Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.4331631616960.0
YIL043C (CBR1)3222499301e-126
KLLA0F27621g2812728781e-118
CAGL0L00847g2852568621e-116
Kwal_47.181592872838591e-115
Sklu_2260.23502928521e-113
ADL087W2872828241e-110
Sklu_2184.23102785057e-62
KLLA0C16918g3102745041e-61
YML125C3122764927e-60
Kwal_33.142603082854797e-58
AFR439C3102714701e-56
Scas_692.63142564692e-56
YML087C3122764544e-54
CAGL0B02519g3122404422e-52
ACR054C3062613961e-45
KLLA0D04488g2962253854e-44
CAGL0E06424g2982393776e-43
Scas_678.62992763716e-42
YKL150W (MCR1)3022403569e-40
Kwal_23.54713122403561e-39
Scas_595.113982131054e-05
Scas_699.4131893973e-04
YGR234W (YHB1)399165910.002
KLLA0E21901g357117890.003
CAGL0I00990g343172830.022
Kwal_27.9681396120750.22
KLLA0B14476g395104740.28
ABR110W78766740.33
Scas_718.19616157740.34
Sklu_2281.2397118730.37
KLLA0D15983g1035115730.43
YOR037W (CYC2)366195720.44
YBR149W (ARA1)34458720.48
YFR030W (MET10)1035152710.72
Kwal_55.21561349115700.80
Scas_565.51047152700.87
ABR082W68337691.4
KLLA0C07579g61968681.5
CAGL0D05280g1030115672.1
KLLA0E13860g88966662.6
Sklu_2216.562049662.8
Kwal_23.5644689145663.2
KLLA0D06127g33066644.6
KLLA0D16753g322103626.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.43
         (316 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.43                                                           657   0.0  
YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome...   362   e-126
KLLA0F27621g complement(2560055..2560900) similar to sp|P38626 S...   342   e-118
CAGL0L00847g complement(104034..104891) similar to sp|P38626 Sac...   336   e-116
Kwal_47.18159                                                         335   e-115
Sklu_2260.2 YIL043C, Contig c2260 2185-3237                           332   e-113
ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH] complement(...   322   e-110
Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement        199   7e-62
KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces...   198   1e-61
YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein ...   194   7e-60
Kwal_33.14260                                                         189   7e-58
AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH] (1...   185   1e-56
Scas_692.6                                                            185   2e-56
YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein ...   179   4e-54
CAGL0B02519g 240486..241424 highly similar to sp|Q12746 Saccharo...   174   2e-52
ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH] (454023..45...   157   1e-45
KLLA0D04488g complement(381861..382751) similar to sp|P36060 Sac...   152   4e-44
CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces c...   149   6e-43
Scas_678.6                                                            147   6e-42
YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5 ...   141   9e-40
Kwal_23.5471                                                          141   1e-39
Scas_595.11                                                            45   4e-05
Scas_699.41                                                            42   3e-04
YGR234W (YHB1) [2182] chr7 (959906..961105) Flavohemoglobin invo...    40   0.002
KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces...    39   0.003
CAGL0I00990g complement(81437..82468) similar to sp|P38909 Sacch...    37   0.022
Kwal_27.9681                                                           33   0.22 
KLLA0B14476g 1271319..1272506 similar to sp|P39676 Saccharomyces...    33   0.28 
ABR110W [702] [Homologous to ScYBR133C (HSL7) - SH] complement(5...    33   0.33 
Scas_718.19                                                            33   0.34 
Sklu_2281.2 YGR234W, Contig c2281 4625-5818                            33   0.37 
KLLA0D15983g 1343315..1346422 similar to sp|P39692 Saccharomyces...    33   0.43 
YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c mitoch...    32   0.44 
YBR149W (ARA1) [334] chr2 (539943..540977) Subunit of NADP+-depe...    32   0.48 
YFR030W (MET10) [1710] chr6 (213300..216407) Assimilatory sulfit...    32   0.72 
Kwal_55.21561                                                          32   0.80 
Scas_565.5                                                             32   0.87 
ABR082W [673] [Homologous to ScYMR032W (HOF1) - SH] complement(5...    31   1.4  
KLLA0C07579g complement(662466..664325) similar to sp|P40053 Sac...    31   1.5  
CAGL0D05280g complement(504512..507604) similar to sp|P39692 Sac...    30   2.1  
KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces...    30   2.6  
Sklu_2216.5 YPR048W, Contig c2216 7954-9816 reverse complement         30   2.8  
Kwal_23.5644                                                           30   3.2  
KLLA0D06127g complement(526164..527156) similar to sgd|S0005772 ...    29   4.6  
KLLA0D16753g 1418383..1419351 similar to sgd|S0004127 Saccharomy...    28   6.5  

>Scas_704.43
          Length = 316

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/316 (100%), Positives = 316/316 (100%)

Query: 1   MYIQAANPNQHSMNTATADSAPTENIRPTGEANAFNRSTLIPVVFILALAIRYISMRRRI 60
           MYIQAANPNQHSMNTATADSAPTENIRPTGEANAFNRSTLIPVVFILALAIRYISMRRRI
Sbjct: 1   MYIQAANPNQHSMNTATADSAPTENIRPTGEANAFNRSTLIPVVFILALAIRYISMRRRI 60

Query: 61  HANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDI 120
           HANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDI
Sbjct: 61  HANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDI 120

Query: 121 MRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNK 180
           MRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNK
Sbjct: 121 MRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNK 180

Query: 181 LGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFK 240
           LGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFK
Sbjct: 181 LGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFK 240

Query: 241 VIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGY 300
           VIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGY
Sbjct: 241 VIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGY 300

Query: 301 ARGKPLSKMEDQVFIF 316
           ARGKPLSKMEDQVFIF
Sbjct: 301 ARGKPLSKMEDQVFIF 316

>YIL043C (CBR1) [2624] chr9 complement(274071..275039) Cytochrome b5
           reductase, converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+), uses FAD cofactor [969 bp,
           322 aa]
          Length = 322

 Score =  362 bits (930), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 204/249 (81%)

Query: 68  KKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDIMRSYTPT 127
           K+  F  F LV KT+LTHNT++Y FGLP+ADDVLGLPIGQHI IK NI+GKDI RSYTPT
Sbjct: 74  KRNDFQSFPLVEKTILTHNTSMYKFGLPHADDVLGLPIGQHIVIKANINGKDITRSYTPT 133

Query: 128 SLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGG 187
           SLD +TKG+FELLVKSYP GN+SK IG L IGD I + GP GNYHYE NCR+ LGMIAGG
Sbjct: 134 SLDGDTKGNFELLVKSYPTGNVSKMIGELKIGDSIQIKGPRGNYHYERNCRSHLGMIAGG 193

Query: 188 TGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFKVIYLLDK 247
           TGIAPM+QIMKAI ++P DTT+V+L++GNV E DILL+KEL+ +V M+P QFK++Y LD 
Sbjct: 194 TGIAPMYQIMKAIAMDPHDTTKVSLVFGNVHEEDILLKKELEALVAMKPSQFKIVYYLDS 253

Query: 248 TDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGYARGKPLS 307
            DR+DW G +GY+T D++++++P+   + VQ+L+CGPP MV S +R+ V +G+ R KPLS
Sbjct: 254 PDREDWTGGVGYITKDVIKEHLPAATMDNVQILICGPPAMVASVRRSTVDLGFRRSKPLS 313

Query: 308 KMEDQVFIF 316
           KMEDQVF+F
Sbjct: 314 KMEDQVFVF 322

>KLLA0F27621g complement(2560055..2560900) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 281

 Score =  342 bits (878), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 206/272 (75%), Gaps = 2/272 (0%)

Query: 45  FILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLP 104
           F+L   I  + +  +   +K VL K    +F LV+KTVLTHNTAIY FGLP +  VLGLP
Sbjct: 12  FVLLCTIIAVVLEYQSKKDKPVLDKEKLQEFPLVAKTVLTHNTAIYRFGLPKSTQVLGLP 71

Query: 105 IGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINV 164
           IGQHIS++ NI+GKDI+RSYTPTSLDS+  G FELL+KSY  GNISK    LNIGD+I V
Sbjct: 72  IGQHISVQANINGKDILRSYTPTSLDSDAVGHFELLIKSYEKGNISKHFAQLNIGDKIKV 131

Query: 165 CGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILL 224
            GP G YHY+PN   ++GMIAGGTGIAPM+QIMK+I+ N  D T+V+L+YGN  E DILL
Sbjct: 132 RGPKGFYHYQPNMNEEIGMIAGGTGIAPMYQIMKSIFANDSDKTKVSLVYGNQTEEDILL 191

Query: 225 RKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGP 284
           +KELD  V+ +PDQFKV YLLDK   + W G +GY+T+D M++ +P+P  EGVQ+L+CGP
Sbjct: 192 KKELDAFVERKPDQFKVYYLLDKAP-EAWTGGVGYITVDTMKERLPAP-AEGVQLLVCGP 249

Query: 285 PRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
           P MV S KRNAVT+GY + KP+SKM DQ+F+F
Sbjct: 250 PPMVSSIKRNAVTLGYEKAKPISKMGDQIFVF 281

>CAGL0L00847g complement(104034..104891) similar to sp|P38626
           Saccharomyces cerevisiae YIL043c CBR1 cytochrome-b5
           reductase, hypothetical start
          Length = 285

 Score =  336 bits (862), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 194/256 (75%), Gaps = 2/256 (0%)

Query: 61  HANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDI 120
            A KA+LK   F +F LV K  LTHNTA Y F L +   VLGLPIGQHI++K  I GK +
Sbjct: 32  EAVKALLKT-EFREFELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPV 90

Query: 121 MRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNK 180
            RSYTPTSLD E  G FELLVKSYP GNISK IG++ IG++IN+ GP G Y Y PN    
Sbjct: 91  SRSYTPTSLDEECVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKH 150

Query: 181 LGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFK 240
           L M+AGGTGI PMFQIMKAI  +P D T VTLLYGNV E DILL++ELD++VK RPDQFK
Sbjct: 151 LAMVAGGTGITPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFK 210

Query: 241 VIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGY 300
           + YLLDK +RDDWEG +GYVTLDLM++  PS  EE VQ+L+CGPP MV S KRNAV +G+
Sbjct: 211 ITYLLDKPERDDWEGGVGYVTLDLMKESFPSA-EEDVQLLVCGPPGMVSSVKRNAVALGF 269

Query: 301 ARGKPLSKMEDQVFIF 316
            R KP+SKMED+VF+F
Sbjct: 270 PRAKPVSKMEDRVFVF 285

>Kwal_47.18159
          Length = 287

 Score =  335 bits (859), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 163/283 (57%), Positives = 214/283 (75%), Gaps = 2/283 (0%)

Query: 35  FNRSTLIPVVFILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGL 94
           F+  T++    I   A+ ++S      A+K +L K  F +F LVSKTVLTHNTA+Y FGL
Sbjct: 6   FSLKTILIGGLIALGAVYFVSQLLSSKASKPILLKDEFQEFPLVSKTVLTHNTAVYRFGL 65

Query: 95  PNADDVLGLPIGQHISIKENI-DGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFI 153
           P   DVLGLPIGQHISI+  + DGK+IMRSYTPTSLDS++ G FELL+KSY  GN+SK I
Sbjct: 66  PKHTDVLGLPIGQHISIQGTLKDGKEIMRSYTPTSLDSDSVGFFELLIKSYEQGNVSKMI 125

Query: 154 GNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLL 213
           G L IGD+I V GP G Y Y PN  +++GMIAGGTGIAPM+QI+K+I+ +PKD T+V+++
Sbjct: 126 GELQIGDKIKVRGPKGFYTYTPNMNSEIGMIAGGTGIAPMYQIIKSIHSDPKDRTKVSII 185

Query: 214 YGNVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPK 273
           YG+  E DILL+KE+D +V+  PDQFKV YLLDK  RD W G +GYVT ++M++++P+  
Sbjct: 186 YGSQTEDDILLKKEIDAIVESNPDQFKVHYLLDKPARDTWTGGVGYVTAEVMKEHLPAAG 245

Query: 274 EEGVQMLLCGPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
            +GVQ+L+CGPP MV S KRNAV +G+ + KP+SKM DQVF+F
Sbjct: 246 -DGVQLLVCGPPGMVSSIKRNAVALGFEKAKPISKMGDQVFVF 287

>Sklu_2260.2 YIL043C, Contig c2260 2185-3237
          Length = 350

 Score =  332 bits (852), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/292 (56%), Positives = 206/292 (70%), Gaps = 7/292 (2%)

Query: 25  NIRPTGEANAFNRSTLIPVVFILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLT 84
           +I     A  F  + L+  VF +      I+      + + VL K  F  F L+SKTVLT
Sbjct: 2   DISSMNSATIFLATVLVIAVFAI------INKTLSSKSARPVLIKDQFQDFPLISKTVLT 55

Query: 85  HNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSY 144
           HNTA+Y FGLP   DVLGLPIGQHISI+  IDGK+I+RSYTPTSLDS+  G FELL+KSY
Sbjct: 56  HNTAVYRFGLPKPTDVLGLPIGQHISIQGIIDGKEIVRSYTPTSLDSDATGHFELLIKSY 115

Query: 145 PNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNP 204
             GNISK IG L IGD I V GP G Y Y  N  + L M+AGGTGIAPM+QI+KAI +N 
Sbjct: 116 EKGNISKMIGELKIGDRIKVRGPKGFYTYTANMNSSLAMVAGGTGIAPMYQIIKAISVNL 175

Query: 205 KDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDL 264
           +D T+V L+YGNV E DILL+KELD +V+  PDQFK+ Y+LDK   + W G IGYVT D+
Sbjct: 176 QDKTKVALVYGNVSEEDILLKKELDAIVESNPDQFKIHYMLDKPTSETWNGGIGYVTADV 235

Query: 265 MEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
           M++Y+P+   EGVQ+L+CGPP MV S KRNAV +G+ R KP+SKM DQ+F+F
Sbjct: 236 MKEYLPAAG-EGVQLLVCGPPPMVSSIKRNAVALGFERAKPISKMGDQIFVF 286

>ADL087W [1654] [Homologous to ScYIL043C (CBR1) - SH]
           complement(532195..533058) [864 bp, 287 aa]
          Length = 287

 Score =  322 bits (824), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 204/282 (72%), Gaps = 10/282 (3%)

Query: 43  VVFILALAIRYISMRRRIH-------ANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLP 95
           +V  L LA+ +I +  +         A K  L K  + +F L++KTVLTHNTAIY FGLP
Sbjct: 8   LVTALVLAVSFIFIYGKFSGAKQSQPAVKTTLNK-DWQEFSLLTKTVLTHNTAIYRFGLP 66

Query: 96  NADDVLGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGN 155
            AD VLGLPIGQHISI   IDGK+++RSYTPTSLDS+  G FELLVKSY  GNISK +  
Sbjct: 67  EADAVLGLPIGQHISISGVIDGKEMLRSYTPTSLDSDATGYFELLVKSYEKGNISKMLAE 126

Query: 156 LNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYG 215
           L IGD I V GP G YHYEPN   ++GMIAGGTGI+PM+QI++AI+ NP+D T V L+YG
Sbjct: 127 LAIGDRIKVRGPKGFYHYEPNMYKEIGMIAGGTGISPMYQIIRAIFSNPRDKTRVCLVYG 186

Query: 216 NVQEADILLRKELDEMVKMRPDQFKVIYLLDK-TDRDDWEGEIGYVTLDLMEKYMPSPKE 274
           N  + DILL+ ELD MV  +PDQFK++Y+LDK  + + WEG++GY+T  +M +++P+P  
Sbjct: 187 NQTKDDILLKPELDAMVAAKPDQFKILYMLDKVAEGEQWEGKLGYITEAIMREHLPAPSS 246

Query: 275 EGVQMLLCGPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
              Q+LLCGPP MV SAKR AV++G+ + KP+SK  DQVF F
Sbjct: 247 SA-QLLLCGPPPMVSSAKRIAVSLGFEKAKPISKKGDQVFAF 287

>Sklu_2184.2 YML125C, Contig c2184 1732-2664 reverse complement
          Length = 310

 Score =  199 bits (505), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 108/278 (38%), Positives = 166/278 (59%), Gaps = 9/278 (3%)

Query: 39  TLIPVVFILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNAD 98
           T IP++  L L  R+ S   R    +  +    +    L  + +++ N+AIY F L  + 
Sbjct: 42  TGIPILLAL-LGFRFYSAYSR----RKSVYPNAWTALELEDQILISKNSAIYRFKLKTSL 96

Query: 99  DVLGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNI 158
           + L +P+G H+++K  I+GK+ +R YTP +   +T G F+++VKSY +G +SK+  +L  
Sbjct: 97  ETLKIPVGHHLAVKIPIEGKNEIRYYTPITQRYDT-GHFDIIVKSYTDGKVSKYFASLKP 155

Query: 159 GDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQ 218
           G  +   GP G ++Y  N    +GMIAGG+GI PM Q++  I   P+DTT+V+L+Y N  
Sbjct: 156 GQLVEFQGPVGRFNYATNSSKAIGMIAGGSGITPMLQVLSQIVTTPEDTTKVSLIYANET 215

Query: 219 EADILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQ 278
           E DILL+ ELDEM    P+ F+V Y+L K     W G+ GYVT D M+KY+P P +E  +
Sbjct: 216 ENDILLKDELDEMADKYPN-FEVHYVLHKPS-PGWTGDTGYVTKDQMQKYLPGPSDEN-R 272

Query: 279 MLLCGPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
           +L+CGP  M+      +  +G+ RG   SK +DQVF+F
Sbjct: 273 LLICGPLAMINMLLNYSEELGWPRGIVKSKPDDQVFVF 310

>KLLA0C16918g 1478540..1479472 similar to sp|Q12746 Saccharomyces
           cerevisiae YML125c, start by similarity
          Length = 310

 Score =  198 bits (504), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 105/274 (38%), Positives = 162/274 (59%), Gaps = 8/274 (2%)

Query: 43  VVFILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLG 102
           V+    LA R +  R R+ +    +    +    L  +T+++ NTAIY F L  + + L 
Sbjct: 45  VILGAILAYRMVVARSRLKS----IYSDRWTALELEDQTIVSKNTAIYRFKLKTSLECLD 100

Query: 103 LPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEI 162
           +P G H++++  ++ KD +R YTP S   ET G F+++VKSY +G +SK+  +L  G  +
Sbjct: 101 IPTGHHLAVRIPLEDKDEIRYYTPISNKFET-GHFDIMVKSYADGQVSKYFASLRPGQTV 159

Query: 163 NVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADI 222
           +  GP G + YE N    +GMIAGG+G+ PM Q++  I   P D T VTLLY N  E DI
Sbjct: 160 DFKGPVGRFAYEANSSKHIGMIAGGSGLTPMLQVLNTIITTPTDLTRVTLLYANETENDI 219

Query: 223 LLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLC 282
           LL+ ELDE+ +  P+ F V YL++      W+GE+G+VT ++M KY+P P  E  ++L+C
Sbjct: 220 LLKDELDEISEKYPN-FLVHYLVNHPS-SSWQGEVGWVTKEIMSKYLPDPSAEN-RLLIC 276

Query: 283 GPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
           G P M  +  + A  +G+ +G   S  +DQVF+F
Sbjct: 277 GKPEMKKTLLKYAEELGWPKGILKSNPDDQVFVF 310

>YML125C (YML125C) [3847] chr13 complement(20762..21700) Protein
           with similarity to NADH-cytochrome b5 reductase [939 bp,
           312 aa]
          Length = 312

 Score =  194 bits (492), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 104/276 (37%), Positives = 161/276 (58%), Gaps = 9/276 (3%)

Query: 41  IPVVFILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDV 100
           +P++F++     Y + +RR       L    +    L  +T+++ NTA+Y F L    + 
Sbjct: 46  LPILFMIIFVRAYSAYKRR-----RSLYPDRWTSLELEDQTIISKNTALYRFKLKTRLES 100

Query: 101 LGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGD 160
           L +P G H++++  IDGK  +R Y P S   E+ G  +L+VK+Y +G +SK+   LN GD
Sbjct: 101 LDIPAGHHVAVRVPIDGKQEVRYYNPISSKLES-GYLDLVVKAYVDGKVSKYFAGLNSGD 159

Query: 161 EINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEA 220
            ++  GP G  +YEPN    LG++AGG+GI P+ QI+  I   P+D T+V+LLY N  E 
Sbjct: 160 TVDFKGPIGTLNYEPNSSKHLGIVAGGSGITPVLQILNEIITVPEDLTKVSLLYANETEN 219

Query: 221 DILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQML 280
           DILL+ ELDEM +  P  F+V Y++     D W G++GY+T D M +Y+P   E+  ++L
Sbjct: 220 DILLKDELDEMAEKYP-HFQVHYVV-HYPSDRWTGDVGYITKDQMNRYLPEYSEDN-RLL 276

Query: 281 LCGPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
           +CGP  M   A + A  +G+      S  +DQVF+F
Sbjct: 277 ICGPDGMNNLALQYAKELGWKVNSTRSSGDDQVFVF 312

>Kwal_33.14260
          Length = 308

 Score =  189 bits (479), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 101/285 (35%), Positives = 171/285 (60%), Gaps = 9/285 (3%)

Query: 32  ANAFNRSTLIPVVFILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYN 91
           AN +    ++P   ++ +  R+++  +R    K+V     +    L  +T+L+ NTA+Y 
Sbjct: 33  ANDYKFLWILPFAAVI-VGFRFLTAYKR---RKSVFPD-KWSALELEDQTLLSKNTAMYR 87

Query: 92  FGLPNADDVLGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISK 151
           F +  + + L  P+G H++++  IDGKD +R YTP S   +  G F+++VKSY +G +SK
Sbjct: 88  FKMKTSFETLNFPVGHHLAVRVPIDGKDQIRYYTPVSPQYQP-GYFDIIVKSYADGQVSK 146

Query: 152 FIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVT 211
           +   L  G  ++  GP G ++Y  N   ++GMIAGG+GI PM QI+  I   P+D T+V+
Sbjct: 147 YFAGLKAGSAVDFKGPVGRFNYVVNSYKQIGMIAGGSGITPMLQILNKIITTPEDLTKVS 206

Query: 212 LLYGNVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDLMEKYMPS 271
           L+Y N  E DILL++E+DE+ +  P+ F+V Y+L +T    W+G++G VT +LM+KY+P 
Sbjct: 207 LIYANETENDILLKEEIDEIAEKYPN-FEVHYVL-RTPSSTWKGDVGLVTNELMQKYLPI 264

Query: 272 PKEEGVQMLLCGPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
              +  ++++ G P M+      A  +G+ +G   SK +D+VF F
Sbjct: 265 SSSDN-RLVMSGKPEMIRMLLEYAEELGWPKGIEKSKGDDRVFAF 308

>AFR439C [3631] [Homologous to ScYML125C - SH; ScYML087C - SH]
           (1228716..1229648) [933 bp, 310 aa]
          Length = 310

 Score =  185 bits (470), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 155/271 (57%), Gaps = 4/271 (1%)

Query: 46  ILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPI 105
           ILALA+   +     + ++  +    +    L  + VL+ N AIY F L ++ + L +P 
Sbjct: 44  ILALAMFVGARLLLAYRSRTSILPNEWTPLELEERIVLSKNAAIYRFKLRSSVETLDIPT 103

Query: 106 GQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVC 165
           G H++ K  +DG + +R YTP S +   +G F+++VKSY +G +SK+   L  G  +   
Sbjct: 104 GFHLAAKVMLDGVEEVRYYTPIS-NKFAEGHFDIIVKSYVDGKVSKWFAGLQPGQTVEFK 162

Query: 166 GPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLR 225
           GP G + Y  N   K+GM+ GG+ I PM  ++  I   P+DTT+V L+Y N  E DILL+
Sbjct: 163 GPVGRFSYVTNAYKKIGMVTGGSAITPMLSVLNKIVTTPEDTTQVCLIYANETENDILLK 222

Query: 226 KELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPP 285
            ELD++    P+ F+V Y++ K     W GE+GYVT   +EKY+P P     ++L+CGPP
Sbjct: 223 DELDDLASKYPN-FEVHYVVRKPSA-SWTGEVGYVTKQHLEKYLP-PCNPAHRLLICGPP 279

Query: 286 RMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
           +M       A  +G+ +G   SK EDQVF+F
Sbjct: 280 KMKQMVLEYAEQLGWPKGAMKSKPEDQVFVF 310

>Scas_692.6
          Length = 314

 Score =  185 bits (469), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 152/256 (59%), Gaps = 4/256 (1%)

Query: 61  HANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDI 120
           H  K  L    +    L  +TV++ NTA+Y F L    + L +P G HI+++  ID K+ 
Sbjct: 63  HQRKRSLFPDRWTSLELDDQTVVSKNTALYRFKLKTNLESLDIPAGYHIAVRVFIDDKEE 122

Query: 121 MRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNK 180
           +R Y P S   +T G F+LL+KSY +G +SK+   L  GD +   GP G  HY PN    
Sbjct: 123 IRYYNPISSKLDT-GHFDLLIKSYADGKVSKYFAGLKPGDTVEFKGPIGELHYAPNSSKA 181

Query: 181 LGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFK 240
           LG++AGG+GI P+ Q++  I   P+D T+++L+Y N  E DILL+ ELDEM +  P  F+
Sbjct: 182 LGIVAGGSGITPVLQMLNEIITVPEDLTKLSLIYANDTENDILLKDELDEMSEKYP-HFE 240

Query: 241 VIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGY 300
           V Y++ +   + WEG++G V+ + MEKY+P   ++  ++L+CGP  M     + A  +G+
Sbjct: 241 VHYVV-RNPSESWEGDVGLVSKEQMEKYLPKYSDDH-RLLICGPEAMEKMVVKYAEELGW 298

Query: 301 ARGKPLSKMEDQVFIF 316
            +    +K +DQVF+F
Sbjct: 299 KQSVSKNKGDDQVFVF 314

>YML087C (YML087C) [3882] chr13 complement(94431..95369) Protein
           containing an oxidoreductase FAD-binding domain and an
           oxidoreductase FAD or NAD-binding domain, has moderate
           similarity to cytochrome b5 reductase (S. cerevisiae
           Cbr1p), which converts 2 ferricytochrome B5 + NADH to 2
           ferrocytochrome B5 + NAD(+) [939 bp, 312 aa]
          Length = 312

 Score =  179 bits (454), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 165/276 (59%), Gaps = 5/276 (1%)

Query: 41  IPVVFILALAIRYISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDV 100
           I VV +L   + Y +    I  +K+ L +  +    L  KT ++ NT++Y F L    + 
Sbjct: 42  IVVVSLLQFVVLYATAFISIGTDKS-LYRNKWVALPLSKKTRISRNTSLYCFKLKYPFER 100

Query: 101 LGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGD 160
           L +P+G H++++  I+G+ ++R YTP ++ + T+G  EL+VK+Y +G +SK+   L I  
Sbjct: 101 LHIPMGYHLAVRVTINGERLVRYYTPVNVPN-TEGHLELVVKTYKHGVVSKYFDKLKIRQ 159

Query: 161 EINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEA 220
            +   GP G   Y+ +   +LG+IAGG+GI P+ Q+++ I  +P+D T ++L+Y N  E 
Sbjct: 160 YVEFKGPLGELEYDQDTATELGIIAGGSGITPVLQVLQEIIPSPEDLTHISLIYANETED 219

Query: 221 DILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQML 280
           DIL++ +LD M K  P  FKV Y++ K +   W G++GYVTL+ M++Y+P   E+  ++L
Sbjct: 220 DILMKSQLDHMAKEYP-HFKVHYVIHKPN-GKWNGDVGYVTLEEMKRYLPKQAEDH-RLL 276

Query: 281 LCGPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
           +CGPP+M       A  +G++ G       D+VF+F
Sbjct: 277 ICGPPKMNEMVLNYAKELGWSNGFHKGNGTDKVFVF 312

>CAGL0B02519g 240486..241424 highly similar to sp|Q12746
           Saccharomyces cerevisiae YML125c, start by similarity
          Length = 312

 Score =  174 bits (442), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 88/240 (36%), Positives = 146/240 (60%), Gaps = 4/240 (1%)

Query: 77  LVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGS 136
           L  +T+++ NTAIY F L    + + +P G H+ ++  IDGK+ +R+Y P S   E KG 
Sbjct: 77  LEDQTLISRNTAIYRFKLKTPLETIDIPSGHHVQVRVFIDGKEEVRNYNPISTRFE-KGH 135

Query: 137 FELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQI 196
            +LLVKSY +G +SK+  ++  G+ ++  GP G+  Y+PN    +GM+ GG+GI P  Q+
Sbjct: 136 IDLLVKSYKDGKVSKYFASMKPGETVDFRGPVGSLVYKPNTYKNIGMVCGGSGITPALQM 195

Query: 197 MKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGE 256
           +  I   P+D T+++L+Y N  E DILL++ELDEM +  P  F V Y++ +     WEGE
Sbjct: 196 LNDIITVPEDLTKLSLIYCNETEKDILLKEELDEMAEKYP-HFNVHYIVSQP-TGQWEGE 253

Query: 257 IGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGYARGKPLSKMEDQVFIF 316
           +G+++ + M K++P P ++  ++L+CGP          A  +G+      +K ++QVF+F
Sbjct: 254 VGHISKETMVKHLPHPADDS-RLLICGPEGFTQKVFDQAKEIGWKMDYTKTKGDEQVFVF 312

>ACR054C [1102] [Homologous to ScYKL150W (MCR1) - SH]
           (454023..454943) [921 bp, 306 aa]
          Length = 306

 Score =  157 bits (396), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 88/261 (33%), Positives = 138/261 (52%), Gaps = 9/261 (3%)

Query: 62  ANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKE-NIDGKDI 120
           A +     G +H   +     ++H+T  + F LP+ D V GL     +  K     G ++
Sbjct: 49  AAQTFTGDGQWHALKIAKIEQVSHDTRRFTFALPSQDHVTGLTTASALLAKYVTPKGSNV 108

Query: 121 MRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNK 180
           +R YTP S D+  +G F+L++K Y  G  +  +  L   D +   GP   + ++PN  + 
Sbjct: 109 IRPYTPVS-DNMARGMFQLVIKHYDGGKFTTHLFGLKENDTVEFKGPIQKWRWDPNMFDS 167

Query: 181 LGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFK 240
           + ++  GTGI P+FQ+M  I  NP D T+V LLYGN    DILLRKEL+E+    PDQ K
Sbjct: 168 IVLMGAGTGITPLFQMMHHIAENPTDNTKVHLLYGNKTPQDILLRKELEELASKYPDQVK 227

Query: 241 VIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVT--- 297
           V Y +DK +  D++GE G++T D +++ +P+P      + +CGPP  + +   N V+   
Sbjct: 228 VTYFVDKPE-GDYKGEKGFITKDFLKQNLPTPGSNS-HIFVCGPPPFMDAFSGNKVSPSD 285

Query: 298 MGYARG--KPLSKMEDQVFIF 316
            G   G    L   +D V+ F
Sbjct: 286 QGQVTGVLSELGYTKDHVYKF 306

>KLLA0D04488g complement(381861..382751) similar to sp|P36060
           Saccharomyces cerevisiae YKL150w MCR1 cytochrome-b5
           reductase, start by similarity
          Length = 296

 Score =  152 bits (385), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 82/225 (36%), Positives = 125/225 (55%), Gaps = 4/225 (1%)

Query: 62  ANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIK-ENIDGKDI 120
            +KA L    +    ++    L+H+T  + F LP  D V GL     I  K     G ++
Sbjct: 39  TSKAFLGDNEWIDLPIIKIEKLSHDTKRFTFALPKKDQVSGLITASCILAKFVTPKGSNV 98

Query: 121 MRSYTPTSLDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNK 180
           +R YTP S D+ TKG  EL+VK Y NG  +  +  L   D ++  GP   + ++PN  + 
Sbjct: 99  IRPYTPVS-DNGTKGKMELVVKHYENGKFTSHLFGLKENDTVSFKGPITKWEWKPNSYDS 157

Query: 181 LGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFK 240
           + ++  GTGI P++Q++  I  NP+D T++ L YGN    DILL+ ELD + K  PDQ K
Sbjct: 158 ITLLGAGTGINPLYQLVHHIAENPEDNTKIHLYYGNKTPEDILLKSELDNLQKKYPDQVK 217

Query: 241 VIYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPP 285
           + Y +DK +  ++EGE G++T D +    P P E+  Q+ +CGPP
Sbjct: 218 ITYFVDKAE-GNFEGETGFITKDYLSHQAPKPSEKN-QVFVCGPP 260

>CAGL0E06424g 644026..644922 similar to sp|P36060 Saccharomyces
           cerevisiae YKL150w MCR1 cytochrome-b5 reductase, start
           by similarity
          Length = 298

 Score =  149 bits (377), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 131/239 (54%), Gaps = 8/239 (3%)

Query: 84  THNTAIYNFGLPNADDVLGLPIGQHISIK-ENIDGKDIMRSYTPTSLDSETKGSFELLVK 142
           +H+T  + F LP  D V GL +   +  K     G  ++R YTP S D   KG  E ++K
Sbjct: 62  SHDTKRFFFKLPTDDSVSGLTLASAVLTKFMTPKGNPVIRPYTPVS-DLSEKGYIEFVIK 120

Query: 143 SYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYL 202
            Y  G ++  +  L   D +   GP   + ++PN  + + ++ GGTGI P++Q++  I  
Sbjct: 121 HYEGGKMTDHLFQLKPKDTLAFQGPIPKWQWKPNSFDTITLLGGGTGITPLYQLVHHITQ 180

Query: 203 NPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVTL 262
           N +D T++ L YG+   +DILL+KELD++ K  P+Q  + Y +DK D   ++G  G++T 
Sbjct: 181 NKEDKTKINLFYGSKTPSDILLKKELDDLQKKYPEQLNIQYFVDKDDTGKFDGNKGFITK 240

Query: 263 DLMEKYMPSPKEEGVQMLLCGPPRMVGS---AKRNAVTMGYARG--KPLSKMEDQVFIF 316
           D + K  P PKE+  Q+ +CGPP  + S    K++ +  G   G  K L   +DQVF F
Sbjct: 241 DFLAKNAPGPKEK-TQVFVCGPPPFMDSLSGQKKSPMEQGDLTGALKDLGYSQDQVFKF 298

>Scas_678.6
          Length = 299

 Score =  147 bits (371), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 88/276 (31%), Positives = 141/276 (51%), Gaps = 15/276 (5%)

Query: 53  YISMRRRIHANK----AVLKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQH 108
           Y   R R+   K      +  G +    +V     +H+T  + F LP+ D + GL +   
Sbjct: 27  YFYTRPRVAVQKEKQRVFVGDGNWIDLPIVKIEDESHDTKRFTFKLPSEDAITGLTLASA 86

Query: 109 ISIKE-NIDGKDIMRSYTPTS-LDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCG 166
           I  K     G +++R YTP S LD +  G+FEL++K Y +G +S  + +L   D ++  G
Sbjct: 87  IFTKYVTAKGNNVVRPYTPVSPLDQQ--GTFELVIKHYNDGKMSSHLFSLKPNDVVSFKG 144

Query: 167 PAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLRK 226
           P   + + PN    + ++  GTG  P++Q+   I  NP+D T++ + YGN   +DILL+K
Sbjct: 145 PIKKWQWVPNSFKSITLLGAGTGTTPLYQLASHIARNPEDKTKINVFYGNKTSSDILLKK 204

Query: 227 ELDEMVKMRPDQFKVIYLLDKTDRDDWEG-EIGYVTLDLMEKYMPSPKEEGVQMLLCGPP 285
           E +E+ +  PDQ KV Y +DK D     G E+G+++ + + K  P PKE+   + +CGPP
Sbjct: 205 EWNELQEKYPDQVKVTYFVDKLDDGKENGVELGFISKEFIAKNAPGPKED-THLFICGPP 263

Query: 286 ---RMVGSAKRNAVTMGYARG--KPLSKMEDQVFIF 316
              +     K      G   G  + L   +DQVF F
Sbjct: 264 PFMKAYSGEKAKPTDQGELTGLLQELGYSKDQVFKF 299

>YKL150W (MCR1) [3118] chr11 (166549..167457) NADH-cytochrome b5
           reductase, mitochondrial protein that may be involved in
           the response to oxidative damage [909 bp, 302 aa]
          Length = 302

 Score =  141 bits (356), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 133/240 (55%), Gaps = 9/240 (3%)

Query: 84  THNTAIYNFGLPNADDVLGLPIGQHISIK-ENIDGKDIMRSYTPTSLDSETKGSFELLVK 142
           +H+T  + F LP  D  +GL +   +  K     G +++R YTP S D   KG F+L+VK
Sbjct: 65  SHDTRRFTFKLPTEDSEMGLVLASALFAKFVTPKGSNVVRPYTPVS-DLSQKGHFQLVVK 123

Query: 143 SYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYL 202
            Y  G ++  +  L   D ++  GP   + ++PN    + ++  GTGI P++Q+   I  
Sbjct: 124 HYEGGKMTSHLFGLKPNDTVSFKGPIMKWKWQPNQFKSITLLGAGTGINPLYQLAHHIVE 183

Query: 203 NPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFKVIYLL-DKTDRDDWEGEIGYVT 261
           NP D T+V LLYGN    DILLRKELD + +  PD+F V Y + DK D  D++GEI +++
Sbjct: 184 NPNDKTKVNLLYGNKTPQDILLRKELDALKEKYPDKFNVTYFVDDKQDDQDFDGEISFIS 243

Query: 262 LDLMEKYMPSPKEEGVQMLLCGPPRMVGS---AKRNAVTMGYARG--KPLSKMEDQVFIF 316
            D +++++P PK E   + +CGPP  + +    K++    G   G    L   +DQVF F
Sbjct: 244 KDFIQEHVPGPK-ESTHLFVCGPPPFMNAYSGEKKSPKDQGELIGILNNLGYSKDQVFKF 302

>Kwal_23.5471
          Length = 312

 Score =  141 bits (356), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 134/240 (55%), Gaps = 9/240 (3%)

Query: 83  LTHNTAIYNFGLPNADDVLGLPIGQHISIK-ENIDGKDIMRSYTPTSLDSETKGSFELLV 141
           ++H+T  + F LP  D V GL     +  K +   G +++R YTP S D  TKG  E ++
Sbjct: 76  VSHDTRRFVFSLPQEDQVSGLITASALLAKLQTPKGSNVIRPYTPVS-DVSTKGHIEFVI 134

Query: 142 KSYPNGNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIY 201
           K Y  G +++ + +    D +   GP   + ++PN  + + +I  G+GI P++Q++  I 
Sbjct: 135 KHYKGGKMTEMLFDKKPSDTVAFKGPIIKWEWKPNSFDSITLIGAGSGITPLYQLLHHIS 194

Query: 202 LNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDRDDWEGEIGYVT 261
            NP+D T++ LLYGN    DILL+KEL+E+     DQ K+ + +DK +   ++GEIG++T
Sbjct: 195 QNPEDKTKIHLLYGNKTPNDILLKKELEEVQAKYADQVKIHFFVDKAE-GPFDGEIGFIT 253

Query: 262 LDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVT---MGYARG--KPLSKMEDQVFIF 316
            + +EK +P   E+  Q+ +CGPP  + +     V+    G   G  K L   ++QVF F
Sbjct: 254 KEFLEKNVPKASEKN-QVFVCGPPPFMQAYSGPKVSPKDQGELTGILKDLGFSKEQVFKF 312

>Scas_595.11
          Length = 398

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 104/213 (48%), Gaps = 26/213 (12%)

Query: 53  YISMRRRIHANKAVLKKGTFHKFCLVSKTVLTHNTAIYNFGL-PNAD---DVLGLPI--G 106
           +I++ + ++A +A      +  F +V K ++ ++  +Y F + P  +   ++  LPI  G
Sbjct: 133 FITVEKEMYAEQAW---PGWKPFTVVDKELVAND--VYAFTVKPTTESGINLSTLPIVAG 187

Query: 107 QHISIKENI----DGKDIMRSYTPTSLDSETKGSFELLV---KSYPNGNISKFI-GNLNI 158
           Q+I++  +     +  D +R Y+  S+ ++    F + +   K++P G +S+F+  ++ +
Sbjct: 188 QYITVNTHPVRQDNQYDALRHYSLCSISTKDGLKFAVKLETDKTHPAGLVSEFLHKDVKV 247

Query: 159 GDEINVCGPAGNYHYEPNCRNK----LGMIAGGTGIAPMFQIM-KAIYLNPKDTTEVTLL 213
           GDE+ +  PAG++       ++    L +++ G G+ P+  ++ K +  NP     +  +
Sbjct: 248 GDELKLSAPAGDFALTDKLIHQNEIPLVLLSAGVGVTPILAMLEKQVTENP--NRPIYWI 305

Query: 214 YGNVQEADILLRKELDEMVKMRPDQFKVIYLLD 246
             +  E     +K +DE++       K I   D
Sbjct: 306 QSSYNEGTQSFKKHVDELLDKATTTKKTILYTD 338

>Scas_699.41
          Length = 318

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 41/93 (44%), Gaps = 15/93 (16%)

Query: 120 IMRSYTPTSL-------------DSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCG 166
           ++R+YTP  L             D    G     +K Y NG +++++  L +   + + G
Sbjct: 101 VVRNYTPVPLSFVQDHNDLIPMTDKNDTGKLVFYLKQYSNGEVARWLHRLPVNSTVEIRG 160

Query: 167 PAGNYHYEP--NCRNKLGMIAGGTGIAPMFQIM 197
           P  +Y ++   N +  + M   G G+   FQ++
Sbjct: 161 PFIDYKFQETDNTKFDVSMFTAGAGVVTAFQLL 193

>YGR234W (YHB1) [2182] chr7 (959906..961105) Flavohemoglobin
           involved in protection from nitrosative stress,
           distantly related to animal hemoglobins [1200 bp, 399
           aa]
          Length = 399

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 77/165 (46%), Gaps = 26/165 (15%)

Query: 102 GLPI--GQHISI------KENIDGKDIMRSYTPTSLDSETKGSFELLVK------SYPNG 147
            LPI  GQ+I++      +EN    D +R Y+  S  + TK      VK      ++P G
Sbjct: 181 SLPITPGQYITVNTHPIRQEN--QYDALRHYSLCS--ASTKNGLRFAVKMEAARENFPAG 236

Query: 148 NISKFI-GNLNIGDEINVCGPAGNYHYEPNCRNK----LGMIAGGTGIAPMFQIM-KAIY 201
            +S+++  +  +GDEI +  PAG++       ++    L +++ G G+ P+  ++ + + 
Sbjct: 237 LVSEYLHKDAKVGDEIKLSAPAGDFAINKELIHQNEVPLVLLSSGVGVTPLLAMLEEQVK 296

Query: 202 LNPKDTTEVTLLYGNVQEADILLRKELDEMVKMRPDQFKVIYLLD 246
            NP     +  +  +  E     +K +DE++    +  K+I   D
Sbjct: 297 CNP--NRPIYWIQSSYDEKTQAFKKHVDELLAECANVDKIIVHTD 339

>KLLA0E21901g 1946190..1947263 similar to sp|P38909 Saccharomyces
           cerevisiae YOR037w CYC2 cytochrome-c mitochondrial
           import factor singleton, hypothetical start
          Length = 357

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 46/117 (39%), Gaps = 43/117 (36%)

Query: 120 IMRSYTPTSLDSETKGSFELL-------------VKSYPNGNISKFIGNLNIGDEINVCG 166
           ++RSYTP  L  E  G+ E+L             +K Y  G ++++I +L +G  + + G
Sbjct: 116 VVRSYTPLPLTIEENGAVEVLRDEENASGALTFYIKQYKQGEVARWINHLPLGHVLELRG 175

Query: 167 P---------------------------AGNYHYEPNCRNKLGMIAGGTGIAPMFQI 196
           P                             NY Y+P     +    GGTGI P+ Q+
Sbjct: 176 PFVEYEFPDTADEITRDRSFLWGNEDCVKDNYKYQP---FDILFFTGGTGIVPLLQM 229

>CAGL0I00990g complement(81437..82468) similar to sp|P38909
           Saccharomyces cerevisiae YOR037w CYC2, hypothetical
           start
          Length = 343

 Score = 36.6 bits (83), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 72/172 (41%), Gaps = 52/172 (30%)

Query: 120 IMRSYTPTSLDSETKG------------SFELL--VKSYPNGNISKFIGNLNIGDEINVC 165
           ++R+YTP  L  ++ G            S +LL  +KSY NG ++++I +L +G  + + 
Sbjct: 120 VVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNNGEVARWIKSLPVGSTLELR 179

Query: 166 GPAGNYHYEPNCRNKLG---------------------MIAGGTGIAPMFQIMKAIYLNP 204
           GP  +Y +    RN L                        AGGTGI    Q +    LNP
Sbjct: 180 GPFIDYKF----RNDLSKHHRDANGSTLINKTQLSNVPFFAGGTGIVTALQPI----LNP 231

Query: 205 --KDTTEVTLLYG--NVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDRDD 252
             +    +TL +   ++QE   L       +V     Q K+ Y L +T + D
Sbjct: 232 YGQFNYNMTLFHSCKSIQELGCLY-----HLVNGLAQQNKITYHLFETSKGD 278

>Kwal_27.9681
          Length = 396

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 59/120 (49%), Gaps = 14/120 (11%)

Query: 99  DVLGLPIGQHISIK----ENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGN---ISK 151
           D L    GQ++++K    +N +  D +R Y+  S    +   F +  + + NG+   +S 
Sbjct: 180 DQLSFQPGQYLTVKTHPTDNGNQYDALRHYSICSSSVSSGLKFAVR-REHGNGHEGLVSS 238

Query: 152 FI-GNLNIGDEINVCGPAGNYHYEPNC----RNKLGMIAGGTGIAPMFQIM-KAIYLNPK 205
           F+  ++ +GDEI +  PAG++    +        L +++ G G  P+  ++ + I  NP+
Sbjct: 239 FLHDHIRVGDEILLSAPAGDFSLNKDLITQNEKPLVLLSAGVGATPLVSMLEEQIATNPE 298

>KLLA0B14476g 1271319..1272506 similar to sp|P39676 Saccharomyces
           cerevisiae YGR234w YHB1 flavohemoglobin singleton, start
           by similarity
          Length = 395

 Score = 33.1 bits (74), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 52/104 (50%), Gaps = 11/104 (10%)

Query: 106 GQHISIKENI----DGKDIMRSYTPTSLDSETKGSFELLVK--SYPNGNISKFIGN-LNI 158
           GQ++++K +     +  D +R Y+  S  +E    F +  +     +G +S+++   +N+
Sbjct: 187 GQYLTVKTHPTTHDNEYDALRHYSICSESTEDGLKFAVKYEHGEEQDGLVSEYMHKFINV 246

Query: 159 GDEINVCGPAGNYHYEPNCRNK----LGMIAGGTGIAPMFQIMK 198
           GD+I +  PAG++        +    L +I+ G G  P+  +++
Sbjct: 247 GDQIELSAPAGDFEMNKELIKQEEVPLVLISAGVGATPLVAMLE 290

>ABR110W [702] [Homologous to ScYBR133C (HSL7) - SH]
           complement(589099..591462) [2364 bp, 787 aa]
          Length = 787

 Score = 33.1 bits (74), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 5/66 (7%)

Query: 254 EGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPPRMVGSAKRNAVTMGY-----ARGKPLSK 308
           E  IG V+L ++E      + EGV+ L+  PPR +G     A  +G       RG PL  
Sbjct: 82  EPAIGEVSLRVLEHEYEYARAEGVKQLIVAPPRELGRLNLYAQRLGRLWERAGRGPPLVS 141

Query: 309 MEDQVF 314
           +   +F
Sbjct: 142 VSLPLF 147

>Scas_718.19
          Length = 616

 Score = 33.1 bits (74), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 67/157 (42%), Gaps = 25/157 (15%)

Query: 137 FELLVKSYPNGNISKFIGNLNIGDEINVCGPAGN-----YHYEPNCRNKLGMIAGGTGIA 191
           +  +++    G  + +I +L  GD +       N     YH  P     + +++ G GIA
Sbjct: 428 YRTILRKIRKGVCTDYIAHLKEGDHLRYKIQHNNLVRDNYHGRP-----MILVSPGVGIA 482

Query: 192 PMFQIMKAIYLNPKDTTEVTLLYG-NVQEADILLRKELDEMVKMRPDQFKVIYLLDKTDR 250
           P+  I+KA     K + ++   +G   ++ D L +  L+E  K +  +   ++  D+ + 
Sbjct: 483 PLMSIVKA-----KLSEDINFFFGCRFKDKDYLYQNLLEEWEKEKRIKLHPVFSRDRENS 537

Query: 251 DDWEGEIGYVTLDLMEKYMPSPK----EEGVQMLLCG 283
            D      YV  D++ K  P       +E   M LCG
Sbjct: 538 PD----TKYVQ-DVLWKLGPEMTNLIVKENAIMCLCG 569

>Sklu_2281.2 YGR234W, Contig c2281 4625-5818
          Length = 397

 Score = 32.7 bits (73), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 63/118 (53%), Gaps = 16/118 (13%)

Query: 103 LPI--GQHISI-----KENIDGKDIMRSYTPTSLDSETKGSFELLVKSYP--NGNISKFI 153
           LPI  GQ+I++     ++N +  D +R Y+  S  +     F +  +      G +S+++
Sbjct: 182 LPIVAGQYITVNTHPTRQN-NQYDALRHYSICSASAADGLKFAVKYEHAAGHEGLVSQYL 240

Query: 154 G-NLNIGDEINVCGPAGNYHYEPNC--RNK--LGMIAGGTGIAPMFQIMK-AIYLNPK 205
             +++IGDEI +  PAG++  +     +N+  L +++ G G  P+  +++  ++ NPK
Sbjct: 241 HQDVSIGDEILLSAPAGDFGMDQKLIYQNEVPLVLLSSGVGATPLLAMLENQVHANPK 298

>KLLA0D15983g 1343315..1346422 similar to sp|P39692 Saccharomyces
           cerevisiae YFR030w MET10 sulfite reductase
           flavin-binding subunit, start by similarity
          Length = 1035

 Score = 32.7 bits (73), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 48/115 (41%), Gaps = 14/115 (12%)

Query: 147 GNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPK- 205
           G  SKFI +L IG E+ V          P+ +  + M   GTG+AP   I++      + 
Sbjct: 851 GQASKFISDLAIGSELVVSVKPSVMKLPPSPKQPVIMSGLGTGLAPFKAIVEEKLWQRQQ 910

Query: 206 --DTTEVTLLYGNVQEADILLRKELDEMVK-----------MRPDQFKVIYLLDK 247
             +  EV L  G+  + +  L  EL E  K              DQ + IY+ D+
Sbjct: 911 GYEIGEVYLYLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPEKIYIQDR 965

>YOR037W (CYC2) [4849] chr15 (401554..402654) Cytochrome c
           mitochondrial import factor, primarily involved in
           import of Cyc1p and also involved in import of Cyc7p
           [1101 bp, 366 aa]
          Length = 366

 Score = 32.3 bits (72), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 40/195 (20%), Positives = 75/195 (38%), Gaps = 36/195 (18%)

Query: 14  NTATADSAPTENIRPTGEANAFNRSTLIPVVFILA------LAIRYISMRRRIH--ANKA 65
           N   + S  T  +  +   ++F+++  I    +        L  RY S R   H  +   
Sbjct: 5   NYVLSSSRITRRLHKSPRKSSFSKNFFITGCLLTVGAVSSYLTYRYTSERENKHELSPSY 64

Query: 66  VLKKGTFHKFCLVSKTVLTHNTAIYN-----FGLPNADDVLGLPIGQHISIKENIDGKDI 120
            +K    HK  + S   L   T ++      + L  A+++  + I Q   +        +
Sbjct: 65  FVKYKISHKRDIDSSHFLLEVTPLFKQKVNIWSLMTAENLWSVEIKQPEVM--------V 116

Query: 121 MRSYTPTSLD--------------SETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCG 166
           +R+YTP  L                   G     +K Y NG +++++ +L  G  I + G
Sbjct: 117 VRNYTPLPLKFNPASKEIEILKDGDNADGKLSFYIKKYENGEVARWLHHLPKGHIIEIRG 176

Query: 167 PAGNYHYEPNCRNKL 181
           P  +Y + P+  N+L
Sbjct: 177 PFIDYEF-PHLPNEL 190

>YBR149W (ARA1) [334] chr2 (539943..540977) Subunit of
           NADP+-dependent D-arabinose dehydrogenase [1035 bp, 344
           aa]
          Length = 344

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 67  LKKGTFHKFCLVSKTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENIDGKDIMRSY 124
           L +    KFC +   +LT  + + + G PN    L +P+ + ++ K N+ G D++ SY
Sbjct: 221 LPQMELRKFCFMHDILLTAYSPLGSHGAPN----LKIPLVKKLAEKYNVTGNDLLISY 274

>YFR030W (MET10) [1710] chr6 (213300..216407) Assimilatory sulfite
           reductase subunit, flavin-binding (alpha) subunit, part
           of the sulfate assimilation pathway [3108 bp, 1035 aa]
          Length = 1035

 Score = 32.0 bits (71), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 59/152 (38%), Gaps = 27/152 (17%)

Query: 147 GNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPK- 205
           G  SK+I +L +G E+ V          P+ +  + M   GTG+AP   I++      + 
Sbjct: 851 GQASKYISDLAVGSELVVSVKPSVMKLPPSPKQPVIMSGLGTGLAPFKAIVEEKLWQKQQ 910

Query: 206 --DTTEVTLLYGNVQEADILLRKELDEMVK-----------MRPDQFKVIYLLDKTDRDD 252
             +  EV L  G+  + +  L  EL E  K              DQ + IY+ D+   + 
Sbjct: 911 GYEIGEVFLYLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPQKIYIQDRIKEN- 969

Query: 253 WEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGP 284
                    LD ++  M   K       LCGP
Sbjct: 970 ---------LDELKTAMIDNKG---SFYLCGP 989

>Kwal_55.21561
          Length = 349

 Score = 31.6 bits (70), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 45/115 (39%), Gaps = 38/115 (33%)

Query: 120 IMRSYTPTSLDSETKGSFELL-------------VKSYPNGNISKFIGNLNIGDEINVCG 166
           ++R+YTP  L     G F++L             +K Y  G +++++  L  G  + + G
Sbjct: 109 VVRNYTPLPLQHVGSGEFKVLADGDNGQGKLSFYLKKYQYGEVARWLSRLPEGHILELRG 168

Query: 167 PAGNYHYEPNCRN------------------------KLGMIAGGTGIAPMFQIM 197
           P  +Y + P+  N                         +     GTGIAP+ Q++
Sbjct: 169 PYIDYEF-PSMDNGEKLDRSFLWGAKPSSDKLMIQPFDISAFTAGTGIAPIMQLL 222

>Scas_565.5
          Length = 1047

 Score = 31.6 bits (70), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 59/152 (38%), Gaps = 27/152 (17%)

Query: 147  GNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNPK- 205
            G  SKFI +L +G E+ V          P+    + M   GTG+AP   I++      + 
Sbjct: 863  GQASKFISDLTVGSELVVSVKPSVMKLPPSPLQPVIMSGLGTGLAPFKAIVEEKLWQKQQ 922

Query: 206  --DTTEVTLLYGNVQEADILLRKELDEMVK-----------MRPDQFKVIYLLDKTDRDD 252
              +  EV L  G+  + +  L  EL E  K              DQ + IY+ D+     
Sbjct: 923  GYEIGEVYLYLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPQKIYIQDR----- 977

Query: 253  WEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGP 284
                I    +DL + ++    +      LCGP
Sbjct: 978  ----IKESLVDLKKAFI----DNNGSFYLCGP 1001

>ABR082W [673] [Homologous to ScYMR032W (HOF1) - SH]
           complement(537499..539550) [2052 bp, 683 aa]
          Length = 683

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 80  KTVLTHNTAIYNFGLPNADDVLGLPIGQHISIKENID 116
           + V+ +  AIY+F  PN +D+L   +G H+ + E ++
Sbjct: 620 RRVIGYARAIYSFTEPNDNDILYFEMGDHLLLTEKLN 656

>KLLA0C07579g complement(662466..664325) similar to sp|P40053
           Saccharomyces cerevisiae YER080w hypothetical protein
           singleton, start by similarity
          Length = 619

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 6/68 (8%)

Query: 89  IYNFGLPNADDVLGLPIGQHISIKENIDGKDIMRSYTPTSLDSETKGSFELLVKSYPNGN 148
           +Y+FG+ NA +    P+ Q   ++E I+G  +MRS+TP   D+E   S +  + +  N  
Sbjct: 202 VYSFGV-NALN----PVRQPFILEEYIEGTLLMRSWTPLENDAEDGKSHKDKLNAVINP- 255

Query: 149 ISKFIGNL 156
           ISKF   L
Sbjct: 256 ISKFQAKL 263

>CAGL0D05280g complement(504512..507604) similar to sp|P39692
           Saccharomyces cerevisiae YFR030w MET10, hypothetical
           start
          Length = 1030

 Score = 30.4 bits (67), Expect = 2.1,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 48/115 (41%), Gaps = 14/115 (12%)

Query: 147 GNISKFIGNLNIGDEINVCGPAGNYHYEPNCRNKLGMIAGGTGIAPMFQIMKAIYLNP-- 204
           G  SK+I  L++G E+ V          P+ +  + M   GTG+AP   I++        
Sbjct: 846 GQASKYISELSVGSELVVSVKPSVMKLPPSPKQPVIMSGLGTGLAPFKAIVEEKLWQKEQ 905

Query: 205 -KDTTEVTLLYGNVQEADILLRKELDEMVK-----------MRPDQFKVIYLLDK 247
            ++  EV L  G+  + +  L  EL E  K              DQ + IY+ D+
Sbjct: 906 GEEIGEVYLFLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPQKIYIQDR 960

>KLLA0E13860g 1219430..1222099 similar to sp|Q02207 Saccharomyces
           cerevisiae YKR009c FOX2
           hydratase-dehydrogenase-epimerase, peroxisomal
           singleton, start by similarity
          Length = 889

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 9/66 (13%)

Query: 129 LDSETKGSFELLVKSYPNGNISKFIGNLNIGDEINVCGPA---GNYHYEPNCRNKLGMIA 185
           +D    G+F+L   ++P+    KF      G  IN C PA   GN+        KLG++ 
Sbjct: 112 IDVHLNGAFKLTRAAWPHMRKQKF------GRIINTCSPAGLYGNFGQANYSAAKLGLLG 165

Query: 186 GGTGIA 191
            G  +A
Sbjct: 166 FGESLA 171

>Sklu_2216.5 YPR048W, Contig c2216 7954-9816 reverse complement
          Length = 620

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 6/49 (12%)

Query: 183 MIAGGTGIAPMFQIMKAIYLNPKDTTEVTLLYGN-VQEADILLRKELDE 230
           MI+ G G+APM  ++++ +       ++ L +GN ++  D L R++L++
Sbjct: 478 MISPGVGLAPMMSLIRSGFFE-----DMHLFFGNRIKSKDFLYREDLEK 521

>Kwal_23.5644
          Length = 689

 Score = 30.0 bits (66), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 57/145 (39%), Gaps = 30/145 (20%)

Query: 183 MIAGGTGIAPMFQIMKAIYLNPKDTTEVTL-----LYGNVQEADILLRKELDEMVKMRPD 237
           MI  GTG+AP    ++      +  + VTL      YG+  + D L ++E  E  K   D
Sbjct: 539 MIGPGTGVAPFRGFVRDRVKFVEQQSNVTLGKHILFYGSRDQNDYLYQEEWPEYSKKLGD 598

Query: 238 QFKVI------------YLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGPP 285
            F+++            Y+ DK    + E        DL+ K       +G  + +CG  
Sbjct: 599 AFEMVVAHSRLPGKPKCYVQDKLIEKEQE------IFDLITK-------KGAFIYVCGDA 645

Query: 286 RMVGSAKRNAVTMGYARGKPLSKME 310
           + +      A+    +RG  + + E
Sbjct: 646 KGMAQGVHAALVRILSRGNGIEESE 670

>KLLA0D06127g complement(526164..527156) similar to sgd|S0005772
           Saccharomyces cerevisiae YOR246c, start by similarity
          Length = 330

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 172 HYEPNCRNKLGMIAGGTGIAPMFQIMK------AIYLNPKDTTEVTLLYGNV-QEADILL 224
           +Y+P   NK+ ++ GG      + ++        +YL  ++++ V      + +EA+I L
Sbjct: 12  YYDPKVDNKVALVTGGNSGIGYYTVLHLYLHGFKVYLGGRNSSRVNHAIKEIKKEAEIRL 71

Query: 225 RKELDE 230
           RK  DE
Sbjct: 72  RKGQDE 77

>KLLA0D16753g 1418383..1419351 similar to sgd|S0004127 Saccharomyces
           cerevisiae YLR137w, start by similarity
          Length = 322

 Score = 28.5 bits (62), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 15/103 (14%)

Query: 187 GTGIAPMFQIMKAIYLNPKDTTEVTLLYGNVQEADILLR-----KELDEMVKMRPDQFKV 241
           GTG +PMF I+ + Y++          Y    + DIL R     +E     + R  +   
Sbjct: 141 GTGTSPMFPIVFSNYVDK---------YVATDQKDILPRLKDNIQENQSECRRRLLKSNT 191

Query: 242 IYLLDKTDRDDWEGEIGYVTLDLMEKYMPSPKEEGVQMLLCGP 284
           I L D   R + E +I    LD  E +  S K     +L CGP
Sbjct: 192 IALDDLKRRTELECQIDIALLD-WELFSGSKKSRNDPVLQCGP 233

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.137    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,515,188
Number of extensions: 466641
Number of successful extensions: 1196
Number of sequences better than 10.0: 47
Number of HSP's gapped: 1149
Number of HSP's successfully gapped: 47
Length of query: 316
Length of database: 16,596,109
Length adjustment: 102
Effective length of query: 214
Effective length of database: 13,065,073
Effective search space: 2795925622
Effective search space used: 2795925622
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)