Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.4231131110571e-145
CAGL0L00825g2651325095e-63
YIL044C (AGE2)2981255021e-61
Sklu_2260.42692274932e-60
Kwal_47.181722733114662e-56
KLLA0F27555g2792224428e-53
ADL084W2331214126e-49
ABL164C3601251932e-16
Kwal_33.131018731181943e-16
Scas_677.6357781914e-16
KLLA0D18942g357961897e-16
Kwal_23.4569370781862e-15
CAGL0G05445g354701809e-15
AFR725C8731161831e-14
Sklu_2267.4359781791e-14
Scas_685.258771111812e-14
CAGL0H01617g3491101737e-14
YDL226C (GCS1)352781738e-14
YDR524C (AGE1)4821231731e-13
Sklu_2181.34141281641e-12
YNL204C (SPS18)300971613e-12
Scas_707.333961281623e-12
AGL279C451761606e-12
ACL055W4711241606e-12
Kwal_27.10676466911581e-11
KLLA0E06787g515841581e-11
CAGL0G03707g486741518e-11
YGL181W (GTS1)3961241501e-10
YER122C (GLO3)4931181491e-10
Scas_672.9485711491e-10
Scas_602.104471271437e-10
Kwal_47.172483111281382e-09
CAGL0L06028g5051271358e-09
KLLA0C17138g3831371321e-08
AFL014C55780628.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.42
         (311 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.42                                                           411   e-145
CAGL0L00825g complement(102709..103506) similar to sp|P40529 Sac...   200   5e-63
YIL044C (AGE2) [2623] chr9 complement(272949..273845) GTPase-act...   197   1e-61
Sklu_2260.4 YIL044C, Contig c2260 5970-6779                           194   2e-60
Kwal_47.18172                                                         184   2e-56
KLLA0F27555g complement(2554571..2555410) some similarities with...   174   8e-53
ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH] complement(...   163   6e-49
ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C (S...    79   2e-16
Kwal_33.13101                                                          79   3e-16
Scas_677.6                                                             78   4e-16
KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces...    77   7e-16
Kwal_23.4569                                                           76   2e-15
CAGL0G05445g complement(514769..515833) similar to sp|P35197 Sac...    74   9e-15
AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH] (1771660..1...    75   1e-14
Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement         74   1e-14
Scas_685.25                                                            74   2e-14
CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces c...    71   7e-14
YDL226C (GCS1) [649] chr4 complement(51116..52174) GTPase-activa...    71   8e-14
YDR524C (AGE1) [1336] chr4 complement(1487530..1488978) ADP-ribo...    71   1e-13
Sklu_2181.3 YGL181W, Contig c2181 6465-7709                            68   1e-12
YNL204C (SPS18) [4399] chr14 complement(258374..259276) Sporulat...    67   3e-12
Scas_707.33                                                            67   3e-12
AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH] (182187..18...    66   6e-12
ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH] complement(2...    66   6e-12
Kwal_27.10676                                                          65   1e-11
KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces c...    65   1e-11
CAGL0G03707g complement(355469..356929) similar to sp|P38682 Sac...    63   8e-11
YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger...    62   1e-10
YER122C (GLO3) [1552] chr5 complement(402867..404348) GTPase-act...    62   1e-10
Scas_672.9                                                             62   1e-10
Scas_602.10                                                            60   7e-10
Kwal_47.17248                                                          58   2e-09
CAGL0L06028g complement(675584..677101) weakly similar to sp|P40...    57   8e-09
KLLA0C17138g 1497245..1498396 some similarities with sp|P40956 S...    55   1e-08
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    28   8.4  

>Scas_704.42
          Length = 311

 Score =  411 bits (1057), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 218/311 (70%), Positives = 218/311 (70%)

Query: 1   MSTSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITK 60
           MSTSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITK
Sbjct: 1   MSTSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITK 60

Query: 61  VKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYEL 120
           VKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYEL
Sbjct: 61  VKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYEL 120

Query: 121 KKWVGTPREVSEPPMSTTHEQVAKXXXXXXXXXXXXXXXXXDIGSAAKKSVXXXXXXXXX 180
           KKWVGTPREVSEPPMSTTHEQVAK                 DIGSAAKKSV         
Sbjct: 121 KKWVGTPREVSEPPMSTTHEQVAKLSLESTSNPNSNSSSLLDIGSAAKKSVSANTNLKST 180

Query: 181 XXXXXXXPSNSTEHVKKTHSHNERTDRVVTQRPDLKKSILSLYSKPXXXXXXXXXXXXXX 240
                  PSNSTEHVKKTHSHNERTDRVVTQRPDLKKSILSLYSKP              
Sbjct: 181 SLLNLATPSNSTEHVKKTHSHNERTDRVVTQRPDLKKSILSLYSKPSSNTNTNSSFFNNN 240

Query: 241 XXXXXXXXXXXXXXLPSNHSVPTFXXXXXXXXXXLAFXXXXXXXXXXXXXXXXXXXXXXL 300
                         LPSNHSVPTF          LAF                      L
Sbjct: 241 ANNNNIMSSASTSSLPSNHSVPTFSNNSNTTTSNLAFNNMSSSPSTSNNNQNNTNSNISL 300

Query: 301 EDNDLFKNVWT 311
           EDNDLFKNVWT
Sbjct: 301 EDNDLFKNVWT 311

>CAGL0L00825g complement(102709..103506) similar to sp|P40529
           Saccharomyces cerevisiae YIL044c AGE2, hypothetical
           start
          Length = 265

 Score =  200 bits (509), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 96/132 (72%), Positives = 109/132 (82%), Gaps = 4/132 (3%)

Query: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62
           TS  VKKALT LLRDPGN++CADCK QSHPRWASWSLGVF+CIKCAGVHRSLGTHI+KVK
Sbjct: 2   TSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICIKCAGVHRSLGTHISKVK 61

Query: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGIT---DTNKLQLFIRTKYE 119
           SVDLDTWKEEHL+ L++MRNNV ANR YEA LPDSS   NG +   D N LQ FIR KYE
Sbjct: 62  SVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKF-NGKSLGNDINLLQEFIRQKYE 120

Query: 120 LKKWVGTPREVS 131
            K+W+ +  ++S
Sbjct: 121 RKRWMDSSVDLS 132

 Score = 28.1 bits (61), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 13/14 (92%), Positives = 13/14 (92%)

Query: 211 QRPDLKKSILSLYS 224
           QR DLKKSILSLYS
Sbjct: 204 QRNDLKKSILSLYS 217

>YIL044C (AGE2) [2623] chr9 complement(272949..273845)
           GTPase-activating protein for Arf1p, has overlapping
           function with Gcs1p in transport from the trans-Golgi
           network (TGN), involved in endocytosis [897 bp, 298 aa]
          Length = 298

 Score =  197 bits (502), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 92/125 (73%), Positives = 104/125 (83%), Gaps = 1/125 (0%)

Query: 1   MSTSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITK 60
           MSTS  VKKAL+ALLRDPGNS+CADCK Q HPRWASWSLGVF+CIKCAG+HRSLGTHI+K
Sbjct: 1   MSTSVPVKKALSALLRDPGNSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISK 60

Query: 61  VKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYEL 120
           VKSVDLDTWKEEHL  LI+ +NN+ AN YYEA L D    +  ITDT+ LQ FI+ KYE 
Sbjct: 61  VKSVDLDTWKEEHLVKLIQFKNNLRANSYYEATLADELKQRK-ITDTSSLQNFIKNKYEY 119

Query: 121 KKWVG 125
           KKW+G
Sbjct: 120 KKWIG 124

 Score = 32.3 bits (72), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/16 (93%), Positives = 15/16 (93%)

Query: 211 QRPDLKKSILSLYSKP 226
           QR DLKKSILSLYSKP
Sbjct: 224 QRNDLKKSILSLYSKP 239

>Sklu_2260.4 YIL044C, Contig c2260 5970-6779
          Length = 269

 Score =  194 bits (493), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 130/227 (57%), Gaps = 18/227 (7%)

Query: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62
           +SP VKK L  LLRDP N+ CADCK+ SHPRW SWSLGVFVCIKCAG+HRSLGTHI+KVK
Sbjct: 2   SSPQVKKVLATLLRDPDNARCADCKVSSHPRWCSWSLGVFVCIKCAGIHRSLGTHISKVK 61

Query: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKK 122
           SVDLDTW+E+HL+ +I+  NN  AN YYEA L  S +      D +KLQ FIRTKYELKK
Sbjct: 62  SVDLDTWQEQHLQQVIRWGNNKRANLYYEAKLQGSHT-----PDPSKLQSFIRTKYELKK 116

Query: 123 WVGTPREVSEPPMSTTHEQVAKXXXXXXXXXXXXXXXXXDIGSAAKKSV---XXXXXXXX 179
           W G   EV    +S T    A                   I +     V           
Sbjct: 117 WCGEADEV----LSATETTTAPNPVAETAPPALVREFSTGIPATTAPPVTTSSTSSSCSS 172

Query: 180 XXXXXXXXPSNSTEHVKKTHSHNERTDRVVTQRPDLKKSILSLYSKP 226
                   P  S+   + TH+H+  T      RP+LKKSILSLY+KP
Sbjct: 173 SLLDLNLTPVASSTQQRVTHTHSYST------RPELKKSILSLYAKP 213

>Kwal_47.18172
          Length = 273

 Score =  184 bits (466), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 143/311 (45%), Gaps = 41/311 (13%)

Query: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62
           +SP+VKK L+ALLRDP N  CADCK   HPRWASWSLGVF+CI+CAG+HRSLGTHI+KVK
Sbjct: 2   SSPAVKKVLSALLRDPANGTCADCKTAGHPRWASWSLGVFICIRCAGIHRSLGTHISKVK 61

Query: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKK 122
           SVDLDTW+EEHL  +++  NN  AN  YE  L       N   D +KL  FIR+KYELKK
Sbjct: 62  SVDLDTWQEEHLRKVVEFGNNAAANAVYECKLSG-----NHTPDASKLSDFIRSKYELKK 116

Query: 123 WVGTPREVSEPPMSTTHEQV--AKXXXXXXXXXXXXXXXXXDIGSAAKKSVXXXXXXXXX 180
           W+G+    +  P S ++  V  +K                      ++ +          
Sbjct: 117 WLGSSANATT-PASGSNSVVTNSKPERTQEKTQVSQQTHNSQTSLLSQTTSVSIGSGSSS 175

Query: 181 XXXXXXXPSNSTEHVKKTHSHNERTDRVVTQRPDLKKSILSLYSKPXXXXXXXXXXXXXX 240
                  P  +      + +  E     +  RPDLKKSILSLYS+P              
Sbjct: 176 QVDLNLAPPRAPTRTTTSQAARE-----LNGRPDLKKSILSLYSRPRASATSVASGASNI 230

Query: 241 XXXXXXXXXXXXXXLPSNHSVPTFXXXXXXXXXXLAFXXXXXXXXXXXXXXXXXXXXXXL 300
                           +N SVP                                     L
Sbjct: 231 SLGSSTGNSSNSTP-GANFSVPA---------------------------GSNTTASASL 262

Query: 301 EDNDLFKNVWT 311
           EDN+LFKNVW+
Sbjct: 263 EDNELFKNVWS 273

>KLLA0F27555g complement(2554571..2555410) some similarities with
           sp|P40529 Saccharomyces cerevisiae YIL044c AGE2,
           hypothetical start
          Length = 279

 Score =  174 bits (442), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 102/222 (45%), Positives = 123/222 (55%), Gaps = 14/222 (6%)

Query: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62
           TS  VKK LT LLRDP N+ C DCK+ +HPRWASWSLGVFVCIKCAG HRS+GTHI+KVK
Sbjct: 2   TSVEVKKVLTTLLRDPENNRCGDCKVATHPRWASWSLGVFVCIKCAGFHRSMGTHISKVK 61

Query: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKK 122
           SVDLDTW EEHLE +++  NN + N YYE  L   +     + D +K+  FIRTKYELKK
Sbjct: 62  SVDLDTWTEEHLEAVLEFGNNKKFNEYYENKLGGGTY----VPDQSKIGQFIRTKYELKK 117

Query: 123 WVGTPREVSEPPMSTTHEQVAKXXXXXXXXXXXXXXXXXDIGSAAKKSVXXXXXXXXXXX 182
           WVG    V     S+ H   AK                     + +              
Sbjct: 118 WVGDDPIVDV--KSSKHTAEAKDRVAQKAAAVRNSPSS----DSPRSLDLDLGLNLNSVV 171

Query: 183 XXXXXPSNSTEHVKKTHSHNERTDRVVTQRPDLKKSILSLYS 224
                P  S+E    T+++  R       RPDLKKSILSLY+
Sbjct: 172 TDKNVPQISSEKPSATNTNVYRP----PDRPDLKKSILSLYA 209

>ADL084W [1657] [Homologous to ScYIL044C (AGE2) - SH]
           complement(536243..536944) [702 bp, 233 aa]
          Length = 233

 Score =  163 bits (412), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 72/121 (59%), Positives = 91/121 (75%), Gaps = 4/121 (3%)

Query: 3   TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62
           TS  V++ L  LLRDP N  CADCK  +HPRWASWSLGVFVCI+CAG HRSLGTH++KVK
Sbjct: 2   TSVEVRRVLEQLLRDPCNQQCADCKNSAHPRWASWSLGVFVCIRCAGFHRSLGTHVSKVK 61

Query: 63  SVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKK 122
           SVDLDTWKEEHL+ +++  NN +AN+ +E  L   S     + D +K+  FI+TKYE++K
Sbjct: 62  SVDLDTWKEEHLQQVVRFGNNQQANKVFEGRLGGGSY----VPDQSKMGQFIKTKYEVRK 117

Query: 123 W 123
           W
Sbjct: 118 W 118

 Score = 33.1 bits (74), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%)

Query: 212 RPDLKKSILSLYSKP 226
           RPDLKKSILSLY+KP
Sbjct: 178 RPDLKKSILSLYAKP 192

 Score = 29.6 bits (65), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 300 LEDNDLFKNVWT 311
           LEDN+LFKNVWT
Sbjct: 222 LEDNELFKNVWT 233

>ABL164C [428] [Homologous to ScYDL226C (GCS1) - SH; ScYNL204C
           (SPS18) - SH] (91566..92648) [1083 bp, 360 aa]
          Length = 360

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 67/125 (53%), Gaps = 9/125 (7%)

Query: 5   PSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSV 64
           P  ++ L  L +  GN  CADC    +P+WAS   G+F+C++CAG+HR LG HI+ V+S+
Sbjct: 8   PDNRRRLLQLQKLGGNKKCADCGA-PNPQWASPKFGIFICLECAGIHRGLGVHISFVRSI 66

Query: 65  DLDTWKEEHLEMLIKMRNNVEANRYY-----EANLPDSSSLKNGITDTNKLQLFIRTKYE 119
            +D +K E LE + +   N + + Y      +  LP  +   N +  + K +L      E
Sbjct: 67  TMDQFKPEELERM-EHGGNAQFHEYLAKHGVDQKLPQKAKYDNPVAASYKEKLTCVC--E 123

Query: 120 LKKWV 124
            K WV
Sbjct: 124 GKDWV 128

>Kwal_33.13101
          Length = 873

 Score = 79.3 bits (194), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 67/118 (56%), Gaps = 5/118 (4%)

Query: 17  DPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSVDLDTWKEEHLEM 76
           D  N+ C DC   +   W S +L   +CI+C+ VHRSLG+HI+KV+S+ LD++    ++ 
Sbjct: 575 DASNTTCCDCGDSNQVEWISINLLCVLCIQCSAVHRSLGSHISKVRSLLLDSFTSREIKE 634

Query: 77  LIKMRNNVEANRYYEANLPDSSSL-KNGITDTNKLQLFIRTKYELKKWVGTPREVSEP 133
           L+K  +N   N  YEA L   S +  + + D  +   FI  KY  KK+V +P +  EP
Sbjct: 635 LLKYVSNKNLNSIYEAELTQKSIIPGSSVADRTR---FITDKYVSKKYV-SPLQEDEP 688

>Scas_677.6
          Length = 357

 Score = 78.2 bits (191), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 48/78 (61%), Gaps = 1/78 (1%)

Query: 5  PSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSV 64
          P  ++ L  L +   N  C DC    +P+WAS   GVF+C++CAG HRSLG HI+ V+S+
Sbjct: 8  PDTRRRLLQLQKIGANKKCVDCHA-PNPQWASPKFGVFICLECAGTHRSLGVHISFVRSI 66

Query: 65 DLDTWKEEHLEMLIKMRN 82
           +D +K E LE + K  N
Sbjct: 67 TMDQFKPEELERMEKGGN 84

>KLLA0D18942g 1594560..1595633 similar to sp|P35197 Saccharomyces
          cerevisiae YDL226c GCS1 ADP-ribosylation factor
          GTPase-activating protein (ARF-GAP), start by
          similarity
          Length = 357

 Score = 77.4 bits (189), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 57/96 (59%), Gaps = 6/96 (6%)

Query: 5  PSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSV 64
          P  ++ L  L +  GN  C DC    +P+WAS   GVF+C++CAG+HR LG HI+ V+S+
Sbjct: 8  PDNRRRLLQLQKVGGNKKCLDCGAH-NPQWASPKFGVFICLECAGIHRGLGVHISFVRSI 66

Query: 65 DLDTWKEEHLEMLIKMRN--NVEANRYYEANLPDSS 98
           +D +K +    L++M N  N +   Y E +  DSS
Sbjct: 67 TMDQFKSDE---LVRMENGGNDKFTEYLEDHGIDSS 99

>Kwal_23.4569
          Length = 370

 Score = 76.3 bits (186), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 49/78 (62%), Gaps = 1/78 (1%)

Query: 5  PSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSV 64
          P  ++ L  L +   N  C DC+   +P+WAS   G+F+C++CAG+HR LG HI+ V+S+
Sbjct: 9  PDNRRRLLQLQKVGSNKKCVDCEA-PNPQWASPKFGIFICLECAGLHRGLGVHISFVRSI 67

Query: 65 DLDTWKEEHLEMLIKMRN 82
           +D +K E LE + K  N
Sbjct: 68 TMDQFKPEELERMEKGGN 85

>CAGL0G05445g complement(514769..515833) similar to sp|P35197
          Saccharomyces cerevisiae YDL226c GCS1 ADP-ribosylation
          factor GTPase-activating protein, start by similarity
          Length = 354

 Score = 73.9 bits (180), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 1/70 (1%)

Query: 5  PSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSV 64
          P  ++ L  L +   N  C DC    +P+WAS   G+F+C++CAG HRSLG HI+ V+S+
Sbjct: 8  PDNRRRLLQLQKIGANKKCVDCGA-PNPQWASPKFGIFICLECAGTHRSLGVHISFVRSI 66

Query: 65 DLDTWKEEHL 74
           +D +K+E L
Sbjct: 67 TMDQFKQEEL 76

>AFR725C [3918] [Homologous to ScYDR524C (AGE1) - SH]
           (1771660..1774281) [2622 bp, 873 aa]
          Length = 873

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 3/116 (2%)

Query: 17  DPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSVDLDTWKEEHLEM 76
           DP NS C DC+      W S ++   VCI C+GVHRSLG H++K++S+ LD++       
Sbjct: 559 DPSNSACCDCRSDKQVEWISLNILCVVCINCSGVHRSLGAHVSKMRSLTLDSFSSPESLQ 618

Query: 77  LIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKKWVGTPREVSE 132
           L+K  +N   N  YE+        +N I   ++ + +I  KY  KK+V    ++S+
Sbjct: 619 LLKCVSNQNVNSLYESEDLPPIFPENSI---DQRKSYITDKYVSKKYVNRTEDISK 671

>Sklu_2267.4 YDL226C, Contig c2267 4691-5770 reverse complement
          Length = 359

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 1/78 (1%)

Query: 5  PSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSV 64
          P  ++ L  L +   N  C DC    +P+WAS   G+F+C++CAG+HR LG HI+ V+S+
Sbjct: 9  PDNRRRLLQLQKIGSNKKCIDCNA-PNPQWASPKFGIFICLECAGIHRGLGVHISFVRSI 67

Query: 65 DLDTWKEEHLEMLIKMRN 82
           +D +K E L  + K  N
Sbjct: 68 TMDQFKPEELARMEKGGN 85

>Scas_685.25
          Length = 877

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 18  PGNSNCADCKLQSHP-RWASWSLGVFVCIKCAGVHRSLGTHITKVKSVDLDTWKEEHLEM 76
           P N  C DC        W S +L   VCIKC+GVHRS+G HI+K++S+ LD +  + +  
Sbjct: 590 PSNQRCCDCNTSDGTVEWISLNLLCLVCIKCSGVHRSMGAHISKIRSLTLDNFTSKEMIY 649

Query: 77  LIK-MRNNVEANRYYEANLPDSSS-LKNGITDTNKLQLFIRTKYELKKWVG 125
           LIK   +N + N  YE+   ++ + + +  TD+ + Q +I  KY  KK++ 
Sbjct: 650 LIKNYISNEKVNSIYESGTNNTQTRISSNATDSRRSQ-YINDKYRFKKFIN 699

>CAGL0H01617g 157279..158328 similar to tr|Q04412 Saccharomyces
           cerevisiae YDR524c AGE1, hypothetical start
          Length = 349

 Score = 71.2 bits (173), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 60/110 (54%), Gaps = 3/110 (2%)

Query: 17  DPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSVDLDTW--KEEHL 74
           D  N  C DC  + +  W S +L   VCI+C+GVHRSLG+HI+KV+S+++D      E  
Sbjct: 18  DESNKRCCDCGSRHNVDWVSINLLCVVCIQCSGVHRSLGSHISKVRSLNMDDLHSNRELK 77

Query: 75  EMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKYELKKWV 124
            +L+    N   N  YEA +P    ++      ++ + +I  KY  KK+V
Sbjct: 78  YLLVNHLINRNVNSVYEARIPAGIKIRKDAQPADRAR-YIVDKYMHKKYV 126

>YDL226C (GCS1) [649] chr4 complement(51116..52174)
          GTPase-activating protein (GAP) for ADP-ribosylation
          factors Arf1p and Arf2p, involved in endocytosis,
          exocytosis, secretion, and mitochondrial and vacuolar
          organization, member of the Gcs1p/Glo3p/Sps18p family
          [1059 bp, 352 aa]
          Length = 352

 Score = 71.2 bits (173), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 5  PSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSV 64
          P  ++ L  L +   N  C DC    +P+WA+   G F+C++CAG+HR LG HI+ V+S+
Sbjct: 8  PDTRRRLLQLQKIGANKKCMDCGA-PNPQWATPKFGAFICLECAGIHRGLGVHISFVRSI 66

Query: 65 DLDTWKEEHLEMLIKMRN 82
           +D +K E L  + K  N
Sbjct: 67 TMDQFKPEELLRMEKGGN 84

>YDR524C (AGE1) [1336] chr4 complement(1487530..1488978)
           ADP-ribosylation factor (ARF) GTPase activating protein
           (GAP) with effector functions, involved in endocytosis
           and protein secretion [1449 bp, 482 aa]
          Length = 482

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 69/123 (56%), Gaps = 4/123 (3%)

Query: 6   SVKKALTALLR--DPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKS 63
           S +  L +++R  D  N  C DC   +   W S +L   +CIKC+GVHRSLG+HI+K++S
Sbjct: 167 SNRDELLSIVRKIDKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRS 226

Query: 64  VDLDTWKE-EHLEMLIKMRNNVEANRYYEANLPDSSSLK-NGITDTNKLQLFIRTKYELK 121
           + LD +   E + +L    +N   N  YE+NL +    K    +D ++   FI  KY+ K
Sbjct: 227 LTLDNFTSLELMHLLQNNVSNSNVNAIYESNLRNFPVKKITANSDDSERSKFIIDKYQFK 286

Query: 122 KWV 124
           K+V
Sbjct: 287 KFV 289

>Sklu_2181.3 YGL181W, Contig c2181 6465-7709
          Length = 414

 Score = 67.8 bits (164), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 68/128 (53%), Gaps = 13/128 (10%)

Query: 4   SPSVKKALTALLRDPGNSN-CADCKLQSHPRWASWSLGVFVCIKCAGVHRS-LGTHI--- 58
           S +V+K L  L+  P N N C +C    +P W S +LGVF+C +CA VHR  LG      
Sbjct: 6   SKAVEKELKDLVNLPENGNRCGECG-APYPTWCSVNLGVFLCGRCASVHRKVLGNRDDDA 64

Query: 59  -TKVKSVDLDTWKEEHLEMLIKMRNNVEANRYYEA--NLPDSSSLKNGITDTNKLQLFIR 115
            + VKS+ LD WKE  L+ +    NN   NR  ++  N  D     +G  D + ++ FIR
Sbjct: 65  HSDVKSLTLDRWKESDLDCV----NNGGGNRRNKSVWNPKDHPFPFDGDDDKSAVEKFIR 120

Query: 116 TKYELKKW 123
            KY L K+
Sbjct: 121 DKYILGKF 128

>YNL204C (SPS18) [4399] chr14 complement(258374..259276)
           Sporulation-specific zinc finger protein involved in
           activation of sporulation, member of Gcs1p/Glo3p/Sps18p
           family of zinc-finger proteins [903 bp, 300 aa]
          Length = 300

 Score = 66.6 bits (161), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 57/97 (58%), Gaps = 6/97 (6%)

Query: 8   KKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSVDLD 67
           +K L    +  GN+NC +CK   +P++ S S G+F+C+ CA + R +GT+I  VKS+ +D
Sbjct: 13  RKRLLRAKKAAGNNNCFECK-SVNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSITMD 71

Query: 68  TWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGI 104
            ++E+ +  + K  NN      + + L  +  L+NGI
Sbjct: 72  NFEEKDVRRVEKSGNN-----RFGSFLSKNGILQNGI 103

>Scas_707.33
          Length = 396

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 70/128 (54%), Gaps = 9/128 (7%)

Query: 2   STSPSVKKALTALLRDPGNSN-CADCKLQSHPRWASWSLGVFVCIKCAGVHRSL--GTH- 57
           S +P+++  L  LL  P N+N C +C   + P W S +LGVF+C +CA VHR +  G   
Sbjct: 16  SRNPNIENELRDLLNAPENANKCGECG-STFPTWCSINLGVFLCGRCASVHRKILNGRED 74

Query: 58  --ITKVKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIR 115
              + +KS+ LD W  + +++L ++  N   ++++  N        +G  D + ++ FIR
Sbjct: 75  DVFSNLKSLSLDKWNNDDMDILAELGGNKGNHKFW--NPKHEPFPFDGDDDKSIVEHFIR 132

Query: 116 TKYELKKW 123
            KY L K+
Sbjct: 133 DKYILGKF 140

>AGL279C [4033] [Homologous to ScYER122C (GLO3) - SH]
          (182187..183542) [1356 bp, 451 aa]
          Length = 451

 Score = 66.2 bits (160), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 18 PGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSVDLDTWKEEHLEML 77
          P N  C DC    +P W S   G+ +CI+C+G HR LG HIT VKS +LD W   +L   
Sbjct: 26 PENRTCFDCG-NKNPTWTSVPFGIMLCIQCSGEHRKLGVHITFVKSSNLDKWTINNLRRF 84

Query: 78 IKMRNNVEANRYYEAN 93
           KM  N  A  ++  N
Sbjct: 85 -KMGGNHRAREFFLKN 99

>ACL055W [994] [Homologous to ScYGL181W (GTS1) - SH]
           complement(267925..269340) [1416 bp, 471 aa]
          Length = 471

 Score = 66.2 bits (160), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 69/124 (55%), Gaps = 13/124 (10%)

Query: 3   TSPSVKKALTALLRDPGNSN-CADCKLQSHPRWASWSLGVFVCIKCAGVHRSL-----GT 56
           +S +V++ L AL+  P N+N C +C   ++P W S +LG F+C +CA VHR +     G 
Sbjct: 5   SSRTVERELKALVSSPENANRCGECGA-TYPTWCSVNLGAFLCGRCAAVHRKVLTGEQGG 63

Query: 57  HITKVKSVDLDTWKEEHLEMLIKMRNNVEANR--YYEANLPDSSSLKNGITDTNKLQLFI 114
             + VKS+ LD W  + LE +     N   NR  ++  N+ + +   +G  D ++++ FI
Sbjct: 64  PESHVKSLTLDRWTVDELEEIT----NSGGNRRNHHTWNVRNVAFPYDGDDDRSRVEDFI 119

Query: 115 RTKY 118
           R KY
Sbjct: 120 RNKY 123

>Kwal_27.10676
          Length = 466

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 3  TSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVK 62
          T     K    L     N  C DC  + +P W S   GV +CI+C+ VHR+LG HIT VK
Sbjct: 11 TKEETTKVFQKLASKQDNRACFDCGTK-NPTWTSVPFGVMLCIQCSAVHRNLGVHITFVK 69

Query: 63 SVDLDTWKEEHLEMLIKMRNNVEANRYYEAN 93
          S +LD W   +L    K+  N +A  ++  N
Sbjct: 70 SSNLDKWTVNNLRRF-KLGGNHKAREFFMKN 99

>KLLA0E06787g 618131..619678 similar to sp|P38682 Saccharomyces
          cerevisiae YER122c GLO3 zinc finger protein, start by
          similarity
          Length = 515

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 45/84 (53%), Gaps = 2/84 (2%)

Query: 7  VKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSVDL 66
          V K    L     N  C DC  + +P W S   GV +CI C+G HR++GTHIT VKS +L
Sbjct: 17 VTKVFARLTTKSENRACFDCGAK-NPTWTSVPFGVLLCIDCSGEHRNMGTHITFVKSSNL 75

Query: 67 DTWKEEHLEMLIKMRNNVEANRYY 90
          D W   +L    K+  N +A  ++
Sbjct: 76 DKWTVNNLRRF-KLGGNDKAKDFF 98

>CAGL0G03707g complement(355469..356929) similar to sp|P38682
          Saccharomyces cerevisiae YER122c GLO3, hypothetical
          start
          Length = 486

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 40/74 (54%), Gaps = 2/74 (2%)

Query: 20 NSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSVDLDTWKEEHLEMLIK 79
          N  C DC    +P W S   GV +CI+C+ VHR+LG HIT VKS  LD W   +L    K
Sbjct: 26 NRVCFDCG-NKNPTWTSVPFGVLLCIQCSAVHRNLGVHITFVKSSTLDKWTVNNLRRF-K 83

Query: 80 MRNNVEANRYYEAN 93
             N +A  Y+  N
Sbjct: 84 YGGNHKAKEYFMKN 97

>YGL181W (GTS1) [1810] chr7 (157910..159100) Putative zinc-finger
           transcription factor of the Gcs1p/Glo3p/Sps18p family,
           involved in heat resistance, flocculation, timing of bud
           emergence, and regulation of biological rhythms [1191
           bp, 396 aa]
          Length = 396

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (51%), Gaps = 11/124 (8%)

Query: 7   VKKALTALLRDPGNSN-CADCKLQSHPRWASWSLGVFVCIKCAGVHRS-LGTH----ITK 60
           V + L  L+    N+N C +C    +P W S +LGVF+C +CA VHR   G+      + 
Sbjct: 13  VDRELKELINSSENANKCGECG-NFYPTWCSVNLGVFLCGRCASVHRKVFGSRDDDAFSN 71

Query: 61  VKSVDLDTWKEEHLEMLIKMRNNVEANRYYE-ANLPDSSSLKNGITDTNKLQLFIRTKYE 119
           VKS+ +D W  E ++ L+ +  N    R++   N+P      +G  D   ++ +IR KY 
Sbjct: 72  VKSLSMDRWTREDIDELVSLGGNKGNARFWNPKNVP---FPFDGDDDKAIVEHYIRDKYI 128

Query: 120 LKKW 123
           L K+
Sbjct: 129 LGKF 132

>YER122C (GLO3) [1552] chr5 complement(402867..404348)
           GTPase-activating protein (GAP) for ADP-ribosylation
           factors Arf1p and Arf2p, involved in retrograde
           transport between Golgi and ER as well as endocytosis
           [1482 bp, 493 aa]
          Length = 493

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 56/118 (47%), Gaps = 10/118 (8%)

Query: 1   MSTSPSVKKALTALLRDPGNSNCADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITK 60
            +T  + ++    L  +  N  C DC    +P W S   GV +CI+C+ VHR++G HIT 
Sbjct: 9   FATEQTTQQVFQKLGSNMENRVCFDCG-NKNPTWTSVPFGVMLCIQCSAVHRNMGVHITF 67

Query: 61  VKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRTKY 118
           VKS  LD W   +L    K+  N +A  ++  N        NG    N   +  +TKY
Sbjct: 68  VKSSTLDKWTINNLRRF-KLGGNHKARDFFLKN--------NGKQLLNTANVDAKTKY 116

>Scas_672.9
          Length = 485

 Score = 62.0 bits (149), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 23 CADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTHITKVKSVDLDTWKEEHLEMLIKMRN 82
          C DC    +P W S   GV +CI+C+ VHR+LG HIT VKS  LD W   +L    K+  
Sbjct: 31 CFDCG-NKNPTWTSVPFGVMLCIQCSAVHRNLGVHITFVKSSTLDKWTINYLRRF-KLGG 88

Query: 83 NVEANRYYEAN 93
          N +A  ++  N
Sbjct: 89 NNKARDFFLKN 99

>Scas_602.10
          Length = 447

 Score = 59.7 bits (143), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 61/127 (48%), Gaps = 12/127 (9%)

Query: 1   MSTSPSVKKALTALLRDPGNSN-CADCKLQSHPRWASWSLGVFVCIKCAGVHRSLGTH-- 57
            + S S ++ L   L    N N C +C L  +P W S +  +F+C +CA VH+ +  H  
Sbjct: 2   FTVSDSYQRELNRFLDSSENHNKCGECGL-PNPTWCSTTYNLFLCTRCATVHKKILNHDP 60

Query: 58  -ITKVKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRT 116
            ++ +KS+ LD W  + L   I    N    R++     +   +KN   D    + F+R 
Sbjct: 61  DLSIIKSIKLDYWTNDELNKFINSGGNAYNKRFW-----NPKDIKN--FDDANWENFLRD 113

Query: 117 KYELKKW 123
           KY LKK+
Sbjct: 114 KYILKKF 120

>Kwal_47.17248
          Length = 311

 Score = 57.8 bits (138), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (51%), Gaps = 13/128 (10%)

Query: 4   SPSVKKALTALLRDPGNSN-CADCKLQSHPRWASWSLGVFVCIKCAGVHRS-LGTH---- 57
           S + ++ L  +L  P N N C +C   + P W S +LGVF+C +CA VHR+ LG      
Sbjct: 7   SKAAERELKNILNSPENGNKCGECG-NTFPTWCSINLGVFLCGRCASVHRNILGNRDDEI 65

Query: 58  ITKVKSVDLDTWKEEHLEMLIKMRNNVEANR--YYEANLPDSSSLKNGITDTNKLQLFIR 115
            + V+S+ +D W    L+ + +   N   NR  +   N+P      +G  D + ++ F+R
Sbjct: 66  YSDVRSLTMDRWSTRDLDEIAESGGN-RRNRMLWNPQNVPFPF---DGDEDKSAVEQFVR 121

Query: 116 TKYELKKW 123
            KY L K+
Sbjct: 122 EKYVLCKF 129

>CAGL0L06028g complement(675584..677101) weakly similar to sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1, start by
           similarity
          Length = 505

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 12/127 (9%)

Query: 6   SVKKALTALLRDPGNSN-CADCKLQSHPRWASWSLGVFVCIKCAGVHRS-LGTH------ 57
           ++   L  ++  P N N C +C   + P W S +LGVF+C +CA VHR  LGT       
Sbjct: 15  NIDGELKDIVNAPENGNRCGECG-SAVPTWCSTNLGVFLCGRCASVHRKILGTDPDEESG 73

Query: 58  -ITKVKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIRT 116
             + VKS+ ++ W+ E ++ +     N    R +  N  +     +G  D + ++ F+R 
Sbjct: 74  IFSNVKSLSMERWEAEDIDSVASSGGNKGNMRKW--NPKNEPFPFDGDEDKSAVERFVRE 131

Query: 117 KYELKKW 123
           KY + K+
Sbjct: 132 KYIIGKY 138

>KLLA0C17138g 1497245..1498396 some similarities with sp|P40956
           Saccharomyces cerevisiae YGL181w GTS1 transcription
           factor of the GCS1P/GLO3P/SPS18P family singleton,
           hypothetical start
          Length = 383

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 67/137 (48%), Gaps = 9/137 (6%)

Query: 2   STSPSVKKALTALLRDPGNSN-CADCKLQSHPRWASWSLGVFVCIKCAGVHRS-LGTH-- 57
           S   SV+  L  LL    NSN C +C     P + S +LGVF+C +CA VHR  LG+   
Sbjct: 4   SRGESVEHDLKFLLNAGENSNKCGECGT-PFPTYCSVNLGVFLCGRCASVHRKVLGSRED 62

Query: 58  --ITKVKSVDLDTWKEEHLEMLIKMRNNVEANRYYEANLPDSSSLKNGITDTNKLQLFIR 115
              + VKS+ LD W +  ++ +  +  N   + ++  N        +G  D   +++FIR
Sbjct: 63  GATSIVKSLSLDRWSKRDVQTVADLGGNKHNSSFW--NPKKEPFPFDGDEDRTAVEMFIR 120

Query: 116 TKYELKKWVGTPREVSE 132
            KY   K+  T  +V +
Sbjct: 121 DKYLKGKFRHTAVKVED 137

>AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH]
           (409496..411169) [1674 bp, 557 aa]
          Length = 557

 Score = 28.5 bits (62), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 37/80 (46%), Gaps = 9/80 (11%)

Query: 13  ALLRDPGNSNCADCKLQSHPRWASWSLGVFVC-------IKCAGVHRS-LGTHITKVKSV 64
           ++ +D GN+   D +  SH R    SLGV +C       + C G     +  +  +VK  
Sbjct: 279 SIGKDDGNTEIWDVETMSHVRTMRSSLGVRICSQDWLDTVVCIGAKSGEIQVNDVRVKDH 338

Query: 65  DLDTWKEEHLEML-IKMRNN 83
            + TW++   E+  IK R +
Sbjct: 339 IVSTWEKHTSEVCGIKFRQD 358

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.313    0.127    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 7,342,558
Number of extensions: 237389
Number of successful extensions: 564
Number of sequences better than 10.0: 38
Number of HSP's gapped: 545
Number of HSP's successfully gapped: 45
Length of query: 311
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 210
Effective length of database: 13,099,691
Effective search space: 2750935110
Effective search space used: 2750935110
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 61 (28.1 bits)