Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.4532931715190.0
CAGL0L00891g3412859231e-124
Sklu_2174.33302879041e-121
YIL041W3262888731e-117
Kwal_47.181483232878091e-107
ADL115W3332877971e-105
KLLA0E04433g3022987041e-91
AFR309C3643161906e-16
Kwal_55.212273762381811e-14
CAGL0L08492g3852351642e-12
KLLA0E04543g3893311623e-12
Scas_676.184442441501e-10
YPR148C435661438e-10
Kwal_56.2261874063672.3
Scas_626.751176636.1
AFR424C105137636.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.45
         (329 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.45                                                           589   0.0  
CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces c...   360   e-124
Sklu_2174.3 YIL041W, Contig c2174 2044-3036                           352   e-121
YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic prote...   340   e-117
Kwal_47.18148                                                         316   e-107
ADL115W [1626] [Homologous to ScYIL041W - SH] complement(483166....   311   e-105
KLLA0E04433g complement(406764..407672) similar to sp|P40531 Sac...   275   1e-91
AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)...    78   6e-16
Kwal_55.21227                                                          74   1e-14
CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces c...    68   2e-12
KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyce...    67   3e-12
Scas_676.18                                                            62   1e-10
YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protei...    60   8e-10
Kwal_56.22618                                                          30   2.3  
Scas_626.7                                                             29   6.1  
AFR424C [3616] [Homologous to ScYKL205W (LOS1) - SH] (1200481..1...    29   6.4  

>Scas_704.45
          Length = 329

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/317 (93%), Positives = 297/317 (93%)

Query: 13  KTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIK 72
           KTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIK
Sbjct: 13  KTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIK 72

Query: 73  QIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQNILTTSST 132
           QIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQNILTTSST
Sbjct: 73  QIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQNILTTSST 132

Query: 133 QIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLI 192
           QIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLI
Sbjct: 133 QIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLI 192

Query: 193 KQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKEASLRVQMETLED 252
           KQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKEASLRVQMETLED
Sbjct: 193 KQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKEASLRVQMETLED 252

Query: 253 DFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEFTEGXXXXXXXXXX 312
           DFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEFTEG          
Sbjct: 253 DFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEFTEGSTSASIPAPP 312

Query: 313 XXXXXXXXXXLDDDEDL 329
                     LDDDEDL
Sbjct: 313 TTTETSEPIELDDDEDL 329

>CAGL0L00891g 106804..107829 similar to sp|P40531 Saccharomyces
           cerevisiae YIL041w, hypothetical start
          Length = 341

 Score =  360 bits (923), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 226/285 (79%), Gaps = 1/285 (0%)

Query: 15  LSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIKQI 74
           L   S+TVSQKT ELSTN+P LAQSTQRMVQE+LGQVTDISQLP+EYLELE K+D+IK +
Sbjct: 15  LQSFSNTVSQKTHELSTNIPTLAQSTQRMVQEKLGQVTDISQLPQEYLELENKVDTIKIV 74

Query: 75  YDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQNILTTSSTQI 134
           Y++FL V++VYE +SYDYP    ES+ EFSK  A+KV+ELS A+SA EAQNIL      +
Sbjct: 75  YEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSATEAQNILVAPGP-V 133

Query: 135 KEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLIKQ 194
           KEPKTLN+A+SKVAL +SE+LN   D+      +  LLN+S++Q K+AQARLQQD  I+ 
Sbjct: 134 KEPKTLNYAMSKVALNASEYLNHSFDDPMDAKLSKVLLNYSDVQTKVAQARLQQDTQIQT 193

Query: 195 KFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKEASLRVQMETLEDDF 254
           KFN  +R +LA +IA+A K RK+VQSKRLQYD+ARTNL NAKPEKEA LRVQMETLED F
Sbjct: 194 KFNKVIRENLAESIARANKARKDVQSKRLQYDVARTNLQNAKPEKEAGLRVQMETLEDQF 253

Query: 255 AQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEF 299
           AQATE AT+VMQ+VI +++ +  + ELA AQL Y+E S+ LMKEF
Sbjct: 254 AQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAKLMKEF 298

>Sklu_2174.3 YIL041W, Contig c2174 2044-3036
          Length = 330

 Score =  352 bits (904), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 182/287 (63%), Positives = 232/287 (80%), Gaps = 3/287 (1%)

Query: 13  KTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIK 72
           K   +LS  VSQ+TQ+L+T+LP+LAQSTQR+VQERLGQVTDISQLP+EYLELE ++D I+
Sbjct: 32  KKFKDLSQAVSQRTQDLTTSLPSLAQSTQRLVQERLGQVTDISQLPQEYLELENRIDRIR 91

Query: 73  QIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQNILTTSST 132
            +Y+NFL V+ VYE +SYDYP   ++S+ EFSKT +SK+ ELSHASS  EAQNIL  S  
Sbjct: 92  LVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKTVSSKLHELSHASSTDEAQNILI-SPG 150

Query: 133 QIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLI 192
             K+PKTLN+ALSKVAL SSE+L++    +  ++ A+ALL +S++QAKIAQARLQQD LI
Sbjct: 151 PAKDPKTLNYALSKVALTSSEYLSKSGHED--ETIATALLKYSDVQAKIAQARLQQDTLI 208

Query: 193 KQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKEASLRVQMETLED 252
           + KFN  LR  LA+++ KA K RKEV++KRLQYDIAR NL NAKPEKEASLRVQME+LED
Sbjct: 209 QTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIARANLANAKPEKEASLRVQMESLED 268

Query: 253 DFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEF 299
           +FAQATE AT VMQDVI +S+ +  ++EL  AQLAY++LS+ L+ +F
Sbjct: 269 EFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYKLSTELLSDF 315

>YIL041W (YIL041W) [2626] chr9 (276524..277504) Cytoplasmic protein
           with possible role in cell-cycle regulation [981 bp, 326
           aa]
          Length = 326

 Score =  340 bits (873), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 182/288 (63%), Positives = 220/288 (76%), Gaps = 7/288 (2%)

Query: 13  KTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIK 72
           K L E+S++VS+KTQEL    P+LAQSTQRMVQERLGQVTDISQLP EY ELE K+D+IK
Sbjct: 12  KKLQEISTSVSEKTQEL----PSLAQSTQRMVQERLGQVTDISQLPREYTELEDKVDTIK 67

Query: 73  QIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQNILTTSST 132
            IY++FL V+++YE  SYDYP    ES+ EFS++ ASK+ EL+HA+SA EAQNIL     
Sbjct: 68  LIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASEAQNILVAPGP 127

Query: 133 QIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLI 192
            IKEPKTLN+ALSKVAL SSE LN+    E  +  ASALL FS++QAKIAQAR+QQD LI
Sbjct: 128 -IKEPKTLNYALSKVALNSSECLNKMFPTEE-QPLASALLQFSDVQAKIAQARIQQDTLI 185

Query: 193 KQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLM-NAKPEKEASLRVQMETLE 251
           + KFN  LR  L+  I KA K RK+V S RL+YD+ARTNL  N KPEKEASLRVQMETLE
Sbjct: 186 QTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVARTNLANNKKPEKEASLRVQMETLE 245

Query: 252 DDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEF 299
           D FAQ TE AT+ +Q+VI +++    + ELA+AQ  YFE S+ LMKEF
Sbjct: 246 DQFAQVTEDATVCLQEVISHANFSEDLKELAKAQAEYFETSAGLMKEF 293

>Kwal_47.18148
          Length = 323

 Score =  316 bits (809), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 162/287 (56%), Positives = 220/287 (76%), Gaps = 2/287 (0%)

Query: 13  KTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIK 72
           K   +LS+ VSQKTQ+ +T LP+LAQSTQR++QE+LGQVTDISQLP++Y+ELE K+D +K
Sbjct: 32  KKFKDLSTAVSQKTQDFTTQLPSLAQSTQRLMQEKLGQVTDISQLPQDYVELENKIDRMK 91

Query: 73  QIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQNILTTSST 132
            +Y+NFL V+ VYE +SYDYP   ++S+ EFS    +K+ ELS A+S +EAQ++L +   
Sbjct: 92  LVYENFLKVTQVYENESYDYPNNVRDSVNEFSSIVGTKLHELSRATSTNEAQSVLISPGP 151

Query: 133 QIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLI 192
             K+PKTLN+ALSKVAL SSE+LN+    E  + S+S LL +S++QAKIAQARL QD LI
Sbjct: 152 H-KDPKTLNYALSKVALTSSEYLNKSPGAEDSEVSSS-LLKYSDVQAKIAQARLHQDTLI 209

Query: 193 KQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKEASLRVQMETLED 252
           + KFN  LR  LA ++ +A K RK V++KRLQYDIAR NL NA+PEKEASLRVQME+LED
Sbjct: 210 QTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIARANLANARPEKEASLRVQMESLED 269

Query: 253 DFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEF 299
           +FAQAT+ A ++MQ V ++S+++  + EL  AQ  Y++ S+ L+ EF
Sbjct: 270 EFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAELLSEF 316

>ADL115W [1626] [Homologous to ScYIL041W - SH]
           complement(483166..484167) [1002 bp, 333 aa]
          Length = 333

 Score =  311 bits (797), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 212/287 (73%), Gaps = 3/287 (1%)

Query: 13  KTLSELSSTVSQKTQELSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIK 72
           K L +LS +VSQ+TQ+L++NLP+LAQ+TQR VQERLGQVTDISQ+PEEY+ELE ++D  K
Sbjct: 32  KKLKDLSLSVSQRTQDLTSNLPSLAQTTQRRVQERLGQVTDISQMPEEYVELEQRVDRTK 91

Query: 73  QIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQNILTTSST 132
            IYDNFL VS +YE +SYDYP    +S+ +FSKT   KV+EL+ A++  EAQ+IL  S  
Sbjct: 92  LIYDNFLKVSQIYESESYDYPQHISDSVNDFSKTVTGKVQELTKATTTEEAQSIL-ISPG 150

Query: 133 QIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLI 192
             + PKTLN+ALSKVAL SSE+L++   ++    +A  LL +S++QAKIAQARLQQD LI
Sbjct: 151 PARNPKTLNYALSKVALTSSEYLSKSGSDDVV--TADILLKYSDVQAKIAQARLQQDTLI 208

Query: 193 KQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMNAKPEKEASLRVQMETLED 252
           + +FN  LR  L T  A+A + RK+V  KRLQYDIAR N   A+PEK+ASLRVQMETLED
Sbjct: 209 QTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIARANFTAARPEKQASLRVQMETLED 268

Query: 253 DFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEF 299
            FAQ+TE A  +MQ VID+++ +    EL  AQL + + ++ L+  F
Sbjct: 269 QFAQSTEDAVALMQAVIDDTEFLKEFQELVTAQLGFHKAAAELLSGF 315

>KLLA0E04433g complement(406764..407672) similar to sp|P40531
           Saccharomyces cerevisiae YIL041w singleton, start by
           similarity
          Length = 302

 Score =  275 bits (704), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 152/298 (51%), Positives = 210/298 (70%), Gaps = 18/298 (6%)

Query: 13  KTLSELSSTVSQKTQE---------LSTNLPNLAQSTQRMVQERLGQVTDISQLPEEYLE 63
           K + ELS++VSQK QE         L TNLP LA STQRM+QE+LGQVTDISQLP+EY++
Sbjct: 10  KKVQELSTSVSQKAQEAQLDQKFKDLKTNLPLLANSTQRMLQEKLGQVTDISQLPDEYVQ 69

Query: 64  LEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEA 123
           LE ++++IK IY+NFL V+ +YE +SYDYP   KES+ EFSK    K+ +LS  ++  +A
Sbjct: 70  LEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLVGGKLHDLSKVTNREQA 129

Query: 124 QNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQ 183
           QN+L  SS Q+KEPKTLN+ALSKVAL SSEH+         +S A+ L  +S+ Q KIAQ
Sbjct: 130 QNVL-LSSPQMKEPKTLNYALSKVALTSSEHVED-------ESLANFLAKYSDSQTKIAQ 181

Query: 184 ARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTN-LMNAKPEKEAS 242
            RLQQD +I+ KFN A++  L  +I  +TK RK V+ KRLQYD+ R+N L N KPEK+A+
Sbjct: 182 LRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVEQKRLQYDVVRSNRLKNTKPEKQAA 241

Query: 243 LRVQMETLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFELSSSLMKEFT 300
           L+V+  T E++FA+AT+ A I M  V++ +D  + ++EL  AQLAY + S+ +++E  
Sbjct: 242 LQVEESTHEEEFAKATDDAIIAMSKVVELADFSANLHELVAAQLAYHKSSAEILEELV 299

>AFR309C [3501] [Homologous to ScYPR148C - SH] (1000084..1001178)
           [1095 bp, 364 aa]
          Length = 364

 Score = 77.8 bits (190), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 131/316 (41%), Gaps = 43/316 (13%)

Query: 15  LSELSSTVSQKTQELSTNLPNLA---QSTQRMVQERLGQVTDISQLPEEYLELEMKLDSI 71
           LSE    ++   Q +  + P      ++ +R +QE LG   DISQLP +Y  LE K D+I
Sbjct: 28  LSETQEHLTHAIQNIKIDDPKTILSLKTRKRQLQETLGSAKDISQLPPQYGFLERKCDAI 87

Query: 72  KQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQN-ILTTS 130
           +Q+    L VS  +E + YDYP    ES+ ++  T+  +   L       + Q       
Sbjct: 88  EQVCKKILVVSKTFEVEGYDYPPNPTESISDWWNTSTKETRFLKFGKGGTDKQKEDKQKQ 147

Query: 131 STQIKEPKTLNFALSKVALKSSEHL-------------NQFNDNEAFKSSASALLNFSNI 177
           +    +P +   AL + A K S+ +              +   +E  +S       +++ 
Sbjct: 148 AAGSSDPPSFAHALHRAA-KGSQGIIQELKEQAEEEQEQEVEIDEDVESLIKMFGTWADA 206

Query: 178 QAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIAR-----TNL 232
           Q  +  A+ + D  + ++FN+ L+H L     K   +R++V+  RL +D  +      + 
Sbjct: 207 QYNMDIAKREMDQFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDA 266

Query: 233 MNAKPEKEA--------------------SLRVQMETLEDDFAQATEHATIVMQDVIDNS 272
             AK + EA                    +   Q+E  ED+F   T  A   M  + D +
Sbjct: 267 ALAKKQDEAKQAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADAT 326

Query: 273 DIVSRVNELARAQLAY 288
            ++S V      QL Y
Sbjct: 327 KLISLVKLFQNFQLVY 342

>Kwal_55.21227
          Length = 376

 Score = 74.3 bits (181), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 113/238 (47%), Gaps = 24/238 (10%)

Query: 15  LSELSSTVSQKTQE-LSTNLPNLA----------QSTQRMVQERLGQVTDISQLPEEYLE 63
           L++  +  + KTQ+ LST + N+           ++ +  +QE LG + DIS+LP +Y  
Sbjct: 13  LTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTIEDISKLPPQYQL 72

Query: 64  LEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEA 123
           LE K DS+++     L V+  +E + YDYP    ESL ++  +    +  L  +S   + 
Sbjct: 73  LEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGLFGLMSSSKKDKG 132

Query: 124 QNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSA--------SALLN-- 173
                 + + +  P++   A++K A  S + L    D E   S+         + L+   
Sbjct: 133 AESAAAAKSALM-PRSFAQAIAKAAKDSGDVLAALKDQEQQASADEEDEDEDITPLIKMF 191

Query: 174 --FSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIAR 229
             +S  Q KI Q + + D L+ ++FN  L   +      A+ +R++V+  RL++D  R
Sbjct: 192 SAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRRKVEDSRLKFDTMR 249

>CAGL0L08492g 929051..930208 similar to tr|Q06523 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 385

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 106/235 (45%), Gaps = 20/235 (8%)

Query: 15  LSELSSTVSQKTQEL--STNLPNLAQSTQ---RMVQERLGQVTDISQLPEEYLELEMKLD 69
           L  ++ ++S+ TQ L    N P    S +   R +QE +G   DIS+LP +Y+ LE K D
Sbjct: 6   LESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCD 65

Query: 70  SIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAAS-KVEELS------HAS---S 119
           SI+++    L V+  YE + YDYP    ESL  + +T     + EL+      H +   +
Sbjct: 66  SIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQTKEWFNISELTKNVIPKHGNVEKA 125

Query: 120 AHEAQNILTTSSTQIKEPKTLNFALSKVALKSSEHLNQFNDNEAFKSSASALLN-----F 174
             EA   LT      + P +   A+++    S          +  +      L      +
Sbjct: 126 GTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLIFESIETKDEDEKEDIDELVKIFKIW 185

Query: 175 SNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIAR 229
           S+   +I+ ++ + D ++ ++FN  L   L  N  K   +R +V+  RL +D  R
Sbjct: 186 SDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMR 240

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%)

Query: 247 METLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAY 288
           +E LED+F   T  A  VM +V +NS+++S +      QL+Y
Sbjct: 324 LEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSY 365

>KLLA0E04543g 412009..413178 similar to sgd|S0006352 Saccharomyces
           cerevisiae YPR148c, start by similarity
          Length = 389

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/331 (25%), Positives = 129/331 (38%), Gaps = 98/331 (29%)

Query: 44  VQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYP---------Y 94
           +QE LG V DISQLP +Y  LE K D++++I    L V+  +E + YDYP         +
Sbjct: 50  LQETLGTVHDISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDW 109

Query: 95  VA--KESLIEFSKTAASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALKSS 152
            +  K+S+  FSK  A    E+        A+N L         P++   ALSK A  S+
Sbjct: 110 WSGNKDSIFSFSKKKAEVSPEVKET-----AENGLL--------PRSFAQALSKAATDSA 156

Query: 153 EHLNQFNDNE----------------AFKSSA----------------------SALLNF 174
             L Q    E                A ++ A                       A  ++
Sbjct: 157 LILKQLKAEETRTNQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESW 216

Query: 175 SNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIARTNLMN 234
           +  Q  I Q++ + D L+ ++FN  L   + T+  K  ++R +VQ  RL +D  R  +  
Sbjct: 217 TKCQLSIDQSKAEMDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKL 276

Query: 235 AKPEK-------EASLRVQMET-----------------------------LEDDFAQAT 258
              EK       EA  +V  ET                             LED F  AT
Sbjct: 277 KLQEKEVVASSEEAEKKVATETPETPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVSAT 336

Query: 259 EHATIVMQDVIDNSDIVSRVNELARAQLAYF 289
                 + ++ D+S+I+S V      QL ++
Sbjct: 337 SETVEFLGELTDSSEIISLVKLFHNFQLIHY 367

>Scas_676.18
          Length = 444

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 98/244 (40%), Gaps = 44/244 (18%)

Query: 20  STVSQKTQELSTNLPNLA---------QSTQRMVQERLGQVTDISQLPEEYLELEMKLDS 70
           +T +QKT +  +N    A         +S +R+ QE +G V DIS LPE+Y  LE + D+
Sbjct: 15  ATAAQKTSDTLSNAITTATDPATKLSLRSQKRLFQESIGTVHDISTLPEQYTTLEARTDA 74

Query: 71  IKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAHEAQNILTTS 130
           +++     L VS  +E + YDYP    ES  ++   ++ K           + +  L   
Sbjct: 75  LEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSSKK----KKEQEKEDKKGFL--- 127

Query: 131 STQIKEPKTLNFALSKVALKSSEHLNQFNDNE----------------------AFKSSA 168
                 P++   A+S  A    E     ND +                        K+  
Sbjct: 128 ------PRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEENEEEDEEDEDVKNLI 181

Query: 169 SALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIA 228
               +++     I Q + + D ++ ++FN  L   L     K   +RK V+  RL++D  
Sbjct: 182 KTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHTLRKRVKDSRLKFDTV 241

Query: 229 RTNL 232
           R  L
Sbjct: 242 RYEL 245

 Score = 33.1 bits (74), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 247 METLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLAYF 289
           +E LED F  +T  A  +M+++ D+S+I+  V      QL Y+
Sbjct: 383 LEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYY 425

>YPR148C (YPR148C) [5564] chr16 complement(826827..828134) Protein
           of unknown function [1308 bp, 435 aa]
          Length = 435

 Score = 59.7 bits (143), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 42/66 (63%)

Query: 38  QSTQRMVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAK 97
           +S  R VQE LG V+DIS+LP +Y  LE K DS++++    L VS  +E + YDYP    
Sbjct: 49  KSRTRFVQESLGTVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLT 108

Query: 98  ESLIEF 103
           ES+ ++
Sbjct: 109 ESISDW 114

 Score = 33.5 bits (75), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 229 RTNLMNAKPEKEASLRVQM-ETLEDDFAQATEHATIVMQDVIDNSDIVSRVNELARAQLA 287
           ++N +N +P  E S   ++ E LED+F   T  A   M+++ D+S+I+  +      QL 
Sbjct: 355 KSNKVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLV 414

Query: 288 YF 289
           YF
Sbjct: 415 YF 416

>Kwal_56.22618
          Length = 740

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 50  QVTDISQLPEEYLELEMKLDSIK-----QIYDNFLAVSSVYEQQSYDYPYVAKESLIEFS 104
           Q   I Q P++Y+ LE + DS++     + Y NFL    +    S+D       +L+EFS
Sbjct: 293 QYKSIYQTPKDYVALEDQFDSLEVNKNSKTYLNFLNTIELLNGSSHDLS--KNHTLVEFS 350

Query: 105 KTA 107
            TA
Sbjct: 351 STA 353

>Scas_626.7
          Length = 511

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 34/76 (44%), Gaps = 8/76 (10%)

Query: 149 LKSSEHLNQFNDNEAFKSSASALLNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNI 208
           LK+ E  N++N++           N  NI +++      +DLL + + +  L+ D     
Sbjct: 277 LKNIEFCNEYNED--------VKRNIMNIVSQLDSTIFNEDLLFENEISSVLKDDFKNRF 328

Query: 209 AKATKVRKEVQSKRLQ 224
              TK+   VQ +R +
Sbjct: 329 RNVTKIMDCVQCERCK 344

>AFR424C [3616] [Homologous to ScYKL205W (LOS1) - SH]
           (1200481..1203636) [3156 bp, 1051 aa]
          Length = 1051

 Score = 28.9 bits (63), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 2/37 (5%)

Query: 255 AQATEHATIVMQDVIDNSDIVSRVNELARAQLAYFEL 291
           +Q  +  T  MQD++DNS I    N L   Q+++FEL
Sbjct: 506 SQPAQLMTTFMQDILDNSAIFQSSNPL--IQISFFEL 540

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.309    0.122    0.309 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,266,037
Number of extensions: 304469
Number of successful extensions: 1588
Number of sequences better than 10.0: 134
Number of HSP's gapped: 1559
Number of HSP's successfully gapped: 147
Length of query: 329
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 227
Effective length of database: 13,065,073
Effective search space: 2965771571
Effective search space used: 2965771571
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 62 (28.5 bits)