Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_705.1828028014670.0
Sklu_1209.23412843402e-37
KLLA0D15125g2822792882e-30
YPR116W2772852812e-29
AAR088W2882592803e-29
CAGL0D04488g2601371971e-17
Kwal_55.205432722511761e-14
KLLA0E04763g636118700.86
YDR021W (FAL1)39978661.9
KLLA0E23804g187361644.4
Sklu_1937.194553635.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_705.18
         (280 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_705.18                                                           569   0.0  
Sklu_1209.2 YPR116W, Contig c1209 1067-2092 reverse complement        135   2e-37
KLLA0D15125g 1275978..1276826 weakly similar to sgd|S0006320 Sac...   115   2e-30
YPR116W (YPR116W) [5537] chr16 (758644..759477) Protein of unkno...   112   2e-29
AAR088W [274] [Homologous to ScYPR116W - SH] complement(500105.....   112   3e-29
CAGL0D04488g 438456..439238 weakly similar to tr|Q06109 Saccharo...    80   1e-17
Kwal_55.20543                                                          72   1e-14
KLLA0E04763g complement(429714..431624) similar to sgd|S0006383 ...    32   0.86 
YDR021W (FAL1) [874] chr4 (486800..487999) Member of the DEAD-bo...    30   1.9  
KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces...    29   4.4  
Sklu_1937.1 YJL154C, Contig c1937 288-3125                             29   5.1  

>Scas_705.18
          Length = 280

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/280 (100%), Positives = 280/280 (100%)

Query: 1   MGHAGNAIKKLLDTRVTALKHAPLDLPPITSPLLISFERWSDKRKKLFFDDEETMKSSNV 60
           MGHAGNAIKKLLDTRVTALKHAPLDLPPITSPLLISFERWSDKRKKLFFDDEETMKSSNV
Sbjct: 1   MGHAGNAIKKLLDTRVTALKHAPLDLPPITSPLLISFERWSDKRKKLFFDDEETMKSSNV 60

Query: 61  HNLNLKDNLFANLLSAPMRSEKLTRVKLPKDMLMQLNLETTESSSSKTRLRLNATINHKR 120
           HNLNLKDNLFANLLSAPMRSEKLTRVKLPKDMLMQLNLETTESSSSKTRLRLNATINHKR
Sbjct: 61  HNLNLKDNLFANLLSAPMRSEKLTRVKLPKDMLMQLNLETTESSSSKTRLRLNATINHKR 120

Query: 121 RGRSSYVINSCRILDQNRKMVNSWLPMPPSISSVQYFEIPDVEIPTDLFSKYGDDLFAIL 180
           RGRSSYVINSCRILDQNRKMVNSWLPMPPSISSVQYFEIPDVEIPTDLFSKYGDDLFAIL
Sbjct: 121 RGRSSYVINSCRILDQNRKMVNSWLPMPPSISSVQYFEIPDVEIPTDLFSKYGDDLFAIL 180

Query: 181 LKSLEKRDSAHSTKTTNQINDWDVILTNDKERNSMVALMKVLINGADNTLINFNLPSFAE 240
           LKSLEKRDSAHSTKTTNQINDWDVILTNDKERNSMVALMKVLINGADNTLINFNLPSFAE
Sbjct: 181 LKSLEKRDSAHSTKTTNQINDWDVILTNDKERNSMVALMKVLINGADNTLINFNLPSFAE 240

Query: 241 NEWEEIRKVNNLLYEDGVVLKSNGDENTIKLLYKYIMYSI 280
           NEWEEIRKVNNLLYEDGVVLKSNGDENTIKLLYKYIMYSI
Sbjct: 241 NEWEEIRKVNNLLYEDGVVLKSNGDENTIKLLYKYIMYSI 280

>Sklu_1209.2 YPR116W, Contig c1209 1067-2092 reverse complement
          Length = 341

 Score =  135 bits (340), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 152/284 (53%), Gaps = 20/284 (7%)

Query: 7   AIKKLLDTRVTALKHAPLDLPPITSPLLISFERWSDKRKKLFFDDEETMKSSNVHNLNLK 66
           A K L+   VT L  AP     +T+PLL +F +WSDK+KKL F  E+   S  + N +L+
Sbjct: 66  ASKNLIGRNVTRLPTAP----TVTTPLLTNFTKWSDKKKKLSFKSEKDF-SFVLPNFHLE 120

Query: 67  DNLFANLLSAPMRSEKLTRVKLPKDMLMQLNL--------ETTESSSSKTRLRLNATINH 118
            NLFA LL++PMR +++TR+K+PKD L+QL L        E   S  +KT L L   + H
Sbjct: 121 KNLFAQLLASPMRCDRVTRLKVPKDFLIQLKLKKLNNNEAERNASKRNKT-LELLPLVEH 179

Query: 119 KRRGRSSYVINSCRILDQNRKMVNSWLPMPPSISSVQYFEIPDVEIPTDLF-SKYGDDLF 177
            R  +SSYV NS + L         W+PM    S ++ F + +++   + F S+Y  D+ 
Sbjct: 180 SRISQSSYVSNSLQTLADKSTGFGKWIPMSVLTSDMRNFSVSEIDFEKNTFLSQYKQDML 239

Query: 178 AILLKSLEKRDSAHSTKTTNQINDWDVILTNDKERNSMVALMKVLINGADNTLINFNLPS 237
            ++++ L +  +    +T   + DWD+++T D   N +   +K L      T+I FNL  
Sbjct: 240 HLIMEGLNELVATQKERTPVILEDWDILVTYDAS-NPIELELKTLSQTDRLTIIVFNLAR 298

Query: 238 FAENEWEEIRKVNNLLY--EDGVVLKSNGDENTIKLLYKYIMYS 279
               E E +  VN  L   + G+VLK    E+ ++L+YK + +S
Sbjct: 299 ANSEELESM--VNGPLKNNDSGIVLKFLKSESLVRLVYKLLAFS 340

>KLLA0D15125g 1275978..1276826 weakly similar to sgd|S0006320
           Saccharomyces cerevisiae YPR116w hypothetical protein,
           start by similarity
          Length = 282

 Score =  115 bits (288), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 145/279 (51%), Gaps = 11/279 (3%)

Query: 9   KKLLDTRVTALKHA---PLDLPPITSPLLISFERWSDKRKKL-FFDDEETMKSSNVHNLN 64
           +KL  +R    K++    L +P + SPLL +F RW+ K + L   D E+  ++    + +
Sbjct: 6   RKLFVSRGDGTKNSLKKTLKVPEVRSPLLTNFHRWAGKERVLKLTDKEQVTEAVGNSSWD 65

Query: 65  LKDNLFANLLSAPMRSEKLTRVKLPKDMLMQLNLETTESSSSKTRLRLNATINHKRRGRS 124
           L  NLFANLL++PMRS+K +R K P+D+L+Q+ L  T + +      L   IN K    S
Sbjct: 66  LSKNLFANLLASPMRSDKASRFKFPRDLLIQMKLVQTGNENPGKLATLMPLINMKSGKSS 125

Query: 125 SYVINSCRILDQNRKMVNSWLPMPPSISSVQYFEIPDVEIPTDLFS-KYGDDLFAILLKS 183
           SYV NS +I    +  +   +P   + S +    + D+ +   LF+ K+ ++L   +   
Sbjct: 126 SYVANSLKIFKGKKPGLGQLVPTAVNDSGIANISLSDIVLDKSLFTEKHQEELLQCIENC 185

Query: 184 LEKRDSAHSTKTTNQINDWDVILTNDKERNSMVALMKVLINGADNTLINFNLPSFAENEW 243
           + +      +     + DWDV+LT D   ++ + L+++     D T+I  NL    EN  
Sbjct: 186 MTQLVDRRKSSVPVVVEDWDVVLTYDHNNDNDIELVRLKQLPKDPTVIILNL-KVVEN-- 242

Query: 244 EEIRK-VNNLL--YEDGVVLKSNGDENTIKLLYKYIMYS 279
           + IR  +N+ L  +E GVVLK   DE  I+L+Y  + +S
Sbjct: 243 DSIRALINDKLKNHEVGVVLKFLKDERLIRLVYSLLNFS 281

>YPR116W (YPR116W) [5537] chr16 (758644..759477) Protein of unknown
           function [834 bp, 277 aa]
          Length = 277

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 90/285 (31%), Positives = 148/285 (51%), Gaps = 19/285 (6%)

Query: 1   MGHAGNAIKKLL-DTRVTALKHAPLDLPPITSPLLISFERWSDKRKKLFFDDEETMKSS- 58
           MG   +A KKLL D     +           SPL+ +FE+WSDKRKKL+F DEE M    
Sbjct: 1   MGLPKSAYKKLLIDCPTRVINKNCAQRVKDVSPLITNFEKWSDKRKKLYFKDEEEMVGQF 60

Query: 59  NVHNLNLKDNLFANLLSAPMRSEKLTRVKLPKDMLMQLNLETT---ESSSSKTRLRLNAT 115
           ++ N NLK+NL+  LL++PMR+EK++++K  +++L+ L +  +   +  + K +L+L  T
Sbjct: 61  HLENFNLKNNLYGRLLASPMRAEKISKLKSCRELLIPLKVVPSTGKDQHADKDKLKLVPT 120

Query: 116 INHKRRGRSSYVINSCRILDQNRKMVNSWLPMPPSISSVQYFEIPDVEIPTDLF-SKYGD 174
           +++ +  +SSYV+NS  I+  N     SW P    IS +Q      +E+ +  F ++Y  
Sbjct: 121 LDYSKSYKSSYVLNSASIVQDNLAAATSWFP----ISVLQTSTPKSLEVDSSTFITEYNA 176

Query: 175 DLFAILLKSLEKRDSAHSTKTTNQINDWDVILTNDKERNSMVALMKVLIN-GADNTLINF 233
           +L A     ++ R S       + IN   V+L  DK +   + +  V    G   T   F
Sbjct: 177 NLHAF----IKARLSVIPNVGPSSIN--RVLLICDKRKTPPIEIQVVSHGKGLPITQSVF 230

Query: 234 NLPSFAENEWEEIRKVNNLLYEDGVVLKSNGDENTIKLLYKYIMY 278
           NL    E   E I  V+     +G+ L ++ D++ IK LY  +++
Sbjct: 231 NLGYLHEPTLEAI--VSKDAVTNGIYLDADNDKDLIKHLYSTLLF 273

>AAR088W [274] [Homologous to ScYPR116W - SH]
           complement(500105..500971) [867 bp, 288 aa]
          Length = 288

 Score =  112 bits (280), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 129/259 (49%), Gaps = 7/259 (2%)

Query: 26  LPPITSPLLISFERWSDKRKKLFFDDEETMKSSNVHNL---NLKDNLFANLLSAPMRSEK 82
           LP + SPL+  F RW+ KR +L F   E       H L   NL+ NLFA LL+APMR ++
Sbjct: 31  LPNVESPLVTHFHRWAGKRIRLSFLAAELGTREGQHILPDWNLRGNLFAGLLAAPMRWDR 90

Query: 83  LTRVKLPKDMLMQLNLETTESSSSKTRLRLNATINHKRRGRSSYVINSCRILDQNRKMVN 142
           L  +++PK  LMQ      E+ S    +++   +  +    SSYV  S   L + ++ + 
Sbjct: 91  LGNLRVPKSFLMQTKARALEAPSDGKLVKIIGVVEERGPASSSYVPQSKAALQRAKQAM- 149

Query: 143 SWLPMPPSISSVQYFEIPDVEIPTD-LFSKYGDDLFAILLKSLEKRDSAHSTKTTN-QIN 200
            ++P+    S ++YF   ++ +  D L ++Y   L + + + LE   S   T     ++ 
Sbjct: 150 -FVPVALQQSDMRYFSSEEIAVDKDTLLAEYSAQLISKVKEGLEVLLSMSGTSHERVELE 208

Query: 201 DWDVILTNDKERNSMVALMKVLINGADNTLINFNLPSFAENEWEEIRKVNNLLYEDGVVL 260
           DWDV++T D +  + + L K      D  +I  N+      E EE+  +    +E G+VL
Sbjct: 209 DWDVVVTYDPDNANDIELRKCKGIPGDPVVIILNMGCLKCTELEELVNLRLRNHEYGLVL 268

Query: 261 KSNGDENTIKLLYKYIMYS 279
           K   +E  +K +Y+ I +S
Sbjct: 269 KVLKNERLLKFMYRLITFS 287

>CAGL0D04488g 438456..439238 weakly similar to tr|Q06109
           Saccharomyces cerevisiae YPR116w, hypothetical start
          Length = 260

 Score = 80.5 bits (197), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 78/137 (56%), Gaps = 10/137 (7%)

Query: 31  SPLLISFERWSDKRKKLFFDDEETMKSSNVHNLNLKDNLFANLLSAPMRSEKLTRVKLPK 90
           SPLL  FERWS KR KLFF+ E++ +   + +L L  N+ AN L++P+R+E+ TR ++PK
Sbjct: 30  SPLLTKFERWSGKRMKLFFESEDSFEHYGLRDLKLPHNMLANKLASPIRAERNTRYRIPK 89

Query: 91  DMLMQLNLETTESSSSKTRLRLNATINHKRRGRSSYVINSCRILDQNRKMVNSWLPMPPS 150
           + L++LNL      ++   L+L A  N      ++Y+ N+ + L+     ++ W      
Sbjct: 90  EFLIKLNL---YKDATNNVLQLKANFNGVTGLGTTYIHNNKKCLEMKFCDISRW------ 140

Query: 151 ISSVQYFEIPDVEIPTD 167
            SS Q  ++P + I  D
Sbjct: 141 -SSRQPLKVPPLPIVAD 156

>Kwal_55.20543
          Length = 272

 Score = 72.4 bits (176), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 119/251 (47%), Gaps = 17/251 (6%)

Query: 30  TSPLLISFERWSDKRKKLFFDDEETMKSSNVHNLNLKDNLFANLLSAPMRSEKLTRVKLP 89
            SPL  +F++WSDK +KL+  D +        + +L+ N+F  LL++PMR +KLTRV+ P
Sbjct: 31  ASPLQKNFDKWSDKPRKLYVRDLKQFPELKFSH-SLEGNVFGQLLASPMRLDKLTRVRAP 89

Query: 90  KDMLMQLNLETTESSSS---KTRLRLNATINHKRRGRSSYVINSCRILDQNRKMVNSWLP 146
           K++L Q  L T +  +S     +  L   I       +SY+ NS  ++ ++   +   LP
Sbjct: 90  KELLKQAKLRTIDCHNSVADGKKFELVPAIGTVSGLPTSYLSNSQTLIQRHAANMTKVLP 149

Query: 147 MPPSISSVQYFEIPDVEIPTDLFSKYGDD-LFAILLKSLEKRDSAHSTKTTNQINDWDVI 205
              + S+++Y +  ++ I  +LF K     +   +LK+L     A S     Q  D D++
Sbjct: 150 TSSTNSNIRYIDRSEILIQPELFLKNQRSVVLETVLKALTDLSKAQSFPL--QPRDGDMV 207

Query: 206 LTNDKERNSMVALMKVLINGADNTLINFNLPSFAENEWEEIRKVNNLLYEDGVVLKSNGD 265
           +T D      + L K+       T I  NL  F   +      + +LL    VV++ +  
Sbjct: 208 VTYDSGVLHPIGLRKL----PQGTAIVLNL--FPTQDCN----MKSLLETRDVVIQMHSH 257

Query: 266 ENTIKLLYKYI 276
           +     LY+ I
Sbjct: 258 KELCFTLYRLI 268

>KLLA0E04763g complement(429714..431624) similar to sgd|S0006383
           Saccharomyces cerevisiae YPR179c PLO1, start by
           similarity
          Length = 636

 Score = 31.6 bits (70), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 13/118 (11%)

Query: 133 ILDQNRKMVNSWLPMP------PSISSVQYFEIPDVE--IPTDL-FSKYGDDLFAILLKS 183
           I  QN K ++SWL  P      P +  +  +   DVE  + T++ +S+ G+DL    +  
Sbjct: 287 IYSQNLKYLSSWLNDPNMAWPLPDVYPISIYTAIDVEKSLLTEVTYSQTGNDLKEQFIND 346

Query: 184 LEKRDSAHSTKTTNQINDWDVILTNDKERNSMVALMKVLI----NGADNTLINFNLPS 237
            ++R+  HS + ++ +      + ND   N +   M VL     +G  N  I+++L +
Sbjct: 347 RKRRNRGHSKERSSLLYYKSKRVKNDYSTNPLKQDMAVLTWVSASGRQNGEIDYHLAT 404

>YDR021W (FAL1) [874] chr4 (486800..487999) Member of the DEAD-box
           family of ATP-dependent RNA helicases involved in export
           of 60S ribosomes from the nucleus [1200 bp, 399 aa]
          Length = 399

 Score = 30.0 bits (66), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 9/78 (11%)

Query: 35  ISFERWSDKRKKLFFDDEETMK-SSNVHNLNLKDNLFANLLS----AP--MRSEKLTRVK 87
           +SF+R  D+  KL F   + +K SS   ++NLKD+L   + S    AP  ++S  +T++ 
Sbjct: 1   MSFDREEDQ--KLKFKTSKKLKVSSTFESMNLKDDLLRGIYSYGFEAPSSIQSRAITQII 58

Query: 88  LPKDMLMQLNLETTESSS 105
             KD++ Q    T ++++
Sbjct: 59  SGKDVIAQAQSGTGKTAT 76

>KLLA0E23804g 2108059..2113680 similar to sp|P32333 Saccharomyces
            cerevisiae YPL082c MOT1 transcriptional accessory
            protein, start by similarity
          Length = 1873

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 10/61 (16%)

Query: 210  KERNSMVALMKVLINGADNTLINFNLPSFAENEWEEIRKVNNLLYEDGVVLKSNGDENTI 269
            K +  M  LMK+LI   + TL    +P   ++ +E + K++        +L SNGDE T 
Sbjct: 1046 KRKGGMHTLMKLLIKFQEKTL--EVVPQLKKSLFEPLEKID--------ILSSNGDETTF 1095

Query: 270  K 270
            K
Sbjct: 1096 K 1096

>Sklu_1937.1 YJL154C, Contig c1937 288-3125
          Length = 945

 Score = 28.9 bits (63), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 224 NGADNTLINFNLPSFAENEWEEIRKVNNLLYEDGVVLKSNGDENTIKLLYKYI 276
           NG  N  I F  P+   + W  IR+ +  L +     K+   +N IKLL+KY+
Sbjct: 573 NGGKN--IRFTYPAIVTSYWRLIRRSSLRLKKHPA--KAQKYQNLIKLLFKYV 621

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.132    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,615,880
Number of extensions: 432531
Number of successful extensions: 1698
Number of sequences better than 10.0: 31
Number of HSP's gapped: 1685
Number of HSP's successfully gapped: 31
Length of query: 280
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 180
Effective length of database: 13,134,309
Effective search space: 2364175620
Effective search space used: 2364175620
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)