Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.4444344322080.0
CAGL0L00869g4194589261e-122
Sklu_2174.24134498911e-116
Kwal_47.181514144448621e-112
YIL042C3944318471e-110
KLLA0E04455g4214318321e-107
ADL116C4354038151e-105
AER270W4892792294e-20
KLLA0C05654g4734252021e-16
KLLA0F27423g5122871974e-16
Kwal_14.18254924331752e-13
Sklu_2299.65304451654e-12
CAGL0F07007g4854501557e-11
AAR157C5032901451e-09
YGL059W4914391333e-08
Scas_563.94922831272e-07
KLLA0A03905g155059701.8
CAGL0J05456g371122672.8
Scas_718.86768100673.1
CAGL0G02893g43151673.5
Scas_630.2439869664.4
YPL188W (POS5)41451638.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.44
         (443 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.44                                                           855   0.0  
CAGL0L00869g complement(105236..106495) similar to sp|P40530 Sac...   361   e-122
Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement         347   e-116
Kwal_47.18151                                                         336   e-112
YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein...   330   e-110
KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces c...   325   e-107
ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352) [...   318   e-105
AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761...    93   4e-20
KLLA0C05654g complement(504568..505989) similar to sp|P53170 Sac...    82   1e-16
KLLA0F27423g complement(2537353..2538891) similar to ca|CA5524|I...    80   4e-16
Kwal_14.1825                                                           72   2e-13
Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement       68   4e-12
CAGL0F07007g 687174..688631 highly similar to sp|P53170 Saccharo...    64   7e-11
AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1...    60   1e-09
YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with simi...    56   3e-08
Scas_563.9                                                             54   2e-07
KLLA0A03905g complement(345818..350470) similar to sp|P19524 Sac...    32   1.8  
CAGL0J05456g 519238..520353 similar to sp|P53938 Saccharomyces c...    30   2.8  
Scas_718.86                                                            30   3.1  
CAGL0G02893g complement(264566..265861) highly similar to sp|Q06...    30   3.5  
Scas_630.24                                                            30   4.4  
YPL188W (POS5) [5260] chr16 (191405..192649) Protein involved in...    29   8.6  

>Scas_704.44
          Length = 443

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/443 (95%), Positives = 423/443 (95%)

Query: 1   MLQSTIRFARLGNKSLLTRPFFCSSITGNRHTTHAHHLKHNKAAINLSHLDFQAYYKIRS 60
           MLQSTIRFARLGNKSLLTRPFFCSSITGNRHTTHAHHLKHNKAAINLSHLDFQAYYKIRS
Sbjct: 1   MLQSTIRFARLGNKSLLTRPFFCSSITGNRHTTHAHHLKHNKAAINLSHLDFQAYYKIRS 60

Query: 61  NIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQNLP 120
           NIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQNLP
Sbjct: 61  NIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQNLP 120

Query: 121 YIVLLNPKINQINSLYLKTLESLLSITFPYDLYKXXXXXXXXXXXXXXXXXXXXVLSDGL 180
           YIVLLNPKINQINSLYLKTLESLLSITFPYDLYK                    VLSDGL
Sbjct: 121 YIVLLNPKINQINSLYLKTLESLLSITFPYDLYKNDLILSLLNHLNEEHNDTLLVLSDGL 180

Query: 181 KEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSPKTEPDMIGIIHKRVKISQFI 240
           KEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSPKTEPDMIGIIHKRVKISQFI
Sbjct: 181 KEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSPKTEPDMIGIIHKRVKISQFI 240

Query: 241 NQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNSMKAH 300
           NQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNSMKAH
Sbjct: 241 NQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNSMKAH 300

Query: 301 IENDVTKPIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLDSTFSKIHEEN 360
           IENDVTKPIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLDSTFSKIHEEN
Sbjct: 301 IENDVTKPIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLDSTFSKIHEEN 360

Query: 361 NGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCKNYLELFDGDITIQNL 420
           NGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCKNYLELFDGDITIQNL
Sbjct: 361 NGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCKNYLELFDGDITIQNL 420

Query: 421 WGLGTDVYIKVKGPNKSLLADRK 443
           WGLGTDVYIKVKGPNKSLLADRK
Sbjct: 421 WGLGTDVYIKVKGPNKSLLADRK 443

>CAGL0L00869g complement(105236..106495) similar to sp|P40530
           Saccharomyces cerevisiae YIL042c, hypothetical start
          Length = 419

 Score =  361 bits (926), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 200/458 (43%), Positives = 280/458 (61%), Gaps = 57/458 (12%)

Query: 1   MLQSTIRFARLGNKSLLTRPFFCSSI--TGNRHTTHAHHLKHNKAAINLSHLDFQAYYKI 58
            L+S +R    G++ ++ R F  +S+    +++ + A++         L HL+F  +YKI
Sbjct: 2   FLRSALRLG--GHRRVIGRQFHAASVLLKNSKYGSVANYQD------RLKHLEFDKHYKI 53

Query: 59  RSNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQN 118
           RSNIELLIQ+Y+ KPIPPL+Y +LT Y+ PLS  E+Y L IKTIN L+S TCR+L+ IQ 
Sbjct: 54  RSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLLSYTCRRLNAIQK 113

Query: 119 LPYIVLLNPKINQINSLYLKTLESLLSITFPYDLYKXXXXXXXXXXXXXXXXXXXXVLSD 178
           LPY+  +NP I +  SLYLKTLESLLSI FPY L+                      LS 
Sbjct: 114 LPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEFLDDHQDTVETLSR 173

Query: 179 GLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALL--SPKTEPDMIGIIHKRVKI 236
           GL+EI +  L  + I KFLD H+RDRI MK++  NHLA+   +  ++P+MIG IHK + +
Sbjct: 174 GLEEIMD-FLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDSDPNMIGTIHKALPV 232

Query: 237 SQFINQTFEFVNDLCQLKFN---LPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEIL 293
           +  + +  EFV+DLC +K++    P+   G         G ++ FPCIP ILEYVLTEIL
Sbjct: 233 ADMVKKVSEFVSDLCFVKYDQLVAPVKIYG---------GHDVTFPCIPTILEYVLTEIL 283

Query: 294 KNSMKAHIEND------VTKPIEISIFETD--SDELTVRIRDYGGGIDPKIEPKIFQYSF 345
           KNS +AHIEN       V KP+E+ I + +   +EL +RIRD+GGGI P +E  IF+YS+
Sbjct: 284 KNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNVESHIFEYSY 343

Query: 346 STTLDSTFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCK 405
           +T                       + S + +S     ++PGE + N +SGMG+GLP+CK
Sbjct: 344 TT-----------------------VESDKKESGASAYVIPGE-DINIVSGMGFGLPMCK 379

Query: 406 NYLELFDGDITIQNLWGLGTDVYIKVKGPNKSLLADRK 443
            Y+E+FDG + IQ+LWG GTDVYIK+KGP K +L  +K
Sbjct: 380 AYIEMFDGKLDIQSLWGWGTDVYIKLKGPTKKMLEPKK 417

>Sklu_2174.2 YIL042C, Contig c2174 576-1817 reverse complement
          Length = 413

 Score =  347 bits (891), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 280/449 (62%), Gaps = 47/449 (10%)

Query: 1   MLQSTIRFARLGNKSLLTRPFFCSSITGNRHTTHA-HHLKHNKAAINLSHLDFQAYYKIR 59
           ML+S +R  ++  KS +  P    S T +    H+ HH + N+    LS L F+  Y+IR
Sbjct: 1   MLRSVLR-KKISAKSTVLVPRLRFSTTASLTIKHSSHHNRRNERL--LSGLGFEQLYQIR 57

Query: 60  SNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQNL 119
           S+IELLIQDY+ KPIP +SY++L+ Y+ PL+  EKY L IKT+N L++ TCR+L+ IQ L
Sbjct: 58  SSIELLIQDYANKPIPAISYEYLSMYKPPLTDNEKYVLVIKTVNLLLAYTCRRLAAIQKL 117

Query: 120 P-YIVLLNPKINQINSLYLKTLESLLSITFPYDLYKXXXXXXXXXXXXXXXXXXXXVLSD 178
             YI ++NP + + N LYLKTLESLLSI FPY L+                      LS 
Sbjct: 118 SXYIAVVNPNVEESNRLYLKTLESLLSIDFPYGLHDQEAMVTKLTKFLDDHQDTLITLSR 177

Query: 179 GLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSP--KTEPDMIGIIHKRVKI 236
           G +E+  E    EA+ +FL+ H+RDRI+MKL++ ++LAL+    K  P  IG++HK +KI
Sbjct: 178 GFEEV-MEFYQQEAVFEFLNQHLRDRISMKLLVTHYLALVQQQDKNSP-AIGVLHKNLKI 235

Query: 237 SQFINQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNS 296
           S+ I++  EFV DLC +K++  +        +  + G ++ FPCIP  LEYVLTEILKNS
Sbjct: 236 SELIHRVEEFVGDLCFVKYDRQVP-------VKILYGADVTFPCIPTDLEYVLTEILKNS 288

Query: 297 MKAHIEN-----DVT-KPIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLD 350
            +AHIEN     D+T KPIE++I  +D D L +RIRD+GGGI P++E ++F+YS+ST   
Sbjct: 289 SRAHIENSTKERDLTEKPIEVTIVRSDCD-LEIRIRDFGGGIPPEVEDRMFEYSYSTVQA 347

Query: 351 STFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCKNYLEL 410
           +T                        D+ +   ++PGE E N +SGMG+GLP+CK YLE+
Sbjct: 348 NT-----------------------KDTGMSAYVIPGE-EVNNVSGMGFGLPMCKAYLEM 383

Query: 411 FDGDITIQNLWGLGTDVYIKVKGPNKSLL 439
           FDG + IQ+L+G GTDVYIK+KGP   LL
Sbjct: 384 FDGSLDIQSLYGWGTDVYIKLKGPENKLL 412

>Kwal_47.18151
          Length = 414

 Score =  336 bits (862), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/444 (41%), Positives = 269/444 (60%), Gaps = 50/444 (11%)

Query: 1   MLQSTIRFARLGNKSLLTRPFFCSSITGNRHTTHAHHLKHNKAAIN--LSHLDFQAYYKI 58
           ML +   F+RL      TR  F + +    HT       H K+++   L  + F+  Y+I
Sbjct: 7   MLTAVRGFSRLR----YTRKAFHNGL----HTLRPLQKVHGKSSLREMLREVGFEELYRI 58

Query: 59  RSNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQN 118
           RSN ELLIQD+++KPIP +SY+FLT+Y+ PL+  EKY L I+T+N L++ TCR+L  IQ 
Sbjct: 59  RSNTELLIQDFAKKPIPAISYEFLTQYKVPLTDNEKYMLTIQTVNLLLTYTCRRLVAIQK 118

Query: 119 LPYIVLLNPKINQINSLYLKTLESLLSITFPYDLYKXXXXXXXXXXXXXXXXXXXXVLSD 178
           LPYI +LNP I + N LYL+TLESLLS+ +PY L+                      LS 
Sbjct: 119 LPYIAVLNPNIEETNRLYLRTLESLLSLNYPYGLHDQEVMAKKLTEFLDDHQDTLLTLSR 178

Query: 179 GLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSPKTEPD-MIGIIHKRVKIS 237
           G +EI  E    E++ +FL+ H+RDRI+MKL+  ++LA++S  +  D +IG++H+ +KIS
Sbjct: 179 GFQEI-MEFFPKESVFEFLNSHLRDRISMKLLATHYLAIVSQTSRDDRVIGVLHREMKIS 237

Query: 238 QFINQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNSM 297
           + + +  EFV DLC +K++  +        I  + GE++ FPCIP  LEYVLTE+LKNS 
Sbjct: 238 ELVCRVEEFVGDLCYVKYDQQVP-------IKILEGEDVTFPCIPTDLEYVLTELLKNSS 290

Query: 298 KAHIE------NDVTKPIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLDS 351
           +AHIE      N   KP+E++I   D+D L +RIRD+GGGI P +E ++F YS+ST    
Sbjct: 291 RAHIEGSTSDNNTAEKPVEVTIVRKDND-LKIRIRDFGGGIPPVVEDRMFDYSYSTV--- 346

Query: 352 TFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCKNYLELF 411
                          TD+       DS +   ++PG    N +SGMG+GLP+CK Y+E+F
Sbjct: 347 --------------NTDA------KDSGMSAYVIPGADVCN-VSGMGFGLPMCKAYMEMF 385

Query: 412 DGDITIQNLWGLGTDVYIKVKGPN 435
           +G + IQ+LWG GTD YI +KGP+
Sbjct: 386 NGTLDIQSLWGWGTDAYIYLKGPD 409

>YIL042C (YIL042C) [2625] chr9 complement(275107..276291) Protein
           with similarity to mitochondrial branched chain
           alpha-ketoacid and pyruvate dehydrogenase protein
           kinases [1185 bp, 394 aa]
          Length = 394

 Score =  330 bits (847), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 181/431 (41%), Positives = 264/431 (61%), Gaps = 44/431 (10%)

Query: 17  LTRPFFCSSITGNRHTTHAHHLKHNKAAINLSHLDFQAYYKIRSNIELLIQDYSRKPIPP 76
           + R + C  +        +H L        LS L F  +YKIRSNIELLIQDY+ KPI P
Sbjct: 4   IMRSWKCGGMRWAHRQRPSHEL--------LSQLSFDQHYKIRSNIELLIQDYASKPIAP 55

Query: 77  LSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQNLPYIVLLNPKINQINSLY 136
           L+Y++  +Y+ PL++ E+Y L IKTIN L+SLTC++L+ IQ LPY  ++NP I + NSLY
Sbjct: 56  LNYEYFLQYRPPLTKKEEYMLTIKTINLLLSLTCKRLNAIQRLPYNAVINPHIERTNSLY 115

Query: 137 LKTLESLLSITFPYDLYKXXXXXXXXXXXXXXXXXXXXVLSDGLKEINNELLSNEAISKF 196
           LK+L++LLSI +PY+L+                     VL+ GL+EI +       IS+F
Sbjct: 116 LKSLQTLLSIAYPYELHNPPKIQAKFTELLDDHEDAIVVLAKGLQEIQS-CYPKFQISQF 174

Query: 197 LDVHIRDRITMKLIILNHLALLSPK---TEPDMIGIIHKRVKISQFINQTFEFVNDLCQL 253
           L+ H+++RITMKL++ ++L+L++     T   MIGI+H+ + I+Q I    ++VND+C +
Sbjct: 175 LNFHLKERITMKLLVTHYLSLMAQNKGDTNKRMIGILHRDLPIAQLIKHVSDYVNDICFV 234

Query: 254 KFNLPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNSMKAHIE-NDVTKPIEIS 312
           KFN     T  + ++ +   ++I F CIP ILEY++TE+ KN+ +A I       PIEI+
Sbjct: 235 KFN-----TQRTPVLIHPPSQDITFTCIPPILEYIMTEVFKNAFEAQIALGKEHMPIEIN 289

Query: 313 IFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLDSTFSKIHEENNGNQRETDSVIG 372
           + + D DEL +RIRD+GGGI P++E  +F YS+ST         H + + +   TD    
Sbjct: 290 LLKPDDDELYLRIRDHGGGITPEVEALMFNYSYST---------HTQQSADSESTD---- 336

Query: 373 SCQNDSSVPQLMMPGEVENNTISGMGYGLPLCKNYLELFDGDITIQNLWGLGTDVYIKVK 432
                       +PGE  NN +SGMG+GLP+CK YLELF G I +Q+L G GTDVYIK+K
Sbjct: 337 ------------LPGEQINN-VSGMGFGLPMCKTYLELFGGKIDVQSLLGWGTDVYIKLK 383

Query: 433 GPNKSLLADRK 443
           GP+K+ L  +K
Sbjct: 384 GPSKTALLSKK 394

>KLLA0E04455g 408415..409680 similar to sp|P40530 Saccharomyces
           cerevisiae YIL042c, hypothetical start
          Length = 421

 Score =  325 bits (832), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/431 (43%), Positives = 263/431 (61%), Gaps = 40/431 (9%)

Query: 15  SLLTRPFFCSSITGNRHTTHAH---HLK--HNKAAINLSHLDFQAYYKIRSNIELLIQDY 69
           S+   P F + I  +  T  +H   H +  H K +  ++ L+FQ  Y IRSNI+ LIQDY
Sbjct: 23  SVHRSPLFNTHIKNDEKTVSSHNRLHRRNNHRKRSKEMTELNFQELYHIRSNIQHLIQDY 82

Query: 70  SRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTINQLISLTCRQLSLIQNLPYIVLLNPKI 129
           S   IP + + FL +Y+ PL   EKY L IKT+N L++LTC +L+ +Q LPYI L+NP I
Sbjct: 83  SSYEIPKIDWAFLLQYRGPLQDNEKYFLTIKTLNLLLTLTCHRLASLQELPYIALVNPNI 142

Query: 130 NQINSLYLKTLESLLSITFPYDLYKXXXXXXXXXXXXXXXXXXXXVLSDGLKEINNELLS 189
            Q N LYLKTLESLLSI +PYDLY                      LS+GL+E+ +    
Sbjct: 143 EQSNRLYLKTLESLLSIEYPYDLYDTDKIQNLTEEFLNDHQDTLLTLSNGLQEV-SRFYD 201

Query: 190 NEAISKFLDVHIRDRITMKLIILNHLALLSPKTEPDMIGIIHKRVKISQFINQTFEFVND 249
            E I KFL+ H+ DRI MKL+  N+L LL   +  ++IG+IHK + IS  + +T EFVND
Sbjct: 202 PENIFKFLNKHLHDRILMKLLTTNYLKLLEQTSSDEVIGVIHKDLHISDLVTRTNEFVND 261

Query: 250 LCQLKFNLPMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNSMKAHIENDVTKPI 309
           L  +K++  +        +  + G +++F  IP  LEYVL E+LKNS +AHIEN+V K +
Sbjct: 262 LTFIKYDKTVP-------VKIMEGSDVKFSYIPTDLEYVLQELLKNSSRAHIENNVDKDV 314

Query: 310 EISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLDSTFSKIHEENNGNQRETDS 369
           E++I + D D+L +RIRD+GGGIDP++E ++F YSFSTT+                    
Sbjct: 315 EVTIVKND-DQLEIRIRDFGGGIDPQVEDRVFDYSFSTTVKE------------------ 355

Query: 370 VIGSCQNDSSVPQLMMPG-EVENNTISGMGYGLPLCKNYLELFDGDITIQNLWGLGTDVY 428
                + DS +   ++PG EV+N  ++GMG+GLP+CK YLELF+G + IQ+LWG GTDVY
Sbjct: 356 -----EKDSGMSDYVLPGQEVQN--VAGMGFGLPMCKAYLELFNGTLDIQSLWGWGTDVY 408

Query: 429 IKVKGPNKSLL 439
           I++ GP+  L 
Sbjct: 409 IRLHGPSDRLF 419

>ADL116C [1625] [Homologous to ScYIL042C - SH] (481045..482352)
           [1308 bp, 435 aa]
          Length = 435

 Score =  318 bits (815), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 166/403 (41%), Positives = 251/403 (62%), Gaps = 39/403 (9%)

Query: 43  AAINLSHLDFQAYYKIRSNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTI 102
           A  +LS L F+  Y++RSN+E+LIQDY+++ IP ++Y+FLTEY  PLS  E++ L+IK +
Sbjct: 62  AGGSLSQLSFEQLYQLRSNLEMLIQDYAKREIPRITYEFLTEYVPPLSDNERFMLSIKVL 121

Query: 103 NQLISLTCRQLSLIQNLPYIVLLNPKINQINSLYLKTLESLLSITFPYDLYKXXXXXXXX 162
           N L++ TCR+L  +Q LPYI ++NP I + N LYLKTLESLL+I  PY L+         
Sbjct: 122 NMLLTYTCRRLLALQRLPYIAVINPNIEESNRLYLKTLESLLAIELPYGLHDHAAMREKL 181

Query: 163 XXXXXXXXXXXXVLSDGLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSPKT 222
                        LS G +EI +     + +  FL++H+RDR++MKL++ ++L L+   +
Sbjct: 182 ITFLDDHGDTLVTLSKGFEEIMD-FYPQQKVFDFLNIHLRDRLSMKLLVTHYLRLVEQSS 240

Query: 223 EPDMIGIIHKRVKISQFINQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGEEIEFPCIP 282
             D IG++ KR+ I++ + +T EFV DL  +K++  +        +  + G ++ F CIP
Sbjct: 241 GADCIGVLDKRLNIAELVKRTEEFVGDLTFVKYDRIVP-------VNILEGHDVTFACIP 293

Query: 283 VILEYVLTEILKNSMKAHIEN------DVTKPIEISIFETDSDELTVRIRDYGGGIDPKI 336
             LEYVL EILKNS +AHIEN         KPIE++I  +  D L +RIRD+GGGI P +
Sbjct: 294 QDLEYVLQEILKNSARAHIENHTPSNYSAEKPIEVTIVRSYED-LEIRIRDFGGGIPPDV 352

Query: 337 EPKIFQYSFSTTLDSTFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISG 396
           E ++F YS++T+                 E D+       D+ +   ++PG+  +N +SG
Sbjct: 353 EDRMFDYSYTTS-----------------EKDA------KDTGMSAYIIPGQDVSN-VSG 388

Query: 397 MGYGLPLCKNYLELFDGDITIQNLWGLGTDVYIKVKGPNKSLL 439
           MG+GLPLCK Y+E+F+G++ I +LWG GTDVYI++KGP +SLL
Sbjct: 389 MGFGLPLCKAYVEMFNGELDIVSLWGWGTDVYIRLKGPKESLL 431

>AER270W [2772] [Homologous to NOHBY] complement(1131292..1132761)
           [1470 bp, 489 aa]
          Length = 489

 Score = 92.8 bits (229), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 127/279 (45%), Gaps = 70/279 (25%)

Query: 190 NEAISKFLDVHIRDRITMKLIILNHLALL---------------SPKTEPDMIGIIHKRV 234
           + +I  +LD     RI ++++I  HL+LL               +  ++ D +GI+  R 
Sbjct: 229 DASIKGYLDRFYMGRIGIRMLIGQHLSLLEQAMHSDLACEHVPGAVGSDADYVGIVCTRT 288

Query: 235 KISQFINQTFEFVNDLCQLKFNL-----------PMSTTGNSSMITYITGEEIEFPCIPV 283
           K++Q  +   +    +C   +NL           P+    +S +       EIEF  +P 
Sbjct: 289 KVAQVADIAIDRARHICAEYYNLYEAPKVELHTIPIKRDDSSGL------REIEFTYVPS 342

Query: 284 ILEYVLTEILKNSMKAHIENDVTK-------------PIEISIFETDSDELTVRIRDYGG 330
            L ++L E+LKN+++A +E+ + K             P+++ I E  ++EL V+I D GG
Sbjct: 343 HLVHMLFEVLKNALRATVESTIQKNPGVTDYDSLRFPPVKVIISEG-TEELAVKISDEGG 401

Query: 331 GIDPKIEPKIFQYSFSTTLDSTFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVE 390
           GI     P ++ Y ++T  D               E DS+I     DS++     P    
Sbjct: 402 GIARSNLPLVWTYLYTTMTDD--------------EQDSLI---DGDSTLSGSCPP---- 440

Query: 391 NNTISGMGYGLPLCKNYLELFDGDITIQNLWGLGTDVYI 429
              ++G GYGL L + Y   F GD+ + ++ G GTDVY+
Sbjct: 441 ---MAGYGYGLALSRLYARHFGGDLRLLSMDGYGTDVYL 476

>KLLA0C05654g complement(504568..505989) similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, start by similarity
          Length = 473

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 106/425 (24%), Positives = 172/425 (40%), Gaps = 67/425 (15%)

Query: 56  YKIRSNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIK---TINQLISLTCRQ 112
           Y    N  +L++ Y +K   P+S K L +Y    S+  K  +         +L      +
Sbjct: 52  YHYYHNDNVLVKKYLQKKPHPMSLKQLAQYYDDSSKLTKMKIISSGKFVKEELCVRIAHK 111

Query: 113 LSLIQNLPYIVLLNPKINQINSLYLKTLESLLSITFPYDLYKXXXXXXXXXXXXXXXXXX 172
           L L+QNLP+ V+ N   NQ+   Y    E      FP                       
Sbjct: 112 LDLLQNLPFDVVNNFHFNQVYESYYNIFERFRK--FP--------EIKDEKDNLKFCQFL 161

Query: 173 XXVLSDGLKEIN-NELLSNEAISKFLDVH------------IRDRITMKLIILNHLAL-- 217
             +LSD    +N   L+      + LD++            +R RI+ +LI+  HL++  
Sbjct: 162 HAILSD-FNSLNLPHLIMGALECRILDLYPQDKMDALISDLLRARISRRLIVEEHLSITS 220

Query: 218 --LSPKTEPDMI-GIIHKRVKISQFINQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGE 274
             LS K E  ++ G I ++    +++N   E    +C+   N  M   G       I G+
Sbjct: 221 NYLSGKKENTLVLGDIFQKCNAKEYLNGARE----VCEAYIN-NMYFAGIKMPELIINGD 275

Query: 275 -EIEFPCIPVILEYVLTEILKNSMKAHIENDV------TKPIEISIFETDSDELTVRIRD 327
            E+EF  +P  L+++L EIL+NS +  ++  +        P+ ++I   D   L  RI D
Sbjct: 276 TELEFYFLPSHLKFLLGEILRNSYEVTVKETIRLGLEKAPPVTVTIISNDQSYL-FRISD 334

Query: 328 YGGGIDPKIEPKIFQYSFSTTLDSTFSKIHEENNGNQRET--DSVIGSCQNDSSVPQLMM 385
            GGG+ P  + +I+ +  S  L            G Q  +  DS  G+        Q  +
Sbjct: 335 RGGGV-PHSDKQIWSFGKSKELAKQSLDNFHHLPGLQTLSLYDSSNGAHLKSDRYRQTSL 393

Query: 386 PGEVENNTISG-------------------MGYGLPLCKNYLELFDGDITIQNLWGLGTD 426
               ENN   G                   +G GL LCK Y E ++GD+T+ ++ G GTD
Sbjct: 394 DRMSENNLTKGKFKVGQPLMELLKRSPRYKLGIGLALCKVYAEYWNGDLTVHSIQGYGTD 453

Query: 427 VYIKV 431
             +K+
Sbjct: 454 TVLKL 458

>KLLA0F27423g complement(2537353..2538891) similar to
           ca|CA5524|IPF2861 Candida albicans putative pyruvate
           dehydrogenase kinase, hypothetical start
          Length = 512

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 71/287 (24%), Positives = 124/287 (43%), Gaps = 61/287 (21%)

Query: 180 LKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLSPKTEP----------DMIGI 229
            K+ + + + +++I  FLD     RI ++++I   LALL    +P          D +GI
Sbjct: 241 WKKTHQQNVVDDSIQSFLDRFYLSRIGIRMLIGQQLALLESARQPAEGPFDEDDEDWVGI 300

Query: 230 IHKRVKISQFINQTFEFVNDLCQLKFNL-----------PMSTTGNSSMITYITGE--EI 276
           I  +  I+Q      +    +C   + L           P+    ++   +    E  +I
Sbjct: 301 ICTKTNITQLSKTAIDNARHICAEHYGLYEAPKVQLLTFPLDYRPSTEEKSGCPNESPDI 360

Query: 277 EFPCIPVILEYVLTEILKNSMKAHIENDVTK-----------PIEISIFETDSDELTVRI 325
           EF  +P  L ++L E LKN+++A +E  + K           P    I    +++LTV+I
Sbjct: 361 EFMYVPGHLIHMLFETLKNALRATVEKTIEKNPSVDKYDLKFPDVKVIITEGTEDLTVKI 420

Query: 326 RDYGGGIDPKIEPKIFQYSFSTTLDS-TFSKIHEENNGNQRETDSVIGSCQNDSSVPQLM 384
            D GGGI     P ++ Y ++T  ++     + EE + N R              +P   
Sbjct: 421 SDEGGGIARSNLPLVWTYLYTTMPENEQIGLMDEEMSQNFR--------------IP--- 463

Query: 385 MPGEVENNTISGMGYGLPLCKNYLELFDGDITIQNLWGLGTDVYIKV 431
                    ++G GYGL L + Y   F GD+ + ++ G GTDVY+ +
Sbjct: 464 ---------MAGYGYGLALSRLYARYFGGDLKLMSMEGFGTDVYLHL 501

>Kwal_14.1825
          Length = 492

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 94/433 (21%), Positives = 179/433 (41%), Gaps = 77/433 (17%)

Query: 53  QAYYKIRSNIELLIQDYSRKPIPPLSYKFLTEY---QKPLSQTEKYNLAIKTINQLISLT 109
           Q YY+   N  +L + Y  K   P+S   L +Y      L++ +  N      ++L++  
Sbjct: 68  QHYYQ---NQNILEKHYLTKKPHPVSLSQLAQYFDDSTALTKQKIVNSGNFVKDELVTRI 124

Query: 110 CRQLSLIQNLPYIVLLNPKINQINSLYLKTLESLLSITFPYDLYKXXXXXXXXXXXXXXX 169
             ++ L+Q LP+ V+ N   +Q+   Y    E           ++               
Sbjct: 125 AHKIHLLQTLPFNVVNNFHFSQVYESYYNIFER----------FRRYPSIKTLEDNERFA 174

Query: 170 XXXXXVLSD-----------GLKEINN-ELLSNEAISKFLDVHIRDRITMKLIILNHLAL 217
                +LSD           G  E    +L   E + + +   +R RI+ +LI+  HL++
Sbjct: 175 KFLHTILSDFNSLNLPHLIMGALECRILDLCPPEKMDEVISSLLRARISRRLIVEEHLSI 234

Query: 218 LS-----PKTEPDMIGIIHKRVKISQFI----NQTFEFVNDLCQLKFNLPMSTTGNSSMI 268
            S      K    ++G I +     +F+    +   +F+ D+  +   LP       +  
Sbjct: 235 TSNYHSGKKENTLVLGDIFQECSAREFLLGAKSMCEKFIQDMYYVGIKLPEFIIDGKT-- 292

Query: 269 TYITGEEIEFPCIPVILEYVLTEILKNSMKAHIENDVT------KPIEISIFETDSDELT 322
                 +++F  +P+ L+Y+L E+L+NS +A ++  +       +PI +++   +S    
Sbjct: 293 ------DLKFYFLPLHLKYLLGEVLRNSYEATMQEYIRLGLKDPEPITVTVVSNESS-FI 345

Query: 323 VRIRDYGGGIDPKIEPKIFQYSFSTTLD----------------STFSKIHEENNGNQRE 366
            RI D  GGI P  E  I+ +  S  L                 S +  + + + G+   
Sbjct: 346 FRISDRAGGI-PHDEKTIWSFGKSKELARKSLSNFHKLPGLQTVSLYDHVTDHHPGHSST 404

Query: 367 TDSVIGSCQ--NDSSVPQLM------MPGEVENNTISGMGYGLPLCKNYLELFDGDITIQ 418
                 S +  N S++P  +      + G +E ++   +G GL +CK Y E ++GD+T+ 
Sbjct: 405 FPYKFTSLEPINASNLPTGLHKFEKPLLGLLERSSRYKLGIGLAMCKVYAEYWNGDLTVH 464

Query: 419 NLWGLGTDVYIKV 431
           +L G GTD  +K+
Sbjct: 465 SLQGYGTDTVLKL 477

>Sklu_2299.6 YGL059W, Contig c2299 10909-12501 reverse complement
          Length = 530

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 107/445 (24%), Positives = 185/445 (41%), Gaps = 83/445 (18%)

Query: 49  HLDFQAYYKIRSNIELLIQDYSRKPIPPLSYKFLTEYQKPLSQTEKYNLAIKTIN----- 103
           +++ Q YY+   N  +L Q Y  K   P+S K L  Y    ++  K    +K IN     
Sbjct: 92  YVNMQHYYQ---NKNILWQKYLTKSPNPVSLKQLAMYYDDSNKLTK----LKIINSGRFV 144

Query: 104 --QLISLTCRQLSLIQNLPYIVLLNPKINQINSLYLKTLESLLSITFPY-----DLYKXX 156
             +L     ++L L+QNLP+ V+ N    Q+   Y    E      FP+     D YK  
Sbjct: 145 KEELAIRIAQKLHLLQNLPFNVVNNFHFVQVYESYYNIFERFRK--FPHIKNIEDNYKFA 202

Query: 157 XXXXXXXXXXXXXXXXXXVLSDGLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLA 216
                             ++   L+    +L   E + + +   +R RI+ +LI+  HL+
Sbjct: 203 EFLYQILSDFNSLNLPHLIMG-ALECRILDLYKQEQMDELISTLLRARISRRLIVEEHLS 261

Query: 217 LLS-----PKTEPDMIGIIHKRVKISQFINQTFE----FVNDLCQLKFNLPMSTTGNSSM 267
           + S      K    ++G I +      ++ +  +    F+ D+      LP         
Sbjct: 262 ITSNFASGKKENTLVLGDIFQECCARDYLLEASQMCEAFIKDMFFDGIPLPKFV------ 315

Query: 268 ITYITGE-EIEFPCIPVILEYVLTEILKNSMKAHIEN------DVTKPIEISIFETDSDE 320
              I G+ +++F  +P  L+Y+L E L+NS +A ++       D   PI ++I  +++  
Sbjct: 316 ---IDGDTDLKFYFLPSHLKYLLGETLRNSYEATVKEYIRLGLDNPHPITVTII-SNNHS 371

Query: 321 LTVRIRDYGGGIDPKIEPKIFQYSFSTTL--------------------DSTFSKIHE-- 358
              RI D GGGI P  +  I+ +  S  L                    D  +  IH+  
Sbjct: 372 FLFRISDRGGGI-PHDDKTIWSFGKSKKLAKESLDNFHKLPGLQTVSLYDYMYQGIHDGK 430

Query: 359 -------ENNGNQ--RETDSVIGSCQN-DSSVPQLMMP--GEVENNTISGMGYGLPLCKN 406
                  +++ NQ  R T     S  N    + +L  P  G +E ++   +G GL +CK 
Sbjct: 431 ISQRITSKDDLNQPYRYTSLEPMSDTNLHKGLYKLEKPLLGLLERSSRYKLGIGLAVCKV 490

Query: 407 YLELFDGDITIQNLWGLGTDVYIKV 431
           Y E ++GD+T+ ++ G GTD  +K+
Sbjct: 491 YAEYWNGDLTVHSIHGYGTDTVLKL 515

>CAGL0F07007g 687174..688631 highly similar to sp|P53170
           Saccharomyces cerevisiae YGL059w, hypothetical start
          Length = 485

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 102/450 (22%), Positives = 186/450 (41%), Gaps = 85/450 (18%)

Query: 42  KAAINLSHLDFQAYYKIRSNIELLIQDYSRKPIPPLSYKFLTEY---------QKPLSQT 92
           KA  + SH   Q +Y    N+  LI DY +K   P+S   L +Y         QK +S  
Sbjct: 46  KAFPSRSHYINQQHYYHNKNV--LINDYLKKNPTPVSLTQLAQYYDDSTTLTKQKVISSA 103

Query: 93  E--KYNLAIKTINQLISLTCRQLSLIQNLPYIVLLNPKINQINSL----YLKTLESLLSI 146
           +  K  ++I+  +++ SL     ++I N  ++ +     N          ++TL+  +  
Sbjct: 104 KFVKEEISIRMAHKIHSLQLLPFNVINNFHFVQVYESYYNIFERFRKFPAVRTLDDSIRF 163

Query: 147 T-FPYDLYKXXXXXXXXXXXXXXXXXXXXVLSDGLKEINNELLSNEAISKFLDVHIRDRI 205
           T F  D+ K                    ++   L+    +L   + + K L   +R RI
Sbjct: 164 TKFARDILKDFNTLNLPH-----------LIMGALECTTLDLYPTDKMDKLLSDLLRARI 212

Query: 206 TMKLIILNHLALL-----SPKTEPDMIGIIHKRVKISQFINQTFEFVNDLCQLKF--NLP 258
           + +LI+  H+++        K    ++G I +     + I    +      Q  +  ++P
Sbjct: 213 SRRLIVEEHISIADNYFSGKKKNTLVLGDIFQECSAKEHILGASKICEKFIQDMYFESIP 272

Query: 259 MSTTGNSSMITYITGE-EIEFPCIPVILEYVLTEILKNSMKAHIENDVTK------PIEI 311
           M           I GE +++F  +P  L+Y+L EIL+N+ +A I++ + K      PI I
Sbjct: 273 MPELK-------INGETDLKFYFLPSHLKYLLGEILRNTYEATIKDYIRKGLPKPEPIVI 325

Query: 312 SIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLD------STFSKI--------- 356
           +I + +   L  RI D  GG+    +     +SF  T +      S F K+         
Sbjct: 326 TIIKNEESYL-FRICDRAGGLAHHHDDNNI-WSFGKTKEQAAQSISNFHKLPGLQTVSLY 383

Query: 357 -HEENNGNQRETD--------------SVIGSCQNDSSVPQLMMPGEVENNTISGMGYGL 401
            H  NN   R+ +              ++  +      VP L +   ++ +    +G GL
Sbjct: 384 DHLYNNTEDRQVNRAYINTSLEPMAHSNIASAVATGYEVPLLKL---LKRSFRYKLGIGL 440

Query: 402 PLCKNYLELFDGDITIQNLWGLGTDVYIKV 431
            +CK Y E ++GD+T+ ++ G GTD  +K+
Sbjct: 441 AMCKVYAEYWNGDLTLHSIHGFGTDTVLKL 470

>AAR157C [345] [Homologous to ScYGL059W - SH] (627130..628641) [1512
           bp, 503 aa]
          Length = 503

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 124/290 (42%), Gaps = 56/290 (19%)

Query: 186 ELLSNEAISKFLDVHIRDRITMKLIILNHLAL----LSPKTEPDMI-GIIHKRVKISQFI 240
           +L   +A+ + +   +R RI+ +LI+  HL++    +S K+E  ++ G I +     +++
Sbjct: 211 DLYPQDAMDRLMSSFLRARISRRLIVEEHLSVTSNYMSGKSENTLVLGDIFQECSAREYL 270

Query: 241 NQTFEFVNDLCQLKF--NLPMSTTGNSSMITYITG-EEIEFPCIPVILEYVLTEILKNSM 297
                   +  +  F  ++P+           I G  ++ F  +P  L Y+  E L+NS 
Sbjct: 271 LHAARICENAIRDMFYPDIPLPD-------FIIDGCADLRFYFLPSQLHYLFGETLRNSY 323

Query: 298 KAHIENDVTK------PIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTL-- 349
           +A ++  + +      PI +++ +     L  RI D GGGI P  +  I+ +  S  L  
Sbjct: 324 EATVKEAIRRGLPKPDPITVTVVQNPESYL-FRISDRGGGI-PHPDRTIWSFGKSKLLAQ 381

Query: 350 ------------------DSTF----------SKIHEENNGNQRETDSVIGSCQNDSSVP 381
                             D  +           K+   +  +  ET+   G  + D   P
Sbjct: 382 QALDNFHKLPGAQTVSLYDHMYDADARRVAAACKLSNTSLQSMAETNLTKGRYKFDFPRP 441

Query: 382 QLMMPGEVENNTISGMGYGLPLCKNYLELFDGDITIQNLWGLGTDVYIKV 431
              + G +E      +G GL +CK Y E ++GD+T+ ++ G GTD  +K+
Sbjct: 442 ---LVGLLERPFRYKLGIGLAMCKVYAEYWNGDLTVHSIHGHGTDTVLKL 488

>YGL059W (YGL059W) [1920] chr7 (392226..393701) Protein with
           similarity to human branched-chain alpha-ketoacid
           dehydrogenase kinase, transcription is induced by the
           drug FK506 in a GCN4-dependent manner [1476 bp, 491 aa]
          Length = 491

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 95/439 (21%), Positives = 178/439 (40%), Gaps = 67/439 (15%)

Query: 46  NLSHLDFQAYYKIRSNIELLIQDYSRKPIPPLSYKFLTEY---QKPLSQTEKYNLAIKTI 102
           N  +++ Q YY  R+   +L+++Y ++   P+S   L +Y      L++T+  N      
Sbjct: 52  NSEYINPQHYYHNRT---VLVENYLKRSPNPVSLTQLAQYYDDSTKLTRTKIINSGKFVK 108

Query: 103 NQLISLTCRQLSLIQNLPYIVLLNPKINQINSLYLKTLESLL---SITFPYDLYKXXXXX 159
            +L+     +L+ +Q LP+ V+ N    Q+   Y    ES     +I    D  +     
Sbjct: 109 EELVIRIAHKLNQLQQLPFNVVNNFHFVQVYESYYNIFESFRKYPTIRTLEDASQFADFI 168

Query: 160 XXXXXXXXXXXXXXXVLSDGLKEINNELLSNEAISKFLDVHIRDRITMKLIILNHLALLS 219
                          ++   L+    +L   E + + L   +R RI+ +LI+  H+   +
Sbjct: 169 KNMLEGFNTLNLPHLIMG-ALECTILDLYPREKMDQLLSDLLRARISRRLIVEEHVVYTA 227

Query: 220 PKTEPD-----MIGIIHKRVKISQFINQTFEFVNDLCQLKF--NLPMSTTGNSSMITYIT 272
             T        ++G I +     +++ +  E      Q  +  ++PM           I 
Sbjct: 228 NYTSGKEENTLVLGDIFQECSAKKYLLEASEESQKFIQDMYFKDIPMPEF-------IIE 280

Query: 273 GE-EIEFPCIPVILEYVLTEILKN----SMKAHIENDVTKPIEISIFETDSDE-LTVRIR 326
           G+ ++ F  +P  L+Y+L EIL+N    +MK +I   + KP  I +    +DE    RI 
Sbjct: 281 GDTQLSFYFLPTHLKYLLGEILRNTYEATMKHYIRKGLEKPEPIIVTVVSNDESYLFRIS 340

Query: 327 DYGGGIDPKIEPKIFQYSFSTTLDST------FSKI--------------HEENNGNQRE 366
           D  GG+    E     +SF  + +        F K+              H + N   + 
Sbjct: 341 DKAGGVLHDDEN---LWSFGKSKERAQESLNNFHKLPGLQTVSIYDEVHSHTKYNSKLKS 397

Query: 367 TDSVIGSCQNDSSVPQLMMP----GEVENNT----------ISGMGYGLPLCKNYLELFD 412
             S+       +S+  +  P    G ++  T             +G GL +CK Y E ++
Sbjct: 398 LQSITLKPYMHTSLEPMSYPSIINGHIKYETPLIELLKRSFRYKLGIGLAMCKVYAEYWN 457

Query: 413 GDITIQNLWGLGTDVYIKV 431
           GD+++ ++ G GTDV +K+
Sbjct: 458 GDLSLHSMPGYGTDVVLKL 476

>Scas_563.9
          Length = 492

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 119/283 (42%), Gaps = 49/283 (17%)

Query: 186 ELLSNEAISKFLDVHIRDRITMKLIILNHLAL----LSPKTEPDMI-GIIHKRVKISQFI 240
           ELL  + I   L   +R RI+ +LI+  HL++    LS K E  ++ G I +  +   + 
Sbjct: 197 ELLPRDEIDALLSSLLRARISRRLIVEEHLSISANYLSGKKENTLVLGDIFQECQALDY- 255

Query: 241 NQTFEFVNDLCQLKFNLPMSTTGNSSMITYITGE-EIEFPCIPVILEYVLTEILKNSMKA 299
              F   +  C+ KF   M           I G+ ++ F  +P  L+Y+L EIL+N  +A
Sbjct: 256 ---FMEASRTCE-KFVKAMYFDDIPIPELIIEGQKDLTFYFLPTHLQYILGEILRNIYEA 311

Query: 300 HIENDVTK------PIEISIFETDSDELTVRIRDYGGGIDPKIEPKIFQYSFSTTLDS-- 351
            I++ + K      PI I+I + DS     R  D  GGI    E  I+ +  S    +  
Sbjct: 312 TIKDYIRKGLAKPEPIVITIVKNDSS-FIFRFSDKAGGILHH-EEDIWSFGKSKERAAES 369

Query: 352 --TFSKI--------------HEENNGNQR----------ETDSVIGSCQNDSSVPQLMM 385
              F K+               EE++ N R           +   +G         +  M
Sbjct: 370 LNNFHKLPGLQTVSLYDHLYNGEEHDMNTRTLMANRPYMHTSLEAMGHSNLKKGPYKFEM 429

Query: 386 P--GEVENNTISGMGYGLPLCKNYLELFDGDITIQNLWGLGTD 426
           P    +E      +G GL +CK Y E ++GD+++  + G GTD
Sbjct: 430 PLIEMLERAPRYKLGIGLAMCKIYAEYWNGDLSLTTIPGHGTD 472

>KLLA0A03905g complement(345818..350470) similar to sp|P19524
            Saccharomyces cerevisiae YOR326w MYO2 myosin heavy chain,
            start by similarity
          Length = 1550

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 267  MITYITGEEIEFPCIPVILEYVLTEILKNSMKAHI-ENDVTKPIEISIFETDSDELTVR 324
            +IT  +  + E P  P IL+YV  ++  ++ KA +  NDV  P++   FE    ++ VR
Sbjct: 1456 LITQYSVADYEEPIAPEILQYVAEKVKNDTSKAEVGNNDVFLPVDNGPFEDPYQKVEVR 1514

>CAGL0J05456g 519238..520353 similar to sp|P53938 Saccharomyces
           cerevisiae YNL080c, hypothetical start
          Length = 371

 Score = 30.4 bits (67), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 17/122 (13%)

Query: 332 IDPKIEPKIFQYSFSTTLDST------FSKIHEENNG---NQRETDSVIGSCQNDSSVPQ 382
           +D +IE    Q+S+STT+++T      +  I  E++    NQR  ++ IGS Q+ SS P 
Sbjct: 240 VDDEIEGINGQFSYSTTIEATPDNNSEYEVISNEDSPSQINQRRLNT-IGSQQSRSSTPT 298

Query: 383 LMMPGEV--ENNTISGMGYGLPLCKNYLELFDGDITIQNLWGLGTDVYIKVKGPNKSLLA 440
                    + NT+  + +     K Y++L+  +IT+  +  +G   +I + G  ++L  
Sbjct: 299 SATSQRRSQKRNTVKSIDFT---TKRYIDLY--NITVFCVVPVGIASFITMVGLLRNLFI 353

Query: 441 DR 442
            R
Sbjct: 354 QR 355

>Scas_718.86
          Length = 768

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 41/100 (41%), Gaps = 26/100 (26%)

Query: 360 NNGNQRETDSVIGSCQNDSSVPQLMMPGEVENNTISGMGYGLPLCKNYLELFDGDITIQN 419
           + G++   + ++ +   D ++P+LM P    ++ +    Y          LF+ DI   N
Sbjct: 317 DKGDKENMNQILDNLNTDITIPRLMPPLRPHSDILLNSTYS---------LFEKDIVKYN 367

Query: 420 LWG-----------------LGTDVYIKVKGPNKSLLADR 442
           L+G                 +GTD+ I + G  +  L DR
Sbjct: 368 LYGEAIENALQDLIQTKKKPIGTDLVILIAGAGRGPLVDR 407

>CAGL0G02893g complement(264566..265861) highly similar to sp|Q06892
           Saccharomyces cerevisiae YPL188w POS5, hypothetical
           start
          Length = 431

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 258 PMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNSMKAHIENDVTKP 308
           P + T   +M+ +IT     +P I VI++  + E +    KA + ND  +P
Sbjct: 82  PWTPTTREAMVQFITHLHESYPEINVIVQPDVAEEISQDFKATVHNDPNRP 132

>Scas_630.24
          Length = 398

 Score = 30.0 bits (66), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 29/69 (42%), Gaps = 1/69 (1%)

Query: 333 DPKIEPKIFQYSFSTTLDSTFSKIHEENNGNQRETDSVIGSCQNDSSVPQLMMPGEVENN 392
           D KI   + + +    + + F  +     GN RE D+    C N  + PQ+M    VE  
Sbjct: 149 DRKISEDLIKKAEQLGIKALFVTVDAPQAGN-RERDARFKFCANKDNGPQIMEKTSVEKK 207

Query: 393 TISGMGYGL 401
           T +G    L
Sbjct: 208 TTNGTARTL 216

>YPL188W (POS5) [5260] chr16 (191405..192649) Protein involved in
           sensitivity to peroxide, has similarity to Utr1p and
           Yel041p [1245 bp, 414 aa]
          Length = 414

 Score = 28.9 bits (63), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 27/51 (52%)

Query: 258 PMSTTGNSSMITYITGEEIEFPCIPVILEYVLTEILKNSMKAHIENDVTKP 308
           P + +   +M+ +IT     +P + VI++  + E +    K+ +END  +P
Sbjct: 76  PWTPSTREAMVEFITHLHESYPEVNVIVQPDVAEEISQDFKSPLENDPNRP 126

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 14,276,124
Number of extensions: 629424
Number of successful extensions: 1993
Number of sequences better than 10.0: 37
Number of HSP's gapped: 1984
Number of HSP's successfully gapped: 43
Length of query: 443
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 338
Effective length of database: 12,961,219
Effective search space: 4380892022
Effective search space used: 4380892022
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)