815
           S+R+P     S R FA+V+ + P+ A+ A ++L G+ +   +LV +
Sbjct: 143 SIRLPSLAFNSRRRFAYVDLVSPEVAKKATNRLNGIEINNYKLVAK 188

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 11/90 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           IIVK LP  +T D+L + F +    T K   +    T+        G   ++AFI + N+
Sbjct: 209 IIVKNLPDDITIDDLIKMFNE-FGDTEKARIVTGDETN-------PGRHSRYAFITFKNK 260

Query: 64  EDAFDAVNYFNGSYINTAKLEVS--MAKSF 91
             A +A++  NG+ +N   L VS  M K++
Sbjct: 261 ASADNALS-LNGAVMNGKPLHVSKVMRKAY 289

>Sklu_2375.5 YPL178W, Contig c2375 12417-13040 reverse complement
          Length = 207

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 35/65 (53%)

Query: 320 MEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPK 379
           + K   +  +++ N+ + T+E+   +LF   G ++ + + LD       GF ++++  PK
Sbjct: 39  LRKSMSSATIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPK 98

Query: 380 EAVQA 384
           EA+ A
Sbjct: 99  EALSA 103

 Score = 36.6 bits (83), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           NL F  + + ++ELF+  G +K + +   +F  +  GF FV +  PKEA +A+  L    
Sbjct: 52  NLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFVIYNTPKEALSAVKYLSDTK 111

Query: 807 LLGRRLVM 814
           L  R + +
Sbjct: 112 LDDRHISI 119

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 19/75 (25%)

Query: 471 SNSAVKQALAEAHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVILVKNFPYGTTREEI 530
           SN  +++A    H + D+RK   S                     I V N  + T+ E+I
Sbjct: 22  SNYLIRKARKNPHGLEDLRKSMSSA-------------------TIYVGNLSFYTSEEQI 62

Query: 531 GELFLPFGKLKRLLM 545
            ELF   G +KR++M
Sbjct: 63  YELFSKCGTIKRIIM 77

>CAGL0H10604g complement(1033488..1034738) similar to sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1, hypothetical
           start
          Length = 416

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 640 TVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQ 699
           T ++F+ +LN       L+  F+ F  F+ A V             S G+GF  F  +E+
Sbjct: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWD-----MQTGRSRGYGFVSFSNQEE 199

Query: 700 ANAVISALDGTVIDGHRIQLKLSHRQ 725
           A   + A+ G  + G +I++  + ++
Sbjct: 200 AQKAMDAMQGKDLSGRQIRINWATKR 225

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           T  LF+ ++     ++     F  F    + HV  D +TG+S+G+ ++ F + +EA +A 
Sbjct: 145 TFNLFVGDLNVDVDDETLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAM 204

Query: 386 IELDKQIFQGRLLHI 400
             +  +   GR + I
Sbjct: 205 DAMQGKDLSGRQIRI 219

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 93/228 (40%), Gaps = 35/228 (15%)

Query: 610 EVKDTVKEIMDSTDKTSNEEHED----EHVADGPTVS---------------IFIKNLNF 650
           EV +T +E+++  ++ S E   D    E+  D P+V                +++ NL+ 
Sbjct: 8   EVIETPEEVIEKPEEVSQEVEGDNASQENDDDKPSVVPASATKGGRETSDRVLYVGNLDK 67

Query: 651 TTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGT 710
           + T   L + F+  +G  +  VK   D K+      + + F E+     AN  +  L+G 
Sbjct: 68  SITEDLLKQYFQ--AGGPIQNVKIIEDMKNE----YVNYAFVEYIRSHDANVALQTLNGV 121

Query: 711 VIDGH--RIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFELFNSFGQL 768
            ++    +I      +Q + N                      + T    F  F +F Q 
Sbjct: 122 QLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVD------DETLAGTFREFPTFIQ- 174

Query: 769 KSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
             V    +  +S RG+ FV F   +EA+ AMD +QG  L GR++ + +
Sbjct: 175 AHVMWDMQTGRS-RGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIRINW 221

 Score = 33.5 bits (75), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 11/85 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + V  L   +T+D LKQ+F+               I +VKI+ + + E   +AF+ Y   
Sbjct: 60  LYVGNLDKSITEDLLKQYFQA-----------GGPIQNVKIIEDMKNEYVNYAFVEYIRS 108

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMA 88
            DA  A+   NG  +    L+++ A
Sbjct: 109 HDANVALQTLNGVQLENKTLKINWA 133

>CAGL0E03630g complement(335091..337331) weakly similar to sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation,
           hypothetical start
          Length = 746

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL 808
           LP +    +V + F ++GQL  V+V +  D   R +AFV+++  K+A++A+    G  L 
Sbjct: 106 LPDDQLCMNVTKHFQNYGQLVGVKVLR--DDHNRPYAFVQYINDKDAKHALKNASGTVLN 163

Query: 809 GRRL 812
           GR+L
Sbjct: 164 GRKL 167

 Score = 37.0 bits (84), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 9/86 (10%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           I V  L S L DD L  +  K      +       +  VK+LR  +  +R +AF+ Y N+
Sbjct: 97  IFVASLASSLPDDQLCMNVTKHFQNYGQ-------LVGVKVLR--DDHNRPYAFVQYIND 147

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89
           +DA  A+   +G+ +N  KL    AK
Sbjct: 148 KDAKHALKNASGTVLNGRKLRCEAAK 173

>CAGL0A03117g join(315979..316263,317561..317974) highly similar to
           sp|Q12159 Saccharomyces cerevisiae YDR381w YRA1
          Length = 232

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 19/122 (15%)

Query: 2   SRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYH 61
           +R+ V+GLP  +  D +++ F+ ++    +          V +  N  G+S   A + + 
Sbjct: 78  ARVTVEGLPRDIKQDAVREFFQSQVGGVQR----------VLLSYNERGQSTGMANVTFR 127

Query: 62  NEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRV--PQPMKERKREALKRFREKEERLL 119
           N E A  AV  F+G+ I+  K  + +     DP V   +P+ ER R A+ R     ER++
Sbjct: 128 NGELAKKAVAQFSGAPIDGGKSRLRL-NIVVDPTVQPARPLTERIR-AISR-----ERVV 180

Query: 120 AE 121
           A+
Sbjct: 181 AQ 182

>CAGL0D06182g 581992..582834 similar to sp|P25299 Saccharomyces
           cerevisiae YGL044c RNA15 component of pre-mRNA 3 -end
           processing factor CF I, hypothetical start
          Length = 280

 Score = 38.9 bits (89), Expect = 0.014,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 38/70 (54%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++L +I Y  TE+    L    G +  + +  D++TGKSKG+A++ ++D + +  A   L
Sbjct: 18  VYLGSIPYDQTEEQILDLCSNVGPVVSLKMMFDSQTGKSKGYAFVQYQDLESSASAVRNL 77

Query: 389 DKQIFQGRLL 398
           +      RLL
Sbjct: 78  NGYQLGSRLL 87

>KLLA0E08745g 782800..784227 some similarities with sp|P32588
           Saccharomyces cerevisiae YNL016w PUB1 major
           polyadenylated RNA-binding protein of nucleus and
           cytoplasm, hypothetical start
          Length = 475

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 11/85 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + V  LP  + DD LKQ+F+           I   I+ VKI+ ++  +   +AF+ Y   
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQ-----------IGGSISSVKIIPDKNSQECNYAFVEYFEP 147

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMA 88
            DA  A    NG  +    L+++ A
Sbjct: 148 HDANVAYQTLNGKEVEGKVLKINWA 172

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 5/85 (5%)

Query: 640 TVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQ 699
           T ++F+ +LN       L+  FK F  F+ A V             S G+GF  F  ++Q
Sbjct: 183 TFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWD-----MQSGRSRGYGFVSFGEQDQ 237

Query: 700 ANAVISALDGTVIDGHRIQLKLSHR 724
           A   +    G  ++G  +++  + +
Sbjct: 238 AQVAMETKQGFELNGRALRINWASK 262

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 71/180 (39%), Gaps = 25/180 (13%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           +++ NL  +     L + F+   G  ++ VK  PD      +    + F E+     AN 
Sbjct: 99  LYVGNLPKSIDDDLLKQYFQI--GGSISSVKIIPD----KNSQECNYAFVEYFEPHDANV 152

Query: 703 VISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFELF 762
               L+G  ++G  +++  + +    N+                     +AT    F+ F
Sbjct: 153 AYQTLNGKEVEGKVLKINWAFQSQQVNSDETFNLFVGDLNVDVD-----DATLAGTFKEF 207

Query: 763 NSFGQ------LKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
            SF Q      ++S R        +RG+ FV F    +A+ AM+  QG  L GR L + +
Sbjct: 208 PSFIQAHVMWDMQSGR--------SRGYGFVSFGEQDQAQVAMETKQGFELNGRALRINW 259

 Score = 31.2 bits (69), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 6/79 (7%)

Query: 325 KTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           +T  LF+ ++     +      F  F    + HV  D ++G+S+G+ ++ F    E  QA
Sbjct: 182 ETFNLFVGDLNVDVDDATLAGTFKEFPSFIQAHVMWDMQSGRSRGYGFVSF---GEQDQA 238

Query: 385 YIELD-KQIFQ--GRLLHI 400
            + ++ KQ F+  GR L I
Sbjct: 239 QVAMETKQGFELNGRALRI 257

>Sklu_1984.3 YIR001C, Contig c1984 2838-3692 reverse complement
          Length = 284

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ NI  +TT +     F   G ++ V +  +  TG  KG+AYI F + K++V+     
Sbjct: 85  IFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHTGAPKGYAYIEF-ESKDSVEKGSAF 143

Query: 389 DKQIFQGRLLHI 400
           D+  F G+ + +
Sbjct: 144 DQSDFNGKTITV 155

>Scas_671.4
          Length = 443

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%)

Query: 326 TGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAY 385
           T  LF+ ++     ++     F  F    + HV  D +TG+S+G+ ++ F D ++A +A 
Sbjct: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAM 229

Query: 386 IELDKQIFQGRLLHI 400
             +      GR + I
Sbjct: 230 NVMQGMPINGRAVRI 244

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 5/85 (5%)

Query: 640 TVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQ 699
           T ++F+ +LN       LS  F  F  +V A V             S G+GF  F  +EQ
Sbjct: 170 TFNLFVGDLNVDVDDETLSHAFDQFPSYVQAHVMWD-----MQTGRSRGYGFVSFADQEQ 224

Query: 700 ANAVISALDGTVIDGHRIQLKLSHR 724
           A   ++ + G  I+G  +++  + +
Sbjct: 225 AQEAMNVMQGMPINGRAVRINWATK 249

 Score = 36.6 bits (83), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 80/180 (44%), Gaps = 24/180 (13%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           +++ NL+ +     L + F+   G  +  VK   D K+ +    + + F E+     AN 
Sbjct: 85  LYVGNLDKSINEDLLKQYFQV--GGQITDVKIMVDKKNNN----VNYAFIEYLKSHDANV 138

Query: 703 VISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFE-- 760
            +  L+G  I+G  +++  + +  S  TT                NL       DV +  
Sbjct: 139 ALQTLNGIQIEGKTVRINWAFQ--SQQTTNSDDTF----------NLFVGDLNVDVDDET 186

Query: 761 LFNSFGQLKS-VRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
           L ++F Q  S V+    +D     +RG+ FV F   ++A+ AM+ +QG+ + GR + + +
Sbjct: 187 LSHAFDQFPSYVQAHVMWDMQTGRSRGYGFVSFADQEQAQEAMNVMQGMPINGRAVRINW 246

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 11/85 (12%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           + V  L   + +D LKQ+F+           +   ITDVKI+ +++  +  +AFI Y   
Sbjct: 85  LYVGNLDKSINEDLLKQYFQ-----------VGGQITDVKIMVDKKNNNVNYAFIEYLKS 133

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMA 88
            DA  A+   NG  I    + ++ A
Sbjct: 134 HDANVALQTLNGIQIEGKTVRINWA 158

>Kwal_55.20972
          Length = 135

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  +    TE D   +F  +G   ++ +  D  +G+SKGFAY+ ++D +  V A   L
Sbjct: 36  IFVGGLHKDLTEGDILTIFSQYGIPVDLKLVRDRESGESKGFAYLKYEDQRSTVLAVDNL 95

Query: 389 DKQIFQGRLLHI 400
           +     GR + +
Sbjct: 96  NGVKIAGRSIRV 107

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 45/95 (47%), Gaps = 14/95 (14%)

Query: 2   SRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNRE-GESRKFAFIGY 60
           + I V GL   LT+ ++   F +             +  D+K++R+RE GES+ FA++ Y
Sbjct: 34  AYIFVGGLHKDLTEGDILTIFSQY-----------GIPVDLKLVRDRESGESKGFAYLKY 82

Query: 61  HNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPR 95
            ++     AV+  NG  +  A   + +  +   PR
Sbjct: 83  EDQRSTVLAVDNLNG--VKIAGRSIRVDHTMFTPR 115

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 5/64 (7%)

Query: 752 EATRKDVFELFNSFG---QLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLL 808
           + T  D+  +F+ +G    LK VR   +    ++GFA++++   +    A+D L GV + 
Sbjct: 44  DLTEGDILTIFSQYGIPVDLKLVR--DRESGESKGFAYLKYEDQRSTVLAVDNLNGVKIA 101

Query: 809 GRRL 812
           GR +
Sbjct: 102 GRSI 105

>KLLA0B00979g 77439..78467 some similarities with sp|Q01560
           Saccharomyces cerevisiae YDR432w NPL3 nucleolar protein
           singleton, hypothetical start
          Length = 342

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 516 ILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKLAFKRFK 575
           + VK FP   T  E+ E+F PFG LK + +      A VE+ +  S   A   +A K F 
Sbjct: 54  LFVKPFPPDVTDAEMKEIFEPFGALKEIKI--LNGFAFVEFEEAESASQAIQNVAGKMFA 111

Query: 576 D 576
           D
Sbjct: 112 D 112

 Score = 37.4 bits (85), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 62/122 (50%), Gaps = 14/122 (11%)

Query: 321 EKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKE 380
           E++S T RLF++      T+ + +++F PFG L+E+ +          GFA++ F++ + 
Sbjct: 47  EELSDT-RLFVKPFPPDVTDAEMKEIFEPFGALKEIKIL--------NGFAFVEFEEAES 97

Query: 381 AVQAYIELDKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLK-KQRELK--KKDNASRQT 437
           A QA   +  ++F    L ++   +KK        ++N+P     +ELK   +DN    T
Sbjct: 98  ASQAIQNVAGKMFADYPLEVV--FSKKLKPRFRVIIRNLPEGCAWQELKDLARDNQLETT 155

Query: 438 FS 439
           FS
Sbjct: 156 FS 157

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 10/57 (17%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGV 805
            P + T  ++ E+F  FG LK +++         GFAFVEF   +EAE+A   +Q V
Sbjct: 59  FPPDVTDAEMKEIFEPFGALKEIKI-------LNGFAFVEF---EEAESASQAIQNV 105

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 37/88 (42%), Gaps = 18/88 (20%)

Query: 2   SRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYH 61
           +R+ VK  P  +TD  +K+ FE          P  +L  ++KIL         FAF+ + 
Sbjct: 52  TRLFVKPFPPDVTDAEMKEIFE----------PFGAL-KEIKILNG-------FAFVEFE 93

Query: 62  NEEDAFDAVNYFNGSYINTAKLEVSMAK 89
             E A  A+    G       LEV  +K
Sbjct: 94  EAESASQAIQNVAGKMFADYPLEVVFSK 121

>CAGL0C01529g 167802..168512 similar to tr|Q08920 Saccharomyces
           cerevisiae YPL178w SAE1, start by similarity
          Length = 236

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 34/60 (56%)

Query: 325 KTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           K+  +++ N+ + T+E+   +LF   G ++ + + LD       GF +I++  P+EA+ A
Sbjct: 44  KSSTIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNA 103

 Score = 34.7 bits (78), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQL 802
           NL F  + + ++ELF+  G +K + +   +F  +  GF F+ +  P+EA NA+  L
Sbjct: 52  NLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALNAVKYL 107

>CAGL0H02211g 200049..201194 similar to sp|P49960 Saccharomyces
           cerevisiae YMR268c PRP24 pre-mRNA splicing factor,
           hypothetical start
          Length = 381

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 53/117 (45%), Gaps = 8/117 (6%)

Query: 689 FGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXN 748
           F + +    E  +  I  L+G  I+G+++ +K S+ +   N                  N
Sbjct: 143 FAYVDLPNMESLDKAIQLLNGKDINGYKLVVKKSNPE---NRDKRSDAPVLERREIIIRN 199

Query: 749 LPFEATRKD-VFELFNSFGQLKSVRVPKK----FDKSARGFAFVEFLLPKEAENAMD 800
           LP     KD + ++F  +G +  +R+PKK          G AFV +  P++A++A++
Sbjct: 200 LPKTMLVKDTLLDIFKKYGAIDDLRIPKKQLEMLSDLNHGCAFVVYTNPEDAKSALE 256

>Sklu_2257.4 YIR005W, Contig c2257 7296-7862 reverse complement
          Length = 188

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 31/62 (50%)

Query: 339 TEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLL 398
           TE D   +F  +G   ++ +  D  T +SKGF Y+ ++D +  V A   L+     GR +
Sbjct: 46  TEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTI 105

Query: 399 HI 400
            +
Sbjct: 106 KV 107

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 40  TDVKILRNREG-ESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPR 95
            D+K++R++E  ES+ F ++ Y ++     AV+  NG+ I    ++V  A  F  PR
Sbjct: 61  VDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGRTIKVDHA--FYTPR 115

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/62 (22%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 752 EATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGR 810
           E T  D+  +F+ +G    +++ + K  + ++GF ++++   +    A+D L G  + GR
Sbjct: 44  ELTEGDILTIFSQYGIPVDIKLVRDKETRESKGFGYLKYEDQRSTVLAVDNLNGATIAGR 103

Query: 811 RL 812
            +
Sbjct: 104 TI 105

>YPL178W (CBC2) [5269] chr16 (212157..212783) Small subunit of
           nuclear cap-binding protein complex [627 bp, 208 aa]
          Length = 208

 Score = 37.0 bits (84), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 33/60 (55%)

Query: 325 KTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           K+  +++ N+ + T+E+   +LF   G ++ + + LD       GF +I++  P EA+ A
Sbjct: 44  KSSTIYVGNLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNA 103

 Score = 37.0 bits (84), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           NL F  + + ++ELF+  G +K + +   +F  +  GF F+ +  P EA NA+  L    
Sbjct: 52  NLSFYTSEEQIYELFSKCGTIKRIIMGLDRFKFTPCGFCFIIYSCPDEALNALKYLSDTK 111

Query: 807 L 807
           L
Sbjct: 112 L 112

>ADR189W [1930] [Homologous to ScYDR429C (TIF35) - SH]
           complement(1034093..1034902) [810 bp, 269 aa]
          Length = 269

 Score = 37.4 bits (85), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 344 RKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLHI 400
           +KL  PF  +  V V  +  TG+S+G AY+ F   K+A  A   L  + F   +L +
Sbjct: 206 QKLLSPFPNVPRVAVVRNKETGRSRGIAYVTFASEKDAETALRLLHGRGFMNLILQV 262

>Sklu_1706.1 YFR023W, Contig c1706 1364-3382
          Length = 672

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 94/423 (22%), Positives = 168/423 (39%), Gaps = 75/423 (17%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+ ++    TE   R  F  +  L  V + +D  + +S G+ YI F + ++A +A  E 
Sbjct: 104 LFIGDLDERVTEKMLRDTFNKYPSLVSVKICVDAISKRSLGYGYINFSNDEDAEKATEEF 163

Query: 389 DKQIFQGRLLHILPADAKKSHRLD---EFDLKNMPLKKQRELKKKDNASRQTFSWNSLYM 445
           +     G+ + I+P+     +R +        N+PL         +N S  T ++   + 
Sbjct: 164 NYVPLFGKEVRIMPSLRNSFYRKNIGTNVFFSNLPL---------ENLSLTTRAFYDTFK 214

Query: 446 NQDAVLGSVAAKLGLKKS---DLIDPESS-NSAV----------KQALAEAHIIGDVRKY 491
               +L   + KL  +K+      D ++S  SA+             +   H   +VRK 
Sbjct: 215 KYGKIL---SCKLDRRKNIGFIYFDKDTSAKSAIDDFNGKEYYGNNIMCGIHFDREVRKS 271

Query: 492 --FESK-----GVDLTKFAQTKSPEQRDAKV-----------ILVKNFPYGTTREEIGEL 533
             FE +     G+ + K       EQ   +V           I VKN P     ++I + 
Sbjct: 272 PEFEKRKSKLDGMTIIKEKLMTDDEQELQEVAPGTKAPHPNAIFVKNLPVNANEDDILDF 331

Query: 534 FLPFGKLKRLLMPP----SGTIAIVEYRDTTSGRSAFTKLAFKRFKDGIIYLEKGPKDCF 589
           F   G +K +        + + A V Y+  +    A  KL  + FK   I + +  K+ F
Sbjct: 332 FSRIGPVKSVFTSKVPKYNSSWAFVTYKKGSDTSEAIEKLNGEIFKHRKIEVARAQKN-F 390

Query: 590 TRDAEPADLIEADAPEENVVEVKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFIKNLN 649
              +  A+   +D           + KE   ST   S  E  + H A+G  +S+++ N++
Sbjct: 391 QHPSNNANSRASDCDTS-------SKKEYAASTSDRS--ESFNLH-ANGYKLSVYLSNMS 440

Query: 650 FTTTSVELSKRFKTFSGFVVAQ--VKTK--PDPKHADKTLSMGFGFAEFRTKEQANAVIS 705
              T        + F  ++ AQ  +KTK      + +KTL+   G    +T+  AN +  
Sbjct: 441 SICT--------EEFLSYLCAQERIKTKKISVCLYDEKTLTYS-GSVLCQTRNDANRLFE 491

Query: 706 ALD 708
            +D
Sbjct: 492 LMD 494

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQG 804
           NLP  A   D+ + F+  G +KSV    K  K    +AFV +    +   A+++L G
Sbjct: 318 NLPVNANEDDILDFFSRIGPVKSV-FTSKVPKYNSSWAFVTYKKGSDTSEAIEKLNG 373

>ADR001C [1742] [Homologous to ScYIR001C (SGN1) - SH]
           (708437..709411) [975 bp, 324 aa]
          Length = 324

 Score = 37.4 bits (85), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 5/87 (5%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ +I    T +   + F   G +  + +  + +TG+ KG+AYI F+    +V+  ++L
Sbjct: 85  VFVSSITPEATAEMLEEHFKDVGVISRITILYNKKTGEPKGYAYIQFES-ISSVEKALQL 143

Query: 389 DKQIFQGRLLHILPADAKKSHRLDEFD 415
           D   F G  + +    AKK   L  F+
Sbjct: 144 DGSSFNGNTISV----AKKRTNLPGFN 166

>AGL038C [4273] [Homologous to ScYHL024W (RIM4) - SH]
           (639306..641444) [2139 bp, 712 aa]
          Length = 712

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 758 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
           V E F  +G+L  V+V +  D S R +AFV++    +A+ A+ Q QG  L GR +
Sbjct: 181 VTEAFKKYGELSMVKVLR--DPSNRPYAFVQYTNDNDAKRALKQAQGTLLNGRTI 233

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 9/88 (10%)

Query: 2   SRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYH 61
           S + V  L + LTDD+L     +   +  +       ++ VK+LR  +  +R +AF+ Y 
Sbjct: 161 SCVFVASLAASLTDDDLCVSVTEAFKKYGE-------LSMVKVLR--DPSNRPYAFVQYT 211

Query: 62  NEEDAFDAVNYFNGSYINTAKLEVSMAK 89
           N+ DA  A+    G+ +N   +    AK
Sbjct: 212 NDNDAKRALKQAQGTLLNGRTIRCEKAK 239

>Kwal_0.370
          Length = 560

 Score = 37.4 bits (85), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           NLPF    +D+   F+  G +KSV    K +     + FV +    +   A+D L G   
Sbjct: 231 NLPFNICNEDLLNYFSRIGPVKSV-FTSKLEAYRSSWGFVTYKKGCDTRKALDSLNGAIF 289

Query: 808 LGRRL 812
           + RRL
Sbjct: 290 MDRRL 294

 Score = 37.0 bits (84), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 35/79 (44%)

Query: 325 KTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           K   LF+ ++    TE      F  F  L  V + +D+ TG S G+ Y+ F   K+A  A
Sbjct: 13  KVSSLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVDSETGISLGYGYLNFYSSKDAETA 72

Query: 385 YIELDKQIFQGRLLHILPA 403
                     GR + I+P+
Sbjct: 73  IETFSYVNLFGREVRIMPS 91

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 29/151 (19%), Positives = 59/151 (39%), Gaps = 21/151 (13%)

Query: 642 SIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQAN 701
           S+FI +L+   T   L+  F+ F   +  ++        ++  +S+G+G+  F + + A 
Sbjct: 16  SLFIGDLDPNVTEKMLNDTFRVFPSLISVKICVD-----SETGISLGYGYLNFYSSKDAE 70

Query: 702 AVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEA---TRKDV 758
             I       + G  +++  S R                       NLP E    T +  
Sbjct: 71  TAIETFSYVNLFGREVRIMPSMRNS--------YFRKNIGTNVFFSNLPLEQPALTTRVF 122

Query: 759 FELFNSFGQLKSVRVPKKFDKSARGFAFVEF 789
           +E F  +G++ S ++ ++     +   FV F
Sbjct: 123 YETFREYGKVLSCKLDRR-----KNIGFVYF 148

>Sklu_2213.4 YGL044C, Contig c2213 6333-7106 reverse complement
          Length = 257

 Score = 37.0 bits (84), Expect = 0.051,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 36/70 (51%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           ++L +I Y  TE+    L    G +  + +  D +TGKSKG+A++ +KD + +  A   L
Sbjct: 15  VYLGSIPYDQTEEQILDLCSNVGPVTNLKMMFDPQTGKSKGYAFVEYKDLEASNSAVRNL 74

Query: 389 DKQIFQGRLL 398
           +      R L
Sbjct: 75  NGYQLGNRFL 84

>Kwal_27.10364
          Length = 443

 Score = 37.4 bits (85), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 71/167 (42%), Gaps = 18/167 (10%)

Query: 655 VELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANAVISALDGTVIDG 714
           +EL K F  F G V++     P  ++        F + +  + E+A  ++  L G V+D 
Sbjct: 131 LELQKLFSQFGGTVLS--IRFPSLRYDSHR---RFAYVDMASSEEAKLIVDRLHGFVVDN 185

Query: 715 HRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLP-FEATRKDVFELFNSFGQLKSVRV 773
           H + +KLS+   +   T                NL  F  + + + + F+ +G ++ + +
Sbjct: 186 HELIIKLSNPLKAEKRT---DSDVLERRQVYLKNLDYFRVSEEIISKSFSKYGHIERISL 242

Query: 774 PKKFDKSAR--------GFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
           P K +            GF FV F     A +++ QL G  L GR++
Sbjct: 243 PHKEEPGLSGAEKRLNDGFGFVTFSESTSAASSL-QLDGSELEGRKI 288

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 103/264 (39%), Gaps = 52/264 (19%)

Query: 511 RDAKVILVKNFPYGTTREEIGELFLPFGKLKRL----LMPPSGTIAIVEYRDTTSGRSAF 566
           R+   ++V+N P G    ++ +LF   G +K +    +      +A +E+ D     SA 
Sbjct: 38  REESTVVVRNLPKGYNFFKVRKLFKDCGNIKHIDVKQVTNEDSKVARIEFEDFNDVLSAL 97

Query: 567 TKLAFKRFKDGIIYLEKGPKDCFTRDAEP------------------------------- 595
           TK + KR  D  I +E+           P                               
Sbjct: 98  TK-SHKRLGDQEIIVEQSQNSTLWVTNYPPLFGELELQKLFSQFGGTVLSIRFPSLRYDS 156

Query: 596 ----ADLIEADAPEENVVE------VKDTVKEIMDSTDKTSNEEHEDEHVADGPTVSIFI 645
               A +  A + E  ++       V D  + I+  ++    E+  D  V +   V  ++
Sbjct: 157 HRRFAYVDMASSEEAKLIVDRLHGFVVDNHELIIKLSNPLKAEKRTDSDVLERRQV--YL 214

Query: 646 KNLNFTTTSVE-LSKRFKTFSGF--VVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           KNL++   S E +SK F  +     +    K +P    A+K L+ GFGF  F     A +
Sbjct: 215 KNLDYFRVSEEIISKSFSKYGHIERISLPHKEEPGLSGAEKRLNDGFGFVTFSESTSAAS 274

Query: 703 VISALDGTVIDGHRIQLKLSHRQG 726
            +  LDG+ ++G +I + L+ R+ 
Sbjct: 275 SLQ-LDGSELEGRKISVTLADRKA 297

>Kwal_27.11447
          Length = 439

 Score = 37.0 bits (84), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 12/87 (13%)

Query: 3   RIIVKG-LPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYH 61
           RI+  G L   +T+D LKQ+F+           +   I +VKIL ++  +   +AF+ +H
Sbjct: 62  RILYVGNLDLAVTEDMLKQYFQ-----------VGGAIANVKILMDKNNKEANYAFVEFH 110

Query: 62  NEEDAFDAVNYFNGSYINTAKLEVSMA 88
              DA  A    +G  I    ++++ A
Sbjct: 111 QPHDASVAFQTLDGKQIENHVIKINYA 137

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 77/182 (42%), Gaps = 29/182 (15%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           +++ NL+   T   L + F+   G  +A VK   D  + +      + F EF     A+ 
Sbjct: 64  LYVGNLDLAVTEDMLKQYFQV--GGAIANVKILMDKNNKEAN----YAFVEFHQPHDASV 117

Query: 703 VISALDGTVIDGHRIQLKLS--HRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATRKDVFE 760
               LDG  I+ H I++  +   +Q SS  T                NL       DV +
Sbjct: 118 AFQTLDGKQIENHVIKINYAFQSQQVSSEDT---------------FNLFVGDLNVDVDD 162

Query: 761 --LFNSFGQLKS-VRVPKKFDKS---ARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVM 814
             L N+F  + + ++    +D     +RG+ FV F    +A+ AM++ QG  + GR + +
Sbjct: 163 ETLANTFKHVPTFIQAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRI 222

Query: 815 QY 816
            +
Sbjct: 223 NW 224

 Score = 36.2 bits (82), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 42/98 (42%), Gaps = 5/98 (5%)

Query: 627 NEEHEDEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLS 686
           N   + + V+   T ++F+ +LN       L+  FK    F+ A V             S
Sbjct: 135 NYAFQSQQVSSEDTFNLFVGDLNVDVDDETLANTFKHVPTFIQAHVMWD-----MQTGRS 189

Query: 687 MGFGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHR 724
            G+GF  F  + QA   +    GTV++G  I++  + +
Sbjct: 190 RGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRINWASK 227

 Score = 34.3 bits (77), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 355 EVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLHI 400
           + HV  D +TG+S+G+ ++ F +  +A +A  E    +  GR + I
Sbjct: 177 QAHVMWDMQTGRSRGYGFVSFGEQVQAQKAMEEKQGTVVNGRAIRI 222

>CAGL0H04675g complement(447256..448080) highly similar to sp|Q04067
           Saccharomyces cerevisiae YDR429c TIF35, start by
           similarity
          Length = 274

 Score = 36.6 bits (83), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 9/68 (13%)

Query: 33  EPINSLITDVKILRNRE-GESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSF 91
           EPI  ++    ++RN+E G SR  AF+ + NE+ A  A+++ +G       L V  +K  
Sbjct: 214 EPIQKVV----VVRNKETGRSRGLAFVTFINEDMAEKALHFLDGRGFMNLILRVDWSK-- 267

Query: 92  ADPRVPQP 99
             P+VP P
Sbjct: 268 --PKVPAP 273

 Score = 33.1 bits (74), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%)

Query: 346 LFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLHI 400
           L  PF  +++V V  +  TG+S+G A++ F +   A +A   LD + F   +L +
Sbjct: 209 LLFPFEPIQKVVVVRNKETGRSRGLAFVTFINEDMAEKALHFLDGRGFMNLILRV 263

>KLLA0C08019g complement(704199..705104) some similarities with
           sp|Q00916 Saccharomyces cerevisiae YIL061c SNP1 U1 small
           nuclear ribonucleoprotein singleton, hypothetical start
          Length = 301

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 34/60 (56%), Gaps = 1/60 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+  + Y   E + +K F  +G++E   +  D + GKS+G+ ++ F   +++ Q + EL
Sbjct: 117 LFVGRLHYAVDEVELQKSFVKYGDIESCRIVRD-QDGKSRGYGFVQFTSYEDSKQCFREL 175

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 14/56 (25%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 762 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQL---QGVHLLGRRLVM 814
           F  +G ++S R+ +  D  +RG+ FV+F   ++++    +L   +G+ ++GR  ++
Sbjct: 135 FVKYGDIESCRIVRDQDGKSRGYGFVQFTSYEDSKQCFRELGVRKGIEIMGRTSIV 190

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 6/76 (7%)

Query: 632 DEHVADGPTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGF 691
           D +++  P  ++F+  L++    VEL K F  +      ++    D K      S G+GF
Sbjct: 106 DANISSDPYRTLFVGRLHYAVDEVELQKSFVKYGDIESCRIVRDQDGK------SRGYGF 159

Query: 692 AEFRTKEQANAVISAL 707
            +F + E +      L
Sbjct: 160 VQFTSYEDSKQCFREL 175

>Kwal_33.13496
          Length = 330

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 34/72 (47%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+  +   T   D   +F  FG +E+V +  D  TG S  + +I F +      AY ++
Sbjct: 249 LFICKLNPLTRAKDLAVIFSRFGTIEKVEIVRDKETGASLHYGFIEFTNKSSCEAAYSKM 308

Query: 389 DKQIFQGRLLHI 400
           +  +   R +H+
Sbjct: 309 EGVLIDDRRIHV 320

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 6/87 (6%)

Query: 634 HVADGPTVSI-FIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFA 692
           HV   P+  + FI  LN  T + +L+  F  F    + +V+   D    +   S+ +GF 
Sbjct: 239 HVGIKPSEKVLFICKLNPLTRAKDLAVIFSRFG--TIEKVEIVRD---KETGASLHYGFI 293

Query: 693 EFRTKEQANAVISALDGTVIDGHRIQL 719
           EF  K    A  S ++G +ID  RI +
Sbjct: 294 EFTNKSSCEAAYSKMEGVLIDDRRIHV 320

>Kwal_27.11096
          Length = 201

 Score = 35.4 bits (80), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 14/65 (21%), Positives = 36/65 (55%)

Query: 320 MEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPK 379
           + +  ++  +++ N+ + T+E+   +LF   G ++ + + LD       GF ++++  P+
Sbjct: 39  LRRSMRSATIYVGNLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPE 98

Query: 380 EAVQA 384
           EA+ A
Sbjct: 99  EALNA 103

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           NL F  + + ++ELF+  G +K + +   +F  +  GF FV +  P+EA NA+  L    
Sbjct: 52  NLSFYTSEEQIYELFSKSGVIKRIIMGLDRFKFTPCGFCFVIYNTPEEALNAVKYLSDTK 111

Query: 807 LLGRRLVM 814
           L  R + +
Sbjct: 112 LDDRNISL 119

>Kwal_27.12337
          Length = 209

 Score = 35.4 bits (80), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQL 802
           N+  + TR+ ++ELF     +  +R PK K  ++ +GFAFVEF   ++ E A   L
Sbjct: 16  NVDPKVTREILYELFLQICPVAKIRYPKDKILQTHQGFAFVEFYNAQDCEYATKCL 71

>YIR001C (SGN1) [2666] chr9 complement(356140..356892) Protein with
           possible role in protein translation, has one RNA
           recognition (RRM) domain [753 bp, 250 aa]
          Length = 250

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 5/69 (7%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ NI    T +     F   G+++ + +  D  TG  KG+ YI F+ P     AY E 
Sbjct: 66  IFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESP-----AYREK 120

Query: 389 DKQIFQGRL 397
             Q+  G L
Sbjct: 121 ALQLNGGEL 129

>Sklu_905.1 YMR268C, Contig c905 196-1743
          Length = 515

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 67/147 (45%), Gaps = 24/147 (16%)

Query: 329 LFLRNI-LYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSK----GFAYILFKDPKEAVQ 383
           +F+R +  Y  +     KL   +G +E V +     +  S     GFA++ + + +E+ Q
Sbjct: 278 IFIRKLDFYKVSLSKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTN-EESAQ 336

Query: 384 AYIELDKQIFQGRLLHILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNASRQTFSWNSL 443
             +EL+  +F+GR+L +  AD K             P  +++E+K+  N  +      S+
Sbjct: 337 KALELNMSVFEGRVLAVSIADRK-------------PYLERQEVKRILNTKKPQNDMISM 383

Query: 444 Y-----MNQDAVLGSVAAKLGLKKSDL 465
           Y     +++D +   +  K  LK  D+
Sbjct: 384 YPFTDKVSKDQLRALITEKASLKDEDI 410

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 761 LFNSFG-QLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQ 815
           LF+ +G  + SVR+P  KFD S R FA+++F    EA  AM +L      G  LV++
Sbjct: 202 LFSQYGGSVLSVRLPSLKFD-SNRRFAYIDFASSDEANTAMSKLNNTSHDGYILVVK 257

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 26/117 (22%), Positives = 51/117 (43%), Gaps = 7/117 (5%)

Query: 689 FGFAEFRTKEQANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXN 748
           F + +F + ++AN  +S L+ T  DG+ + +K S+    S  T                 
Sbjct: 226 FAYIDFASSDEANTAMSKLNNTSHDGYILVVKKSNPHEKSKRTDAATLEKREIFIRKLD- 284

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFD-----KSARGFAFVEFLLPKEAENAMD 800
             ++ +   + +L   +G ++ V +P   D     K   GFAFV +   + A+ A++
Sbjct: 285 -FYKVSLSKLTKLVEKYGPVERVSMPNSEDSVNSNKQNDGFAFVTYTNEESAQKALE 340

>YHR086W (NAM8) [2376] chr8 (278154..279725) U1 snRNA-associated
           protein, essential for meiotic recombination, suppressor
           of mitochondrial splicing defects, has 3 RNA recognition
           (RRM) domains [1572 bp, 523 aa]
          Length = 523

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/82 (23%), Positives = 35/82 (42%), Gaps = 1/82 (1%)

Query: 329 LFLRNILYTTTEDDFRKLF-GPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           +F+ ++    TE    +LF   +       +  D  TG SKG+ ++ F +  E   A  E
Sbjct: 165 IFVGDLAPNVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSE 224

Query: 388 LDKQIFQGRLLHILPADAKKSH 409
           +      GR + + P   ++ H
Sbjct: 225 MQGVFLNGRAIKVGPTSGQQQH 246

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 752 EATRKDVFELF-NSFGQLKSVR-VPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLG 809
             T   +FELF N +      + V  +    ++G+ FV+F    E + A+ ++QGV L G
Sbjct: 173 NVTESQLFELFINRYASTSHAKIVHDQVTGMSKGYGFVKFTNSDEQQLALSEMQGVFLNG 232

Query: 810 RRL 812
           R +
Sbjct: 233 RAI 235

>Scas_697.10
          Length = 610

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 68/181 (37%), Gaps = 24/181 (13%)

Query: 639 PTVSIFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKE 698
           P  ++FI +LN   T   L   F  +  FV A+V            +S+G G+  F  KE
Sbjct: 99  PFTALFIGDLNEDVTKETLESIFGVYPSFVSAKV-----CYDFQTNVSLGHGYLNFGDKE 153

Query: 699 QANAVISALDGTVIDGHRIQLKLSHRQGSSNTTXXXXXXXXXXXXXXXXNLPFEATR--- 755
            A   I   +   +    I++  S R  ++  +                NLP E  R   
Sbjct: 154 DAEKAIDDFNCMKLGDKVIRIMPSLRGKNTKKS--------IGTNVFFTNLPDEDNRLFH 205

Query: 756 -KDVFELFNSFGQLKSVRV-PKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLV 813
            +  FE+F  FG++ S R+ P K         F+ F   + A+  + +       G R+ 
Sbjct: 206 SRKFFEIFRQFGKILSCRLDPNK------NIGFISFEHEEVAKTVVKKYNNSMFFGNRIT 259

Query: 814 M 814
            
Sbjct: 260 C 260

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+ ++    T++    +FG +       V  D +T  S G  Y+ F D ++A +A  + 
Sbjct: 103 LFIGDLNEDVTKETLESIFGVYPSFVSAKVCYDFQTNVSLGHGYLNFGDKEDAEKAIDDF 162

Query: 389 DKQIFQGRLLHILPA----DAKKSHRLDEFDLKNMP 420
           +      +++ I+P+    + KKS   + F   N+P
Sbjct: 163 NCMKLGDKVIRIMPSLRGKNTKKSIGTNVF-FTNLP 197

>YHL024W (RIM4) [2262] chr8 (56646..58787) Protein required for
           sporulation and formation of meiotic spindle, has two
           RNA recognition motif (RRM) domains [2142 bp, 713 aa]
          Length = 713

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 758 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
           V E F  +G L  V+V +  D + R +AFV++    +A++A+ + QG  L GRRL
Sbjct: 113 VTENFKKYGDLARVKVLR--DNANRPYAFVQYNNDHDAKHALIRAQGTLLNGRRL 165

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (48%), Gaps = 17/92 (18%)

Query: 2   SRIIVKGLPSFLTDDNL----KQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAF 57
           S I V  L + L+DD L     ++F+K  +           +  VK+LR  +  +R +AF
Sbjct: 93  SCIFVASLAAALSDDELCLSVTENFKKYGD-----------LARVKVLR--DNANRPYAF 139

Query: 58  IGYHNEEDAFDAVNYFNGSYINTAKLEVSMAK 89
           + Y+N+ DA  A+    G+ +N  +L    AK
Sbjct: 140 VQYNNDHDAKHALIRAQGTLLNGRRLRCEPAK 171

>Scas_709.2*
          Length = 171

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 15/114 (13%)

Query: 2   SRIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYH 61
           + I + GL   LT+ ++   F      +    P++ L+ +     N+ GES+ FAF+ Y 
Sbjct: 34  AYIYIGGLDKELTEGDIISVF------SQYGVPVDLLLVN----DNQTGESKGFAFLKYE 83

Query: 62  NEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQPMKERKREALKRFREKE 115
           ++     A++  NG  + +  ++V    +F +PR  Q      RE +K   EK+
Sbjct: 84  DQRSTVLAIDNLNGVKVGSNTIQVD--HTFYEPRDEQ---WDYRETMKNELEKD 132

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 339 TEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           TE D   +F  +G   ++ +  D +TG+SKGFA++ ++D +  V A
Sbjct: 46  TEGDIISVFSQYGVPVDLLLVNDNQTGESKGFAFLKYEDQRSTVLA 91

>CAGL0J01914g complement(189309..189818) similar to sp|P40565
           Saccharomyces cerevisiae YIR005w IST3, hypothetical
           start
          Length = 169

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  +    TE D   +F  +G   +V +  D  T +SKGFA++ ++D +  + A   L
Sbjct: 36  IFIGGLNRQLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNL 95

Query: 389 DKQIFQGRLLHI 400
           +     GR + +
Sbjct: 96  NGITVAGRQIKV 107

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 40  TDVKILRNREG-ESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAKSFADPRVPQ 98
            DV ++R++E  ES+ FAF+ Y ++     AV+  NG  I  A  ++ +   F  PR   
Sbjct: 61  VDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNG--ITVAGRQIKVDHIFFTPRDDI 118

Query: 99  PMKERKREALKRFREKE 115
           P      EA++ F  K+
Sbjct: 119 P---EYTEAVREFLSKD 132

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 752 EATRKDVFELFNSFG-QLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGR 810
           + T  D+  +F+ +G  +  + V  K    ++GFAF+++   +    A+D L G+ + GR
Sbjct: 44  QLTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGR 103

Query: 811 RL 812
           ++
Sbjct: 104 QI 105

>YDR429C (TIF35) [1252] chr4 complement(1324465..1325289)
           Translation initiation factor eIF3, p33 subunit,
           contains an RRM (RNA recognition motif) domain [825 bp,
           274 aa]
          Length = 274

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 340 EDDFRK-LFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLL 398
           E+  R+ L  PF  +  V V  +  TGKS+G A++ F   + A QA   LD + +   +L
Sbjct: 204 ENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFLDGRGYMNLIL 263

Query: 399 HI 400
            +
Sbjct: 264 RV 265

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 12/67 (17%)

Query: 25  RLNQTHKNEPINSL----------ITDVKILRNRE-GESRKFAFIGYHNEEDAFDAVNYF 73
           ++ Q ++N   NSL          I  V ++RN+E G+SR  AF+ + +EE A  A+ + 
Sbjct: 194 KIMQVNENADENSLREELLFPFAPIPRVSVVRNKETGKSRGLAFVTFSSEEVAEQALRFL 253

Query: 74  NG-SYIN 79
           +G  Y+N
Sbjct: 254 DGRGYMN 260

>AER285C [2787] [Homologous to ScYMR268C (PRP24) - SH]
           (1162117..1163397) [1281 bp, 426 aa]
          Length = 426

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 748 NLPFEATRKDVFELFNSFG-QLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           N P     +++   F   G Q  SVR+P     + R FA+V+   P+ A+ A + L G+ 
Sbjct: 114 NFPPRYDGRELRRFFEDLGFQCLSVRLPSLRYNAGRRFAYVDLPSPQSADAAANTLNGMD 173

Query: 807 LLGRRLVMQ 815
           L G  LV++
Sbjct: 174 LDGYNLVVK 182

>ADR183C [1924] [Homologous to ScYDR432W (NPL3) - SH]
           (1024792..1025754) [963 bp, 320 aa]
          Length = 320

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 760 ELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
           E+F+ +G LK V++         GFAFVEF  P+ AE A+  + G       L + Y
Sbjct: 55  EIFSPYGALKEVKL-------MSGFAFVEFEKPESAEQAIKDVNGKMFADMPLTVSY 104

>Kwal_55.20414
          Length = 284

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 44/80 (55%), Gaps = 2/80 (2%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTL-SMGFGFAEFRTKEQAN 701
           I++ NL+F+TT  ELS+  K +   V   + ++      + T+  +G G+A+F++ + A 
Sbjct: 19  IYVSNLDFSTTEEELSEFLKEY-NVVSVLIPSQTIRGFRNSTVRPLGIGYADFQSAQDAQ 77

Query: 702 AVISALDGTVIDGHRIQLKL 721
                L+G  +   ++++K+
Sbjct: 78  NAAQNLNGKQLKDRKLKIKI 97

>KLLA0F18216g 1677731..1679857 some similarities with sp|P38741
           Saccharomyces cerevisiae YHL024w RIM4 No sporulation
           singleton, hypothetical start
          Length = 708

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 762 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
           F  +G++ SV+V +  D + R +AFV++    EA NA+ Q QG  L  R +
Sbjct: 144 FAKYGKIVSVKVLR--DPANRPYAFVQYASDDEALNALSQAQGTTLNNRNI 192

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+  + +  T+    + F  +GE++  +  L  +  + K FA+I +K P  A +A    
Sbjct: 325 IFIGQLNFKVTKPLLLERFSKYGEIDNCN--LIHKQEQLKCFAFIKYKTPASAAKALERE 382

Query: 389 DKQIFQGRLLHILPADAKKSHR 410
           +  IF  ++LH+   +   S R
Sbjct: 383 NHSIFVEKILHVQIREVSNSRR 404

>Scas_714.59
          Length = 233

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 340 EDDFRK-LFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLL 398
           E++ R+ L  PF  +++  V  +  TG+SKG A++ F   + A +A   LD + F   +L
Sbjct: 163 ENNLREELLFPFAPIQKCVVVRNRETGRSKGLAFVTFSSEQMAEKALHFLDGRGFMNLIL 222

Query: 399 HI 400
            +
Sbjct: 223 RV 224

>Kwal_30.12890
          Length = 280

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 39  ITDVKILRNRE-GESRKFAFIGYHNEEDAFDAVNYFNG 75
           I  V ++RNRE G SR  A++ +  EE A  A+N+ NG
Sbjct: 224 IPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNG 261

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 346 LFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRLLH 399
           L  PFG + +V V  +  TG+S+G AY+ F+  + A  A   L+ + F   +L+
Sbjct: 217 LLFPFGRIPKVVVVRNRETGRSRGIAYVTFETEEIAETALNFLNGRGFMNLILN 270

>KLLA0D13772g 1185663..1186700 some similarities with sp|Q8J1F4
           Ashbya gossypii Yib1, hypothetical start
          Length = 345

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ NI    T +   + F   GE+  V +  +  TG  KG+AYI F+   +++   +EL
Sbjct: 105 IFVGNITTEATAETLEEHFKDCGEVVRVTILYNKLTGAPKGYAYIEFES-SDSIPKALEL 163

Query: 389 DKQIFQGRLLHI 400
                 G  +++
Sbjct: 164 KDSELHGETINV 175

>Sklu_2249.4 YFR032C, Contig c2249 6281-7210 reverse complement
          Length = 309

 Score = 35.0 bits (79), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           ++I NL+F TT  EL+     ++   V             +   +G  +A+F + ++A  
Sbjct: 24  VYISNLSFDTTEDELTGYLLEYNVLSVLIPSQTIRGFRNSRVRPLGIAYADFESADKAKE 83

Query: 703 VISALDGTVIDGHRIQLK 720
            I AL+G V +   ++LK
Sbjct: 84  AIEALNGKVFNNRTLRLK 101

>AAL018W [169] [Homologous to ScYNL004W (HRB1) - SH; ScYCL011C
           (GBP2) - SH] complement(309542..310555) [1014 bp, 337
           aa]
          Length = 337

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 35/72 (48%), Gaps = 2/72 (2%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +F+ N+ Y TT +D R+LFG  G +  V   + T  G  +G   + + + ++  +A    
Sbjct: 9   VFIGNLTYDTTPEDLRQLFGEVGHV--VRADIITSRGHHRGMGTVEYTNAQDVDEAIRRF 66

Query: 389 DKQIFQGRLLHI 400
           +   F  R L +
Sbjct: 67  NGMDFMHRELFV 78

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 16/69 (23%), Positives = 32/69 (46%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           N+P      D+++LF + G++    +    + +  G +  EF    +A+  +++L   H 
Sbjct: 265 NMPLATAESDLYDLFETAGKVLRANLQYDSEGNPTGSSVCEFETVADAQECIERLNNYHY 324

Query: 808 LGRRLVMQY 816
            G  L M Y
Sbjct: 325 GGCDLKMSY 333

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           IF+ NL ++ +   L   FK  S  + A V    D        S GFG     T+E   A
Sbjct: 109 IFVANLPYSISWQTLKDMFKECSEVIHADVSVDAD------GYSRGFGTVYVTTRENQIA 162

Query: 703 VISALDGTVIDGHRIQLK 720
            I   +G  ++G  ++++
Sbjct: 163 AIERWNGYELEGRILEVR 180

>KLLA0D05016g complement(431592..432380) similar to sp|P25555
           Saccharomyces cerevisiae YCL011c GBP2 potential
           telomere-associated protein, start by similarity
          Length = 262

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 643 IFIKNLNFTTTSVELSKRFKTFSGFVVAQVKTKPDPKHADKTLSMGFGFAEFRTKEQANA 702
           +F+  L F+    EL   FK     + A V T  D K      S GFG     TKEQ N 
Sbjct: 64  VFVAQLPFSVNWQELKDMFKPCGDVLHADVVTDRDGK------SRGFGTVYMATKEQQND 117

Query: 703 VISALDGTVIDGHRIQLK 720
            I    GT   G  + +K
Sbjct: 118 AIRHWTGTEYKGRVLDVK 135

>Scas_607.10
          Length = 605

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           LF+  +    TE+    +F  +  L  + +  D+ + KS  + Y+ F D  EA +A  + 
Sbjct: 94  LFINGLADDVTENMLYDVFSKYQSLVSLKICCDSDSKKSLNYGYLNFSDELEAKKAVDDF 153

Query: 389 DKQIFQGRLLHILPA 403
           +  I  G  + ++P+
Sbjct: 154 NYTILFGNEIKMMPS 168

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 12/86 (13%)

Query: 4   IIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHNE 63
           I VK LP  + D+ +  HF K         P+ S+ +      N       +AFI Y  +
Sbjct: 304 IFVKNLPFDVPDEEILDHFSKL-------GPVKSVFSS-----NVTKYKSSWAFITYKKQ 351

Query: 64  EDAFDAVNYFNGSYINTAKLEVSMAK 89
            D   A N+FN +      + VS AK
Sbjct: 352 TDTIRATNHFNNTKFQGKTITVSRAK 377

>ACL071C [978] [Homologous to ScYHL034C (SBP1) - SH; ScYLL046C
           (RNP1) - SH] (229767..230663) [897 bp, 298 aa]
          Length = 298

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 510 QRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTKL 569
           +R +  + V N PY TT+EEI E    FG    L++ P     +   RDT S R  ++  
Sbjct: 148 ERSSDTLYVNNIPYYTTKEEIAEF---FGTKPELIVLP-----MRRMRDTVSNRFFYS-- 197

Query: 570 AFKRFKDGIIYL 581
             K    GI+++
Sbjct: 198 --KSMNRGIVFV 207

>Scas_530.4
          Length = 684

 Score = 34.7 bits (78), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 758 VFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
           V + F  FG++  V+V +  D++ R +AFV++    +A  A+ +  G  L GRRL
Sbjct: 161 VTDYFKKFGEIIRVKVLR--DQANRPYAFVQYTNDNDANVALKEAHGSILNGRRL 213

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 39  ITDVKILRNREGESRKFAFIGYHNEEDAFDAVNYFNGSYINTAKLEVSMAK 89
           I  VK+LR++   +R +AF+ Y N+ DA  A+   +GS +N  +L    A+
Sbjct: 171 IIRVKVLRDQA--NRPYAFVQYTNDNDANVALKEAHGSILNGRRLRCERAR 219

>Kwal_55.20903
          Length = 147

 Score = 33.1 bits (74), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           ++P + +   + + F   G +  + +  K  KS  G+A+VEF     AE A+ +L G  L
Sbjct: 65  DIPSDISLPSLEDHFRDMGSICRITMISKQRKSGTGYAYVEFATKASAERAL-ELDGSIL 123

Query: 808 LGRRL 812
            G +L
Sbjct: 124 RGHKL 128

>Scas_720.2
          Length = 245

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 13/60 (21%), Positives = 34/60 (56%)

Query: 325 KTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQA 384
           ++  +++ N+ + T+E+   +LF   G ++ + + LD       GF ++++ + +EA+ A
Sbjct: 45  QSATIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNA 104

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           NL F  + + ++ELF+  G +K + +   +F  +  GF FV +   +EA NA+  L    
Sbjct: 53  NLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFVIYSNAQEALNALKYLSDTK 112

Query: 807 LLGRRLVM 814
           L  + + +
Sbjct: 113 LDDKHITI 120

>CAGL0A04213g 412237..414156 similar to sp|P34217 Saccharomyces
           cerevisiae YBL051c, hypothetical start
          Length = 639

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 31/70 (44%), Gaps = 1/70 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLQGVH 806
           N+PF   ++ + ++    G          FD    RG AF  F  P++    +  L G  
Sbjct: 62  NIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFANFSTPEDTSRVISDLNGKE 121

Query: 807 LLGRRLVMQY 816
           + GR+L ++Y
Sbjct: 122 INGRKLKVEY 131

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 680 HADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK 720
           H D  +  G  FA F T E  + VIS L+G  I+G +++++
Sbjct: 90  HFDNGIFRGLAFANFSTPEDTSRVISDLNGKEINGRKLKVE 130

>ADR307W [2048] [Homologous to ScYHR086W (NAM8) - SH]
           complement(1238223..1239923) [1701 bp, 566 aa]
          Length = 566

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 5/55 (9%)

Query: 762 FNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLVMQY 816
           F  FGQ+  V++P       +G  FV+++    AENA+ ++QG  +   R+ + +
Sbjct: 302 FQPFGQIVYVKIPV-----GKGCGFVQYVDRSSAENAIAKMQGFPIGNSRVRLSW 351

 Score = 30.8 bits (68), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 35/81 (43%), Gaps = 1/81 (1%)

Query: 329 LFLRNILYTTTEDDFRKLF-GPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           +F+ ++    TE    +LF   +       +  D  TG SKG+ ++ F +  E  ++ +E
Sbjct: 143 IFVGDLAPNVTESQLFELFISRYSSTLNAKIVFDQGTGVSKGYGFVKFGNEAEQQRSLLE 202

Query: 388 LDKQIFQGRLLHILPADAKKS 408
           +      GR + +      KS
Sbjct: 203 MQGVFLNGRAIRVSTTSKNKS 223

>CAGL0J02200g complement(215042..215476) similar to sp|P40561
           Saccharomyces cerevisiae YIR001c SGN1, hypothetical
           start
          Length = 144

 Score = 32.7 bits (73), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 17/108 (15%)

Query: 329 LFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIEL 388
           +++ NI   TT ++  + F   G ++ + +  D  TG S G+AY+ F       +A   L
Sbjct: 47  IYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKA---L 103

Query: 389 DKQIFQGRLL--HILPADAKKSHRLDEFDLKNMPLKKQRELKKKDNAS 434
           D   F G  L  H++  + K++         N+P  KQ      D+ +
Sbjct: 104 D---FNGTNLRQHVISVERKRT---------NIPNYKQNTSNNTDSGT 139

>YBL051C (PIN4) [144] chr2 complement(122718..124724) Protein with
           weak similarity to RNA-binding proteins, contains one
           RNA recognition (RRM) domain [2007 bp, 668 aa]
          Length = 668

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 680 HADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK 720
           H D  +  G  FA F T E+   VI++L+G  I G +++++
Sbjct: 119 HFDNGIFRGLAFANFTTPEETTQVITSLNGKEISGRKLKVE 159

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 1/70 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLQGVH 806
           N+PF   ++ + ++               FD    RG AF  F  P+E    +  L G  
Sbjct: 91  NIPFAIKKEQLLDIIEEMDLPLPYAFNYHFDNGIFRGLAFANFTTPEETTQVITSLNGKE 150

Query: 807 LLGRRLVMQY 816
           + GR+L ++Y
Sbjct: 151 ISGRKLKVEY 160

>YDR381W (YRA1) [1208] chr4 (1236546..1236830,1237597..1237992)
           Protein with RNA:RNA annealing activity, involved in
           mRNA packaging for export from the nucleus, contains one
           RNA recognition (RRM) domain [681 bp, 226 aa]
          Length = 226

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 10/85 (11%)

Query: 3   RIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHN 62
           ++ V+GLP  +  D +++ F  ++    +          V +  N  G+S   A I + N
Sbjct: 79  KVNVEGLPRDIKQDAVREFFASQVGGVQR----------VLLSYNERGQSTGMANITFKN 128

Query: 63  EEDAFDAVNYFNGSYINTAKLEVSM 87
            E A  AV  FNGS I+  +  + +
Sbjct: 129 GELARRAVERFNGSPIDGGRSRLRL 153

>KLLA0B10472g complement(914512..915108) similar to sgd|S0006099
           Saccharomyces cerevisiae YPL178w SAE1 small subunit of
           the nuclear cap-binding protein complex CBC, start by
           similarity
          Length = 198

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 15/65 (23%), Positives = 36/65 (55%)

Query: 320 MEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPK 379
           + K  K+  +++ N+ + T+E+   +LF   G ++++ + LD       GF +I+F   +
Sbjct: 40  LRKSMKSCTVYVGNLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFDKME 99

Query: 380 EAVQA 384
           +A+ +
Sbjct: 100 DALNS 104

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 1/68 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVP-KKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           NL F  + + ++ELF+  G +K + +   +F  +  GF F+ F   ++A N++  L    
Sbjct: 53  NLSFYTSEEQIYELFSKCGTIKKIIMGLDRFKFTPCGFCFIIFDKMEDALNSIKYLGDTK 112

Query: 807 LLGRRLVM 814
           L  R + +
Sbjct: 113 LDDRHITI 120

>Kwal_55.21039
          Length = 119

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 5/63 (7%)

Query: 338 TTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIFQGRL 397
           T  ++   LF  +GE+ ++ +     + + +G A+I+ K   EA  A I L+ + F G+ 
Sbjct: 50  TLRENLFLLFSTYGEVLQIDM-----SKRIRGQAFIVLKTVDEANIALISLNNEPFFGKD 104

Query: 398 LHI 400
           LHI
Sbjct: 105 LHI 107

>CAGL0H02123g complement(188454..190121) similar to sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 555

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 329 LFLRNILYTTTEDDFRKLF-GPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           +F+ ++  + TE     LF   +       V  D  TG SKG+ ++ FK   +  +A +E
Sbjct: 192 IFVGDLAPSVTEAQLFDLFINKYPSTVHAKVMYDQLTGISKGYGFVKFKSSMDQQRALVE 251

Query: 388 LDKQIFQGRLLHI 400
           +      GR + I
Sbjct: 252 MQGCFLNGRAIKI 264

>KLLA0F14861g 1375042..1376811 some similarities with sp|Q00539
           Saccharomyces cerevisiae YHR086w NAM8 meiotic
           recombination protein, hypothetical start
          Length = 589

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 2/62 (3%)

Query: 753 ATRKDVFELFNS--FGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGR 810
            T   +FELF S     L +  V  +F   ++G+ FV+F+   E + A+ ++QG  L GR
Sbjct: 161 VTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVEMQGTFLNGR 220

Query: 811 RL 812
            +
Sbjct: 221 AI 222

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query: 329 LFLRNILYTTTEDDFRKLF-GPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           LF+ ++    TE    +LF   +       +  D  TG SKG+ ++ F +  E  +A +E
Sbjct: 152 LFVGDLAPNVTEAQLFELFISRYSSTLNAKIVFDQFTGVSKGYGFVKFVNEMEQQRALVE 211

Query: 388 LDKQIFQGRLLHI 400
           +      GR + +
Sbjct: 212 MQGTFLNGRAIRV 224

>KLLA0C08041g complement(705516..707240) gi|24741192|emb|CAD56154.1
           Kluyveromyces lactis CCr4/NOT complex/transcription
           factor subunit, start by similarity
          Length = 574

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%)

Query: 688 GFG-FAEFRTKEQANAVISALDGTVIDGHRIQ 718
           G+G +  F  K+ A   I A+DG  IDGH+++
Sbjct: 200 GYGIYVTFSRKDDAAKCIQAIDGIYIDGHQVK 231

>Scas_241.1
          Length = 186

 Score = 31.6 bits (70), Expect = 1.8,   Method: Composition-based stats.
 Identities = 16/63 (25%), Positives = 33/63 (52%), Gaps = 5/63 (7%)

Query: 754 TRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRLV 813
           +  D+ + F  FG +  V++P     + +G  FV+++    AE A+ ++QG  L   R+ 
Sbjct: 38  SEDDLRQYFQPFGDIIYVKIP-----TGKGCGFVQYVDRLSAELAISKMQGFPLANSRIR 92

Query: 814 MQY 816
           + +
Sbjct: 93  LSW 95

>Scas_632.7*
          Length = 229

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 10/80 (12%)

Query: 3   RIIVKGLPSFLTDDNLKQHFEKRLNQTHKNEPINSLITDVKILRNREGESRKFAFIGYHN 62
           ++ V+GLP  +  D +++ F  ++    +          V +  N  G+S   A I + N
Sbjct: 78  KVNVEGLPRDIKQDAVREFFASQVGGVQR----------VLLSYNERGQSTGMANITFRN 127

Query: 63  EEDAFDAVNYFNGSYINTAK 82
            + A  AV  FNG+ I+  +
Sbjct: 128 AQQAKVAVTKFNGAPIDGGR 147

>KLLA0C07194g 624694..625587 no similarity, hypothetical start
          Length = 297

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 21/45 (46%)

Query: 512 DAKVILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEY 556
           D   + V  FP GT   E+   F   G+L R+ +PP G    + Y
Sbjct: 3   DRNTVHVSGFPAGTRANELAPQFENVGRLVRIDIPPLGRFKSIPY 47

>CAGL0F08217g complement(814508..816544) similar to sp|P53316
           Saccharomyces cerevisiae YGR250c, hypothetical start
          Length = 678

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 749 LPFEATRKDVFELFNSFGQLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHL 807
           +P   +   + E F+ FG + S+++   FD    G  F+ F+L  EA   +  + G  +
Sbjct: 146 IPKNMSLNTLMETFDKFGTISSLKI--LFDNKNVGIGFLSFMLGSEAAECIRCMNGTKI 202

>Scas_665.4
          Length = 219

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           N+  + T++ ++ELF     +  +R PK K  +  +G+AF+EF   K+ +  +  +    
Sbjct: 16  NIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKDVQYVIQVMNNTV 75

Query: 807 LLGRRLV 813
            L  R +
Sbjct: 76  ALYDRFL 82

>YOR319W (HSH49) [5101] chr15 (912817..913458) U2 snRNP protein and
           pre-mRNA splicing factor with similarity to human SAP49,
           has 2 RNA recognition (RRM) domains [642 bp, 213 aa]
          Length = 213

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 754 TRKDVFELFNSFGQLKSVRVPK-KFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL 812
           T++ ++ELF     +  ++ PK K  ++ +G+AF+EF    +A+ A+  +     L  RL
Sbjct: 21  TKEQLYELFIQINPVLRIKYPKDKVLQAYQGYAFIEFYNQGDAQYAIKIMNNTVRLYDRL 80

Query: 813 V 813
           +
Sbjct: 81  I 81

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 1/75 (1%)

Query: 318 IAMEKISKTGRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKD 377
           I+ + I    +LF++N+  +   D   K+F  FG+L           GK K  AY+ F+D
Sbjct: 99  ISKDMILPIAKLFIKNLADSIDSDQLVKIFNKFGKLIREPEIFYLSNGKLKC-AYVYFED 157

Query: 378 PKEAVQAYIELDKQI 392
            ++A  A   L+ Q+
Sbjct: 158 FEKADLAIKSLNNQL 172

>ABL059W [533] [Homologous to ScYOR319W (HSH49) - SH]
           complement(287620..288234) [615 bp, 204 aa]
          Length = 204

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 327 GRLFLRNILYTTTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYI 386
            +LF++N+  T      +KLFG FG L +       + G  +  AY+ F   + + +A  
Sbjct: 98  AKLFVKNLDSTIDAVQLQKLFGKFGPLAKPPQLFTLKDGALRC-AYVYFTTFRHSDEALE 156

Query: 387 ELDKQIFQGRLLHI 400
           +L+ QI   +++ I
Sbjct: 157 KLNNQIVANQIISI 170

>CAGL0L04290g complement(499514..501778) similar to sp|Q12216
           Saccharomyces cerevisiae YOR156c NFI1 interacts with
           CDC12P in 2-hybrid assay, hypothetical start
          Length = 754

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 160 QVPSWEKPVSHKNAEEDNEESSNPLLALLNNGDDD 194
           QVP+WE PV  K  + ++  +S  +L +L N DD+
Sbjct: 375 QVPTWECPVCSKEVDLNSLATSEYVLEILKNTDDE 409

>Scas_622.8
          Length = 287

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 13/72 (18%)

Query: 510 QRDAKVILVKNFPYGTTREEIGELFLPFGKLKRLLMPPSGTIAIVEYRDTTSGRSAFTK- 568
           +R    + V N PY  T+EE+ EL   FG    L++ P   +     RD T+ +  F++ 
Sbjct: 168 ERSKDTLYVNNLPYSATKEELAEL---FGTKPELVVLPKRRM-----RDETTKKVVFSET 219

Query: 569 ----LAFKRFKD 576
               +AF  F++
Sbjct: 220 LNRGIAFITFEN 231

>ACR235W [1282] [Homologous to ScYBL051C (PIN4) - SH]
           complement(771971..773707) [1737 bp, 578 aa]
          Length = 578

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLQGVH 806
           N+PF   ++ + E+               FD    RG AF  F   +E    +  L G  
Sbjct: 55  NIPFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTEETMQVVQHLNGKE 114

Query: 807 LLGRRLVMQY 816
           + GRRL ++Y
Sbjct: 115 IGGRRLRVEY 124

 Score = 30.0 bits (66), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (53%)

Query: 680 HADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK 720
           H D  +  G  FA F T E+   V+  L+G  I G R++++
Sbjct: 83  HFDNGVFRGLAFANFTTTEETMQVVQHLNGKEIGGRRLRVE 123

>Scas_591.5*
          Length = 290

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%)

Query: 482 AHIIGDVRKYFESKGVDLTKFAQTKSPEQRDAKVILVKNFPYGTTREEIGELF 534
           +HI   V K   +  V   K   T + E    K++LV++ P   T+E IGELF
Sbjct: 187 SHIEKSVPKKLPTDKVINEKKKVTSTVENPPNKILLVQDLPEDATQESIGELF 239

>YFR032C (YFR032C) [1713] chr6 complement(222078..222947) Protein
           with weak similarity to S. pombe poly(A)-binding protein
           (SP:P31209), has one RNA recognition (RRM) domain [870
           bp, 289 aa]
          Length = 289

 Score = 30.4 bits (67), Expect = 5.5,   Method: Composition-based stats.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 4/83 (4%)

Query: 643 IFIKNLNFTTTSVELSKRFKTF---SGFVVAQVKTKPDPKH-ADKTLSMGFGFAEFRTKE 698
           ++I NL FT +  +L      +   S  +  Q   +   +H ++    +G  FA+F    
Sbjct: 20  VYISNLPFTASERDLHAFLNNYGASSVLIPTQTVRRFSKRHNSNPRKPLGIAFAQFANNT 79

Query: 699 QANAVISALDGTVIDGHRIQLKL 721
            A   I  L+GTV    ++ LKL
Sbjct: 80  LALKAIQDLNGTVFQNQKLFLKL 102

>KLLA0B11594g complement(1018044..1018388) some similarities with
           sp|P40567 Saccharomyces cerevisiae YIR009w MSL1 U2
           snRNA-associated protein with singleton, hypothetical
           start
          Length = 114

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 5/56 (8%)

Query: 338 TTEDDFRKLFGPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIELDKQIF 393
           T  +    LF  +GE+ +V +     T K +G A+I FK   EA  A + L  ++F
Sbjct: 47  TVRESLYMLFATYGEVIKVSM-----TPKQRGQAFITFKSVDEANLALLSLKDELF 97

>Kwal_55.20154
          Length = 522

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/73 (21%), Positives = 32/73 (43%), Gaps = 1/73 (1%)

Query: 329 LFLRNILYTTTEDDFRKLF-GPFGELEEVHVALDTRTGKSKGFAYILFKDPKEAVQAYIE 387
           +F+ ++    TE    +LF   +       +  D  TG SKG+ ++ F    E  ++ +E
Sbjct: 137 VFVGDVAPNVTEAQLFELFISRYASTLNAKIVFDQMTGVSKGYGFVKFGQESEQQRSLLE 196

Query: 388 LDKQIFQGRLLHI 400
           +      GR + +
Sbjct: 197 MQGVFLNGRAIRV 209

>Scas_500.6
          Length = 621

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 29/70 (41%), Gaps = 1/70 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLKSVRVPKKFDKSA-RGFAFVEFLLPKEAENAMDQLQGVH 806
           N+PF   R+ + ++               FD    RG AF  F    E    ++ L G  
Sbjct: 59  NIPFAIKREQLLDIMAKMDLPLPYAFNYHFDNGVFRGLAFANFTTTDETTRVIECLNGKE 118

Query: 807 LLGRRLVMQY 816
           + GR+L ++Y
Sbjct: 119 IGGRKLRVEY 128

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 22/41 (53%)

Query: 680 HADKTLSMGFGFAEFRTKEQANAVISALDGTVIDGHRIQLK 720
           H D  +  G  FA F T ++   VI  L+G  I G +++++
Sbjct: 87  HFDNGVFRGLAFANFTTTDETTRVIECLNGKEIGGRKLRVE 127

>Scas_645.14
          Length = 717

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 688 GFGFAEFRTKEQANAVISALDGTVIDGHRI 717
           G+GF    + EQA  VI  LDG    G+R+
Sbjct: 350 GYGFVNLGSHEQALKVIQTLDGLEWKGNRL 379

>YMR268C (PRP24) [4222] chr13 complement(802887..804221) Pre-mRNA
           splicing factor, responsible for reannealing U4 and U6
           snRNAs to recycle snRNPs for subsequent splicing
           reactions, has 3 RNA recognition (RRM) domains [1335 bp,
           444 aa]
          Length = 444

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 748 NLPFEATRKDVFELFNSFGQLK-SVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVH 806
           N P   T++++ +L      +  S+R+P     ++R FA+++    ++A   +++L G+ 
Sbjct: 123 NFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSKEDARYCVEKLNGLK 182

Query: 807 LLGRRLV 813
           + G  LV
Sbjct: 183 IEGYTLV 189

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 27,009,592
Number of extensions: 1210612
Number of successful extensions: 7130
Number of sequences better than 10.0: 334
Number of HSP's gapped: 6756
Number of HSP's successfully gapped: 675
Length of query: 869
Length of database: 16,596,109
Length adjustment: 110
Effective length of query: 759
Effective length of database: 12,788,129
Effective search space: 9706189911
Effective search space used: 9706189911
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 66 (30.0 bits)