Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_705.1932431115470.0
YPR114W3152998721e-117
CAGL0B04191g2972967412e-97
KLLA0D15059g3283165991e-75
Sklu_1468.23183115931e-74
Kwal_55.205563103125805e-73
AAR085W3053095066e-62
Sklu_1942.42902292168e-20
KLLA0D10868g2832561921e-16
Sklu_1914.22722031912e-16
YJR116W2792771603e-12
CAGL0H00572g2822751603e-12
ABR162W2712231471e-10
Scas_691.232732221471e-10
Kwal_55.197662702201471e-10
YLR320W (MMS22)145491691.3
CAGL0I04774g423132671.9
KLLA0D19536g45070645.2
KLLA0F04169g58328628.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_705.19
         (324 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_705.19                                                           600   0.0  
YPR114W (YPR114W) [5535] chr16 (753297..754244) Protein of unkno...   340   e-117
CAGL0B04191g 408700..409593 similar to tr|Q06107 Saccharomyces c...   290   2e-97
KLLA0D15059g 1270160..1271146 similar to sgd|S0006318 Saccharomy...   235   1e-75
Sklu_1468.2 YPR114W, Contig c1468 762-1718                            233   1e-74
Kwal_55.20556                                                         228   5e-73
AAR085W [271] [Homologous to ScYPR114W - SH] complement(495296.....   199   6e-62
Sklu_1942.4 , Contig c1942 3428-4300 reverse complement                88   8e-20
KLLA0D10868g complement(926978..927829) similar to sp|P47153 Sac...    79   1e-16
Sklu_1914.2 YJR116W, Contig c1914 2139-2957                            78   2e-16
YJR116W (YJR116W) [3008] chr10 (640740..641579) Protein of unkno...    66   3e-12
CAGL0H00572g complement(55888..56736) similar to sp|P47153 Sacch...    66   3e-12
ABR162W [755] [Homologous to ScYJR116W - SH] complement(706451.....    61   1e-10
Scas_691.23                                                            61   1e-10
Kwal_55.19766                                                          61   1e-10
YLR320W (MMS22) [3708] chr12 (771940..776304) Protein of unknown...    31   1.3  
CAGL0I04774g complement(427445..428716) similar to sp|P35206 Sac...    30   1.9  
KLLA0D19536g complement(1646330..1647682) similar to sp|P53867 S...    29   5.2  
KLLA0F04169g 395518..397269 similar to sp|P38361 Saccharomyces c...    28   8.6  

>Scas_705.19
          Length = 324

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/311 (95%), Positives = 296/311 (95%)

Query: 1   MNKIASILDRTMDCLLELPQPVIFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMW 60
           MNKIASILDRTMDCLLELPQPVIFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMW
Sbjct: 1   MNKIASILDRTMDCLLELPQPVIFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMW 60

Query: 61  FLIAKYIIFPPFVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISL 120
           FLIAKYIIFPPFVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISL
Sbjct: 61  FLIAKYIIFPPFVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISL 120

Query: 121 LQCVFVLYPSLSILLNPAKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYS 180
           LQCVFVLYPSLSILLNPAKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYS
Sbjct: 121 LQCVFVLYPSLSILLNPAKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYS 180

Query: 181 SIAFVLHGIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPSNNKFIDYX 240
           SIAFVLHGIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPSNNKFIDY 
Sbjct: 181 SIAFVLHGIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPSNNKFIDYL 240

Query: 241 XXXXXXXXXXXXXXARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLILDVLNA 300
                         ARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLILDVLNA
Sbjct: 241 LLFNNLLLMIIFFLARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLILDVLNA 300

Query: 301 IWLSTMVKVAI 311
           IWLSTMVKVAI
Sbjct: 301 IWLSTMVKVAI 311

>YPR114W (YPR114W) [5535] chr16 (753297..754244) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.7788p [948 bp, 315 aa]
          Length = 315

 Score =  340 bits (872), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 165/299 (55%), Positives = 208/299 (69%), Gaps = 2/299 (0%)

Query: 12  MDCLLELPQPVIFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMWFLIAKYIIFPP 71
           MD LL LPQP +FKT V+  L + N++ S AIL+NLHSI YVA+FYH+WFL  K+I+FP 
Sbjct: 1   MDVLLSLPQPELFKTTVIPFLANRNIIKSEAILSNLHSIFYVAIFYHIWFLFGKWILFPH 60

Query: 72  FVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISLLQCVFVLYPSL 131
            VK K+ +DQ+       KT   +  +H   KK+Y SL+ Q S+H ISLLQ + VLY SL
Sbjct: 61  LVKWKLDYDQKHNVKKDEKTTSERQAQHY--KKKYTSLINQSSVHLISLLQSIVVLYYSL 118

Query: 132 SILLNPAKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYSSIAFVLHGIVS 191
             LL+P  S+E +  S +RVF   RDT+V+CIFAIGYF+WD  IS  YS+  FV+HGI+S
Sbjct: 119 KFLLDPKASAEPYQTSHSRVFTENRDTQVICIFAIGYFVWDIYISTMYSTFPFVVHGIIS 178

Query: 192 AAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPSNNKFIDYXXXXXXXXXXXX 251
             V+ IGLKPYIQYYAPVF+MFELSNP LNFRWFGIK LP  +KF               
Sbjct: 179 TVVFCIGLKPYIQYYAPVFLMFELSNPSLNFRWFGIKFLPQKSKFCSLLLLLNNLTLMVV 238

Query: 252 XXXARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLILDVLNAIWLSTMVKVA 310
              ARI +GWFQIG + YD+Y VRN+P F++FD++VI+ GN +LD+LN IW STMV VA
Sbjct: 239 FFAARIAWGWFQIGKLCYDFYQVRNEPGFLVFDTIVILAGNFVLDILNVIWFSTMVSVA 297

>CAGL0B04191g 408700..409593 similar to tr|Q06107 Saccharomyces
           cerevisiae YPR114w, hypothetical start
          Length = 297

 Score =  290 bits (741), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 146/296 (49%), Positives = 194/296 (65%), Gaps = 20/296 (6%)

Query: 16  LELPQPVIFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMWFLIAKYIIFPPFVKL 75
           L++P P IF   V+  L+  N+V S AIL+NLHSIIYVAL Y MWFL  ++++FPP  K 
Sbjct: 11  LDIPSPTIFDAKVIPFLRDYNIVKSEAILSNLHSIIYVALGYQMWFLATRWLLFPPLTKW 70

Query: 76  KMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISLLQCVFVLYPSLSILL 135
           ++     +  N   K +K               L I+ +IHF+S LQ + V+Y SL  L 
Sbjct: 71  RLS--HSKVPNDEKKAKK---------------LNIEAAIHFVSFLQTLVVVYLSLIFLC 113

Query: 136 NPAKSSEIFYDS-EARVFGTTRDTEVVCIFAIGYFLWDSVISMFYSSIAFVLHGIVSAAV 194
           +  K+S   YD+  AR+FG +RDTE++ ++AIGYF+WD  IS+ +S++ FVLHGI+S  V
Sbjct: 114 DGDKTSN--YDTVNARIFGRSRDTEIITVYAIGYFVWDVYISVLHSTLPFVLHGIISTVV 171

Query: 195 YFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPSNNKFIDYXXXXXXXXXXXXXXX 254
           + IGLKPYIQYYAPVF+MFELSNPFLN RWFG+K LP+ N+                   
Sbjct: 172 FTIGLKPYIQYYAPVFLMFELSNPFLNLRWFGLKYLPTENRVCSIALLINNLLLLIFFFS 231

Query: 255 ARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLILDVLNAIWLSTMVKVA 310
           ARI +GW+QIG + +D+YTV  DPRF+  DS +IVGGNL+LDVLNAIW  TM+ VA
Sbjct: 232 ARIAWGWYQIGKLTWDFYTVHTDPRFLWLDSSIIVGGNLVLDVLNAIWFGTMLSVA 287

>KLLA0D15059g 1270160..1271146 similar to sgd|S0006318 Saccharomyces
           cerevisiae YPR114w, start by similarity
          Length = 328

 Score =  235 bits (599), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 125/316 (39%), Positives = 185/316 (58%), Gaps = 21/316 (6%)

Query: 4   IASILDRTMDCLLELPQPVIFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMWFLI 63
           ++  +D     ++ LP       YV+  L+SN  ++S  IL+NLH+++Y+A+ YH  FL+
Sbjct: 14  VSEQIDLFTTYVMSLPPHPHLTEYVIPYLESNGWITSNVILSNLHTVLYIAVGYHALFLL 73

Query: 64  AKYIIFPPFVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISLLQC 123
           ++ ++FPP    ++ WD E  K+           + +S +K++  LV Q ++  +S +Q 
Sbjct: 74  SQRVLFPPLASYRLSWDPETTKD-----------QRKSKEKQHADLVNQSAVRLVSWIQS 122

Query: 124 VFVLYPSLSILLNPAKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYSSIA 183
           + VLY S   +    +  ++  +S  R+FG       VC+FAIGYFLWD  IS+ YS++ 
Sbjct: 123 LIVLYLSFEAIAYNNEKPDL--NSHDRIFGMDPYNVKVCVFAIGYFLWDIYISLVYSTLP 180

Query: 184 FVLHGIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPSNN--------K 235
           FVLHG++S  VY IGLKPYI YYA +F+MFELSNPFLN RWFGIK LP           K
Sbjct: 181 FVLHGLISTVVYAIGLKPYINYYAGIFLMFELSNPFLNIRWFGIKYLPQLTKDCQTVMAK 240

Query: 236 FIDYXXXXXXXXXXXXXXXARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLIL 295
             +                ARI +G++Q   +  D+Y +RNDP F+  ++ +IV GNLIL
Sbjct: 241 VCNVIQLVNNVVLILIFFLARICWGFYQFYQLCTDFYNIRNDPSFLPLETAIIVTGNLIL 300

Query: 296 DVLNAIWLSTMVKVAI 311
           DVLN  WLSTM+ VA+
Sbjct: 301 DVLNLFWLSTMLSVAV 316

>Sklu_1468.2 YPR114W, Contig c1468 762-1718
          Length = 318

 Score =  233 bits (593), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 190/311 (61%), Gaps = 25/311 (8%)

Query: 12  MDCLL----ELPQPVIFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMWFLIAKYI 67
           M CL     +LP   +    V+  L  + +V+S  IL NLH+I+YVA  Y + F+I+++ 
Sbjct: 1   MSCLFSYIADLPPHPLISNKVVPFLLEHKIVTSANILANLHTILYVAAAYQLVFVISQWF 60

Query: 68  IFPPFVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISLLQCVFVL 127
           +FP  V+ K+    E  +      + +K++      K Y+SL+ Q ++HF+SL+Q   +L
Sbjct: 61  VFPLLVRWKLSSAGESLE------KDNKIYN-----KEYSSLLNQSAVHFVSLVQSFVIL 109

Query: 128 YPSLSILLNPAKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYSSIAFVLH 187
           Y S   + +  + +     + ARVF ++R+ ++VCIFA+GYF+WD++ISM YSS  FVLH
Sbjct: 110 YLSFGSMQSINRYTHP--SAGARVFASSRENDIVCIFAVGYFIWDTLISMVYSSFPFVLH 167

Query: 188 GIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPS--------NNKFIDY 239
           G +S  ++ IGLKPYI +YAP+F++FELSNPFLNFRWFGIK  P           K ++ 
Sbjct: 168 GAISTVMFLIGLKPYINFYAPIFLLFELSNPFLNFRWFGIKYFPQLTEANRGLVTKILNI 227

Query: 240 XXXXXXXXXXXXXXXARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLILDVLN 299
                          ARI +GW++IG + +D+Y + + P+F+  ++ ++V GNLILDVLN
Sbjct: 228 VQLVNNAVLITMFFLARIFWGWWKIGELCWDFYQIYDQPQFLALETGIVVTGNLILDVLN 287

Query: 300 AIWLSTMVKVA 310
           A+W + M+ VA
Sbjct: 288 AVWFAKMLSVA 298

>Kwal_55.20556
          Length = 310

 Score =  228 bits (580), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 127/312 (40%), Positives = 180/312 (57%), Gaps = 30/312 (9%)

Query: 8   LDRTMDCLLELPQPVIFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMWFLIAKYI 67
           +D  +  L+ L  P  F  ++L      NL+SSP IL +LHSI+YVAL YH  FL +K+I
Sbjct: 1   MDAAVQFLMGLECPASFPKHLLS---QYNLISSPKILAHLHSILYVALAYHAVFLASKWI 57

Query: 68  IFPPFVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISLLQCVFVL 127
           +FPP  +L++     E        R+               L+ Q ++HF+SL+Q   +L
Sbjct: 58  LFPPVARLRLC---SENGKPDRGVRR--------------DLINQSALHFVSLVQSGVIL 100

Query: 128 YPSLSILLNPAKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYSSIAFVLH 187
           Y  L+       ++      E RVF     T+ +CIFAIGYF+WD+VIS+FYSS  FVLH
Sbjct: 101 YLCLTYWQTHGPNTT-HPTPEMRVFHHDVHTDTICIFAIGYFVWDAVISVFYSSAPFVLH 159

Query: 188 GIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPSNN---------KFID 238
           G+VSAA++ IGL  YIQ+YAP F++FELSNPFLN RWFGIK  P  +         +F++
Sbjct: 160 GVVSAAMFCIGLDNYIQFYAPAFLLFELSNPFLNLRWFGIKYFPQLSEGTPASALVRFLN 219

Query: 239 YXXXXXXXXXXXXXXXARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLILDVL 298
           +               ARI +GW QI  +  D++ VR+DPRF+   +++I+ GN +LDVL
Sbjct: 220 FFQLINNIVLILVFFGARIAWGWHQIFHLCCDFWHVRHDPRFLPLQTLIIISGNFVLDVL 279

Query: 299 NAIWLSTMVKVA 310
           N +W   M+ VA
Sbjct: 280 NLVWFCKMLAVA 291

>AAR085W [271] [Homologous to ScYPR114W - SH]
           complement(495296..496213) [918 bp, 305 aa]
          Length = 305

 Score =  199 bits (506), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 173/309 (55%), Gaps = 41/309 (13%)

Query: 16  LELPQPV--IFKTYVLDVLQSNNLVSSPAILNNLHSIIYVALFYHMWFLIAKYIIFPPFV 73
           L L  PV  +    ++  L+ + +V S  +L+++H +IYVALFYH  +L+ K+++FP  V
Sbjct: 6   LALGAPVHPLIGEQLVPFLRRHGVVRSEEMLSHMHLVIYVALFYHCCYLVGKHMLFPGLV 65

Query: 74  KLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISLLQCVFVLYPSLSI 133
           + +                     +  +P++    L++Q +IH++SL+Q V +L  +L  
Sbjct: 66  RWR---------------------RAVAPQR----LLVQSAIHWVSLVQSVVIL--TLCY 98

Query: 134 LLNPAKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYSSIAFVLHGIVSAA 193
              P  +       E RVF TT    V+  FA+GYFLWD+VIS+ +SS+AF LHG VS  
Sbjct: 99  ASWPLHTRATHPRPEDRVFATTPVNSVLASFALGYFLWDTVISLRHSSVAFALHGAVSTV 158

Query: 194 VYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLP---------SNNKFIDYXXXXX 244
           V+ IG+ PYI YYA +F++FELSNPFLN  WF    LP          + + + +     
Sbjct: 159 VFLIGMTPYINYYAGMFLLFELSNPFLNGHWFARHYLPLGSQTHPHAGDARLVRWSARFA 218

Query: 245 XXXXXXXXXX---ARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLILDVLNAI 301
                        ARI YG+++IG +  D+Y VR DPRF+ + +  I+GGNL+L+VLNAI
Sbjct: 219 LANDLVFFTVFFCARIAYGYYKIGELALDFYRVRADPRFMPYGTAFILGGNLVLNVLNAI 278

Query: 302 WLSTMVKVA 310
           W  TMV +A
Sbjct: 279 WFRTMVCMA 287

>Sklu_1942.4 , Contig c1942 3428-4300 reverse complement
          Length = 290

 Score = 87.8 bits (216), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 108/229 (47%), Gaps = 33/229 (14%)

Query: 102 PKKRYNSLVIQCSIHF----ISLLQCVFVLYPSLSILLNPAKSSEIFYDSEARVFGTTRD 157
           P + Y  L  Q  I F    +S +Q + +LY    +  +P  S +       R+ G T  
Sbjct: 64  PSRIYRKLTPQEKIDFHSRVVSFVQTLLILYLIWPLFHDPELSKD-------RINGYTPY 116

Query: 158 TEVVCIFAIGYFLWDSVISM-FYS--SIAFVLHGIVSAAVYFIGLKPYIQYYAPVFMMFE 214
           +  V   A GYF+WD+++S+ FYS   + FV+HG+VSA+V+ I  +P+I YY+P+F++FE
Sbjct: 117 SGFVSAMASGYFIWDTILSIRFYSVFGLPFVVHGLVSASVFLISFQPFILYYSPIFLLFE 176

Query: 215 LSNPFLNFRWFGIKLLPSNNKFIDYXXXXXXX----------------XXXXXXXXARIV 258
           LS PFLN  W  ++  PS    ++                                 RI+
Sbjct: 177 LSTPFLNIHW-CLEFFPSKWAALNKDEKQEEAIFFESKLKPLKLVNGFVFMVTFFLVRII 235

Query: 259 YGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLILDVLNAIWLSTMV 307
           +G      +  D+   R+   +    ++VI+ GN +++ LN  W   M+
Sbjct: 236 WGLTNSYWLFKDFIQFRSQVHWPF--ALVIILGNSVMNCLNLYWFGKMI 282

>KLLA0D10868g complement(926978..927829) similar to sp|P47153
           Saccharomyces cerevisiae YJR116w, start by similarity
          Length = 283

 Score = 78.6 bits (192), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 118/256 (46%), Gaps = 34/256 (13%)

Query: 61  FLIAKYIIFPPFVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPKKRYNSLVIQCSIHFISL 120
           F++ ++I++P  V    +W  +E              +   P K      I   IH +S+
Sbjct: 42  FVVYQFILYPFVVPKLNEWFFKEHYT-----------ERDEPDK------INFDIHTVSM 84

Query: 121 LQCVFVLYPSLSILLNP-AKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFY 179
           +Q V  LY    +L  P   +   +Y+S A          +V   +IGYF+WD  I + Y
Sbjct: 85  IQSVVSLYLIWPLLWIPFGFNVATYYNSYA---------SMVSAVSIGYFMWDLYICLRY 135

Query: 180 S---SIAFVLHGIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLLPSNNKF 236
                I F+ H + + AV  I L P  Q +   F+ FE S PF+N  W+ I+L   ++K 
Sbjct: 136 FKLFGIGFLFHAVAAFAVLTITLHPVCQAWIGRFLSFEASTPFVNINWYIIQLSRGSSKQ 195

Query: 237 I--DYXXXXXXXXXXXXXXXARIVYGWFQIGMIVYDYYTVRNDPRFILFDSVVIVGGNLI 294
           +   +                R+V+G+  + +++Y+ + V +  +  L+ + VI+G N+ 
Sbjct: 196 VVPTWFNVLNGFLLISVFFFVRLVWGFVAVAILIYEMWQVWD--QIPLYMTAVILGINVS 253

Query: 295 LDVLNAIWLSTMVKVA 310
           LD LN  W S M+K+A
Sbjct: 254 LDFLNIHWFSKMLKIA 269

>Sklu_1914.2 YJR116W, Contig c1914 2139-2957
          Length = 272

 Score = 78.2 bits (191), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 102/203 (50%), Gaps = 19/203 (9%)

Query: 115 IHFISLLQCVFVLYPSLSILLNP-AKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDS 173
           IH +S+ QC+  L     IL  P + +   +YD           + +V    +GYF+WD 
Sbjct: 67  IHTVSMFQCILSLVLIYPILFTPLSLNIATYYDPY---------SSLVSSLTMGYFMWDL 117

Query: 174 VISMFYSS---IAFVLHGIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFLNFRWFGIKLL 230
            + + + S   + F+ H   S  V++  L+P+ Q +   F++FE S PF+N  W+  +L 
Sbjct: 118 CVCLRHFSLFGVGFLGHACASLFVFYSTLRPFCQSWVGKFLIFEASTPFVNINWYISQLS 177

Query: 231 PSNNKFI--DYXXXXXXXXXXXXXXXARIVYGWFQIGMIVYDYYTVRND-PRFILFDSVV 287
            +++K +   +                RIV+G+  I +++ + + V +  P+++L     
Sbjct: 178 RTSSKPVVPAWFNVLNGILLIGVFFLVRIVWGFTAILLLLREMWKVWDQLPQWLLLS--- 234

Query: 288 IVGGNLILDVLNAIWLSTMVKVA 310
           I+G N++LD LN  WLS M+K+A
Sbjct: 235 IIGINILLDSLNVFWLSKMIKIA 257

>YJR116W (YJR116W) [3008] chr10 (640740..641579) Protein of unknown
           function, has moderate similarity to uncharacterized C.
           albicans Orf6.7788p [840 bp, 279 aa]
          Length = 279

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 123/277 (44%), Gaps = 40/277 (14%)

Query: 39  SSPAILNNLHSIIYVALFYHMWFLIAKYIIFPPFVKLKMQWDQEEEKNTSAKTRKHKLHK 98
           SS  IL +LH II+  +FY + F +       PF+                   K    K
Sbjct: 25  SSNLILAHLHEIIFSFVFYQLAFSVVA-----PFLN------------------KVVFRK 61

Query: 99  HQSPKKRYNSLVIQCSIHFISLLQCVFVLYPSLSILLNPAKSSEIFYDSEARVFGTTRDT 158
           H +   R   L I  ++H +S++Q V     S ++LL P  ++ + Y+    V  T   +
Sbjct: 62  HYT-TIRDPLLKIDFNVHTVSMIQAVV----SNTVLL-PTLTTPMHYNV---VTYTDSYS 112

Query: 159 EVVCIFAIGYFLWDSVISMFY---SSIAFVLHGIVSAAVYFIGLKPYIQYYAPVFMMFEL 215
            +V   + GYF+WD  + + Y     + F  H I S  V  + L+P+ Q +   F+++E 
Sbjct: 113 SMVSSLSAGYFIWDLTMCVRYFKLYGLEFTGHAIGSVYVMLLSLRPFCQPWIGRFLIYEA 172

Query: 216 SNPFLNFRWFGIKL-LPSNNKFIDYXXXXXXXXXXXXXXXARIVYGWFQIGMIVYDYYTV 274
           S PF+N  WF ++    S N    +                RI +G     ++    + V
Sbjct: 173 STPFVNINWFIMQCNAKSKNSIPLWFNVVNGLLLMTVFFVVRICWGSIASALLFRQMWKV 232

Query: 275 RND-PRFILFDSVVIVGGNLILDVLNAIWLSTMVKVA 310
           R++ P+   F +V ++  N+ +++LN +W   M+++A
Sbjct: 233 RDELPK---FSAVTMMSLNIFMNLLNVLWFKKMIRIA 266

>CAGL0H00572g complement(55888..56736) similar to sp|P47153
           Saccharomyces cerevisiae YJR116w, start by similarity
          Length = 282

 Score = 66.2 bits (160), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 114/275 (41%), Gaps = 42/275 (15%)

Query: 44  LNNLHSIIYVALFYHMWFLIAKYIIFPPFVKLKMQWDQEEEKNTSAKTRKHKLHKHQSPK 103
           L +LH I+Y  +FY     + +Y I P                   K  ++   KH S  
Sbjct: 31  LAHLHEIVYAFIFYQ----VCQYTIAP-------------------KINRYFFGKHYSDI 67

Query: 104 KRYNSLVIQCSIHFISLLQCVFVLYPSLSILLNPAKSSEIFYDSEARVFGTTRDTEVVCI 163
                L +   +H +S++Q V  +   L +L  P       +D     +       +V  
Sbjct: 68  TD-KKLKLDFDVHTVSMIQAVISIAILLPVLALP-------FDLNIATY-VNPWCSMVSA 118

Query: 164 FAIGYFLWDSVISMFYSSI---AFVLHGIVSAAVYFIGLKPYIQYYAPVFMMFELSNPFL 220
            + GYF+WD  + + + SI    F+ H + S  V    L P+ Q +   +++FE S PF+
Sbjct: 119 LSCGYFVWDLALCLRHFSIYGFEFLFHAVGSLVVMLAILTPFCQPWVGKYLLFEASTPFV 178

Query: 221 NFRWFGIKL-----LPSNNKFIDYXXXXXXXXXXXXXXXARIVYGWFQIGMIVYDYYTVR 275
           N  W+ I+L       S     ++                RIV+GW    +++  ++  R
Sbjct: 179 NMNWYTIQLNHKHKSSSGPVIPNWLNMINGLLLLLTFFGVRIVWGWSCNLLLLRQFWRAR 238

Query: 276 NDPRFILFDSVVIVGGNLILDVLNAIWLSTMVKVA 310
            +  ++     V++  N+ + +LN +W S M+K+A
Sbjct: 239 YELPYL--AGAVVLSLNITMSLLNVLWFSKMLKIA 271

>ABR162W [755] [Homologous to ScYJR116W - SH]
           complement(706451..707266) [816 bp, 271 aa]
          Length = 271

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 92/223 (41%), Gaps = 27/223 (12%)

Query: 97  HKHQSPKKRYNSLVIQCSIHFISLLQ---CVFVLYPSLSILLNPAKSSEIFYDSEARVFG 153
           +   +P+ R N       IH +S +Q   CV +++P L   L  A     FYD  A +  
Sbjct: 53  YTRAAPRTRAN-----FDIHTVSTVQAVLCVGMIWPLLR--LPAALPVFGFYDEYASLVA 105

Query: 154 TTRDTEVVCIFAIGYFLWDSVISMFYSSI---AFVLHGIVSAAVYFIGLKPYIQYYAPVF 210
            T          +GYF+WD  +   Y ++    F+ H + S AV    L P  Q +   F
Sbjct: 106 AT---------MVGYFVWDVYLCTRYLAVFGPGFLGHALGSLAVLLSALTPAFQPWLGKF 156

Query: 211 MMFELSNPFLNFRWFGIKLLPSNNKFI--DYXXXXXXXXXXXXXXXARIVYGWFQIGMIV 268
           ++FE S P +N  WF  +L   +   +   +                RIV+G   + +I 
Sbjct: 157 LIFEASTPLVNVNWFITQLARGSTSAVVPRWLPVVNGLLLLVTFFCVRIVWG--VMALIA 214

Query: 269 YDYYTVRN-DPRFILFDSVVIVGGNLILDVLNAIWLSTMVKVA 310
            DYY  R   P       +++   N  + +LN  W   MV++A
Sbjct: 215 MDYYVWRQWGPETPKLVGLLVPAINFFMTLLNFYWFYKMVRIA 257

>Scas_691.23
          Length = 273

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 105/222 (47%), Gaps = 26/222 (11%)

Query: 99  HQSPKKRYNSLVIQCSIHFISLLQC---VFVLYPSLSILLNPAKSSEIFYDSEARVFGTT 155
           + S K +Y  + +   +H +S++Q    +F+++P+L +   P   + + Y          
Sbjct: 56  YSSIKDKY--VKVDFDVHTVSMIQAAVSLFIIWPTLFL---PNNLNVVTYHGPL------ 104

Query: 156 RDTEVVCIFAIGYFLWDSVISMFYSSI---AFVLHGIVSAAVYFIGLKPYIQYYAPVFMM 212
             T +V    IGYFLWD ++ + Y  +    F+ H + S  V  + LKP+ Q +   F++
Sbjct: 105 --TSMVASLTIGYFLWDLLVCIRYFRVYGFEFLAHAVGSLYVMLLVLKPFCQPWVGKFLL 162

Query: 213 FELSNPFLNFRWFGIKLL-PSNNKFI--DYXXXXXXXXXXXXXXXARIVYGWFQIGMIVY 269
           +E S PF+N  W+ I+L  P   K I   +                R+ +G     ++  
Sbjct: 163 YEASTPFVNINWYIIQLTDPITKKCIIPMWINVLNGLVLMATFGLVRLCWGSIATLILGR 222

Query: 270 DYYTVRND-PRFILFDSVVIVGGNLILDVLNAIWLSTMVKVA 310
             + +++  PR     S+ ++  N++++ +N +W S M+++A
Sbjct: 223 QMWLIKDQLPR---TSSIAMLVLNVVMNSMNFMWFSKMIRIA 261

>Kwal_55.19766
          Length = 270

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 101/220 (45%), Gaps = 26/220 (11%)

Query: 104 KRYNSLV-----IQCSIHFISLLQCVFVLYPSLSILLNPAKSSEIFYDSEARVFGTTRD- 157
           +RY  L      +   IH +S++QCV  L  +  IL  P   S           GT +D 
Sbjct: 52  RRYTELENRNTKLNFDIHTVSMVQCVVSLGLTWPILWQPLSLS----------LGTYQDP 101

Query: 158 -TEVVCIFAIGYFLWDSVISMFYS---SIAFVLHGIVSAAVYFIGLKPYIQYYAPVFMMF 213
            T +V     GYF+WD  + + +     + F+ H + +  V+ + L+P+ Q +   F++F
Sbjct: 102 YTSMVAAVTCGYFIWDLWVCLRHLKLFGLGFLGHAVAALYVFVLALRPFGQGWVGKFLIF 161

Query: 214 ELSNPFLNFRWFGIKLLPSNNKFI--DYXXXXXXXXXXXXXXXARIVYGWFQIGMIVYDY 271
           E S PF+N  WF  +L     + +   +                R+++G+  I +++   
Sbjct: 162 EASTPFVNVNWFISQLTREAGRPVVPMWLNAINGALLIVVFFVVRVLWGFSAIILLIGKL 221

Query: 272 YTVRND-PRFILFDSVVIVGGNLILDVLNAIWLSTMVKVA 310
           +  R + P +I    + IV  NL LD LN  WL+ MV++A
Sbjct: 222 WQARAELPTWI---PMTIVPLNLALDALNLFWLTKMVQIA 258

>YLR320W (MMS22) [3708] chr12 (771940..776304) Protein of unknown
            function [4365 bp, 1454 aa]
          Length = 1454

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 34/91 (37%), Gaps = 8/91 (8%)

Query: 150  RVFGTTRDTEVVCIFAIGYFLWDS--VISMFYSSIAFVLHGIVSAAVYFIGLKPYIQYYA 207
            R  G + D +  C F      WDS        S  AFV  GIV A      +  Y+   +
Sbjct: 1237 RELGISSDEDEKCAF------WDSFNEAGDILSKAAFVETGIVQACCTGNEIDGYLDNLS 1290

Query: 208  PVFMMFELSNPFLNFRWFGIKLLPSNNKFID 238
             +F    L +PF  F    I  +  N  F D
Sbjct: 1291 TLFTSTMLESPFAFFSDLVIAHIFENRPFFD 1321

>CAGL0I04774g complement(427445..428716) similar to sp|P35206
           Saccharomyces cerevisiae YBR036c CSG2 calcium dependent
           regulatory protein, start by similarity
          Length = 423

 Score = 30.4 bits (67), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 53/132 (40%), Gaps = 20/132 (15%)

Query: 29  LDVLQSNNLVSSPAILNNLHSIIYVALFYHMWFLIAKYIIFPPFVKLKMQWDQEEEKNTS 88
           L + +    +S P + + L S +   L           +   PF  L  +W     +++S
Sbjct: 219 LSINKDTGELSDPFLFDRLKSSLLCGL---------GALTIGPFAVLWNRWFGGRSRSSS 269

Query: 89  AKTR-------KHKLHKHQSPKKRYNSLVIQCS-IHFISLLQCVFVLYPSLSILLNPAKS 140
             T+        H L +H   +   NS V QC+ + FI L+  + VL+P L  +  P  S
Sbjct: 270 VLTKTLPQSSVSHSLLEHIKARNAVNSFVKQCTHLSFIGLVGMI-VLFPFLPAI--PTSS 326

Query: 141 SEIFYDSEARVF 152
             + +    R F
Sbjct: 327 ETVSFLYSDRTF 338

>KLLA0D19536g complement(1646330..1647682) similar to sp|P53867
           Saccharomyces cerevisiae YNL223w AUT2 essential for
           autophagy singleton, start by similarity
          Length = 450

 Score = 29.3 bits (64), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 10/70 (14%)

Query: 138 AKSSEIFYDSEARVFGTTRDTEVVCIFAIGYFLWDSVISMFYSSIAFVLH---------G 188
            +S++I+ D   R+F   RD  ++ +FA+   + D + S+++  I  +L          G
Sbjct: 219 TQSADIYEDEVTRIFHKDRDANLLLLFAVRLGV-DKINSLYWKDIFKILSSPYSVGIAGG 277

Query: 189 IVSAAVYFIG 198
             S+++YF G
Sbjct: 278 KPSSSLYFFG 287

>KLLA0F04169g 395518..397269 similar to sp|P38361 Saccharomyces
           cerevisiae YBR296c PHO89 Na+-coupled phosphate transport
           protein, high affinity singleton, start by similarity
          Length = 583

 Score = 28.5 bits (62), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 175 ISMFYSSIAFVLHGIVSAAVYFIGLKPY 202
           +S   +++A VL G+V+ AVYFI L PY
Sbjct: 216 LSGTTTALAIVLTGLVACAVYFIFLYPY 243

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.329    0.143    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,836,429
Number of extensions: 401445
Number of successful extensions: 1467
Number of sequences better than 10.0: 23
Number of HSP's gapped: 1457
Number of HSP's successfully gapped: 24
Length of query: 324
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 222
Effective length of database: 13,065,073
Effective search space: 2900446206
Effective search space used: 2900446206
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)