Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.4158258222170.0
CAGL0J02904g5431934684e-51
YER054C (GIP2)5481884431e-47
Scas_715.465701804342e-46
YIL045W (PIG2)5381573805e-39
Sklu_2260.63991683472e-35
CAGL0L00803g8271733483e-34
ADL083C3541432894e-28
Kwal_23.57644621642784e-26
KLLA0F27533g4981141693e-12
YOR178C (GAC1)793941024e-04
Scas_526.4915151930.004
YLR273C (PIG1)64856850.031
Kwal_56.2326242976830.047
CAGL0H04037g91556810.11
AGR275C67956800.13
Kwal_47.17085211379750.63
Scas_659.2159456721.2
Scas_521.157956702.2
CAGL0F04917g68296692.4
KLLA0F14443g89553666.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.41
         (582 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.41                                                           858   0.0  
CAGL0J02904g complement(279516..281147) similar to sp|P40036 Sac...   184   4e-51
YER054C (GIP2) [1483] chr5 complement(262051..263697) Glc7p-inte...   175   1e-47
Scas_715.46                                                           171   2e-46
YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interac...   150   5e-39
Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement       138   2e-35
CAGL0L00803g 98548..101031 some similarities with sp|P40036 Sacc...   138   3e-34
ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C (...   115   4e-28
Kwal_23.5764                                                          111   4e-26
KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036 Saccha...    70   3e-12
YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulator...    44   4e-04
Scas_526.4                                                             40   0.004
YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein t...    37   0.031
Kwal_56.23262                                                          37   0.047
CAGL0H04037g complement(379169..381916) weakly similar to sp|P28...    36   0.11 
AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C (...    35   0.13 
Kwal_47.17085                                                          33   0.63 
Scas_659.21                                                            32   1.2  
Scas_521.1                                                             32   2.2  
CAGL0F04917g complement(499132..501180) weakly similar to sp|P28...    31   2.4  
KLLA0F14443g complement(1338526..1341213) weakly similar to sp|P...    30   6.1  

>Scas_704.41
          Length = 582

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/582 (76%), Positives = 446/582 (76%)

Query: 1   MYINGNHLNKDATTLTASHFPSYXXXXXXXXXXXXXXXXXXXXXXXXXIPHWENFHINTI 60
           MYINGNHLNKDATTLTASHFPSY                         IPHWENFHINTI
Sbjct: 1   MYINGNHLNKDATTLTASHFPSYSFNNNKSNSNSNNDTKTKKQNDNDDIPHWENFHINTI 60

Query: 61  PPSKGNNANTIDTSPKNTMHKRIFPANDTLGSSTKPFSSLNFLQEPRKLDQLKLNALPQE 120
           PPSKGNNANTIDTSPKNTMHKRIFPANDTLGSSTKPFSSLNFLQEPRKLDQLKLNALPQE
Sbjct: 61  PPSKGNNANTIDTSPKNTMHKRIFPANDTLGSSTKPFSSLNFLQEPRKLDQLKLNALPQE 120

Query: 121 ELRRXXXXXXXXXXXXXXXXXXXXXXSYYLNDNDTDAFKEEQENEDEISPITQVPANAKI 180
           ELRR                      SYYLNDNDTDAFKEEQENEDEISPITQVPANAKI
Sbjct: 121 ELRRNTNLNKNINPIPTPIKPTIYKNSYYLNDNDTDAFKEEQENEDEISPITQVPANAKI 180

Query: 181 PFPVPNNAYMEVNRIKPVYKKSGELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDR 240
           PFPVPNNAYMEVNRIKPVYKKSGELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDR
Sbjct: 181 PFPVPNNAYMEVNRIKPVYKKSGELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDR 240

Query: 241 AHHLARSKSVHFANTLPVRFFSKDESPIIVAESHEITNELNFKHKPLQRSXXXXXXXXXX 300
           AHHLARSKSVHFANTLPVRFFSKDESPIIVAESHEITNELNFKHKPLQRS          
Sbjct: 241 AHHLARSKSVHFANTLPVRFFSKDESPIIVAESHEITNELNFKHKPLQRSMDMDELEELE 300

Query: 301 XXXXIAARXXXXXXXXXXXGSXXXXXXXXXXXXGIFSLGLDKLILKDRSSSIAXXXXXXX 360
               IAAR           GS            GIFSLGLDKLILKDRSSSIA       
Sbjct: 301 TDEDIAARKKKTLKKLLNLGSDDEDDDDDDEDDGIFSLGLDKLILKDRSSSIARRGGGGG 360

Query: 361 XXNIETQMEXXXXXXXXXXXXXXXXXXXLERGMGGFVTFNNTTTLTSEKSVIGLYSKNFP 420
             NIETQME                   LERGMGGFVTFNNTTTLTSEKSVIGLYSKNFP
Sbjct: 361 RRNIETQMEKFNKKNEDDDDDNNILDKDLERGMGGFVTFNNTTTLTSEKSVIGLYSKNFP 420

Query: 421 TLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYIXXXXXXXXXXXKYIIGRALVEN 480
           TLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYI           KYIIGRALVEN
Sbjct: 421 TLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYINNHVGNNNKQNKYIIGRALVEN 480

Query: 481 IYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLIDDVNKSVSKCHLEF 540
           IYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLIDDVNKSVSKCHLEF
Sbjct: 481 IYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLIDDVNKSVSKCHLEF 540

Query: 541 CIQYQTRNEKERKEFWXXXXXXXXXXXXXTEVFRNPFENTII 582
           CIQYQTRNEKERKEFW             TEVFRNPFENTII
Sbjct: 541 CIQYQTRNEKERKEFWDNNDDKNYKVDVVTEVFRNPFENTII 582

>CAGL0J02904g complement(279516..281147) similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2, hypothetical
           start
          Length = 543

 Score =  184 bits (468), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 86/193 (44%), Positives = 124/193 (64%), Gaps = 6/193 (3%)

Query: 395 GFVTFNNTTTLTSEKSVIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQ 454
           G   FN + +   ++ V+GLY++NFP L+NKNP+SLKLNIF+N S+GK+VFLQ+L+LHI 
Sbjct: 350 GGSMFNGSYSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEVFLQELSLHIH 409

Query: 455 NDYI-----XXXXXXXXXXXKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSD 509
            +                  + + GR LV+NI+FDK+V+++YTWD WR+ +D+E ++VS 
Sbjct: 410 RERAFYSPGSGVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRNVQDVEGVWVSS 469

Query: 510 AKQIIP-GSNMDVFKFLIDDVNKSVSKCHLEFCIQYQTRNEKERKEFWXXXXXXXXXXXX 568
           A+ ++P G+ MDVF F+IDD  K   K  LEFCIQY TR++ +R EFW            
Sbjct: 470 AQGLVPGGAAMDVFHFVIDDATKWEGKASLEFCIQYTTRDDTQRLEFWDNNCGKNYCVDL 529

Query: 569 XTEVFRNPFENTI 581
             + FRNPF N +
Sbjct: 530 VMDGFRNPFANAL 542

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 90/191 (47%), Gaps = 23/191 (12%)

Query: 90  LGSSTKPFSSLNFLQEPRKLDQLKLNALPQEELRRXXXXXXXXXXXXXXXXXXXXXXSYY 149
           +G S K  +SL FL +P+++ QL  +  P+EEL R                       Y 
Sbjct: 34  VGGSGK-LTSLQFLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYR------EYS 86

Query: 150 LNDNDTDAFKEEQENEDEISPITQVPANAKIPFPVPNNAYMEVNRIK-------PVYKKS 202
               D  A  E Q+  D++ P++      ++   + +N     N          PVYKKS
Sbjct: 87  QGPGDGGA-SERQQARDDLIPLSPKSTLPELDTNMLDNTLDSDNSSNDLAPFSPPVYKKS 145

Query: 203 GELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHFANTLPVRFFS 262
           GE +K  LKRRS+SLP TP         +N   +G    + L RSKSVHF  T PVR+F+
Sbjct: 146 GEPVKSVLKRRSKSLPGTPG--------LNTSMHGASPPNKLMRSKSVHFDQTAPVRYFN 197

Query: 263 KDESPIIVAES 273
           ++E PI V+ +
Sbjct: 198 ENERPIDVSNA 208

>YER054C (GIP2) [1483] chr5 complement(262051..263697)
           Glc7p-interacting protein, possible regulatory subunit
           for the PP1 family protein phosphatase Glc7p [1647 bp,
           548 aa]
          Length = 548

 Score =  175 bits (443), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 84/188 (44%), Positives = 116/188 (61%), Gaps = 21/188 (11%)

Query: 411 VIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQ---------------- 454
           V+GLYSKNFP L+NKNP+SLKLNIF+N S+ KKVFLQ+L+L+I                 
Sbjct: 357 VVGLYSKNFPILSNKNPKSLKLNIFINLSQNKKVFLQELSLYIHRDNNYFSNSSSFYNIP 416

Query: 455 -----NDYIXXXXXXXXXXXKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSD 509
                ND             + I GR LV+NI++DK+VV++YTWD+WR+  ++E +Y+SD
Sbjct: 417 NSHNGNDCNGVAKGYNAGCTRLIAGRILVKNIFYDKRVVVRYTWDSWRTTHEVECVYISD 476

Query: 510 AKQIIPGSNMDVFKFLIDDVNKSVSKCHLEFCIQYQTRNEKERKEFWXXXXXXXXXXXXX 569
              I+PG+NMD+F F+IDDV+K   +  LEFCI Y TRN+ ER+E+W             
Sbjct: 477 GDGILPGTNMDIFHFIIDDVSKVDPRGKLEFCIHYSTRNDYEREEYWDNNNGNNYKVDVV 536

Query: 570 TEVFRNPF 577
            + F +PF
Sbjct: 537 MDGFNDPF 544

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/219 (34%), Positives = 107/219 (48%), Gaps = 31/219 (14%)

Query: 91  GSSTKPFSSLNFLQEPRKLDQLKLNALPQEELRRXXXXXXXXXXX------------XXX 138
           GS+ +  +SL FL +P+++ Q++ N  P+EE++R                          
Sbjct: 50  GSTEETLNSLKFLHKPQRVTQMRANRFPEEEVQRNTDLNKRIFSAGNDENVDNESGWSKI 109

Query: 139 XXXXXXXXSYYLNDNDTDAFKEEQENEDEISPITQVPANAKIPFPVPNNAYMEVNR---- 194
                      LN +    FK E      +SP + VP + +  +P   +   ++N     
Sbjct: 110 AAAKNHTSVESLNGSTRPPFKIELP---PLSPKSTVPKSFQAEYPEAKSPGNDMNFEYDE 166

Query: 195 ------IKPVYKKSGELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSK 248
                   PVYKKSGELLK SLKRRS+SLP TP I     R  NG     D +  L RSK
Sbjct: 167 EILIPFAPPVYKKSGELLKSSLKRRSKSLPTTPGI-----RSGNG-VQARDGSPMLIRSK 220

Query: 249 SVHFANTLPVRFFSKDESPIIVAESHEITNELNFKHKPL 287
           SVHF    PV++F++DESPI V ++ +  N L+FKHKP+
Sbjct: 221 SVHFDQAAPVKYFAEDESPINVNKTEQHDNCLSFKHKPV 259

>Scas_715.46
          Length = 570

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 111/180 (61%), Gaps = 13/180 (7%)

Query: 411 VIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQND-------------Y 457
           V+GLY+ NFP L+NKNP+SLKLNIF+  SK KK FLQ++ LHI+ +              
Sbjct: 388 VVGLYNINFPILSNKNPKSLKLNIFIKLSKDKKCFLQEVTLHIEKENPLKRLLPANGSNS 447

Query: 458 IXXXXXXXXXXXKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGS 517
                       + I G+ LV+NI++DK+V+++YTW++WR+  D+E I+VSD   I+PG+
Sbjct: 448 EFGQGSIIQRSTRLITGKILVKNIFYDKRVIVRYTWNDWRTVHDVECIWVSDGDGIVPGT 507

Query: 518 NMDVFKFLIDDVNKSVSKCHLEFCIQYQTRNEKERKEFWXXXXXXXXXXXXXTEVFRNPF 577
           NMDVF+FLIDD NK  ++  LEFCIQY  RN+ ER E+W                F NPF
Sbjct: 508 NMDVFRFLIDDANKLEARAKLEFCIQYTARNDTERLEYWDNNDGKNYKVGVIMNGFTNPF 567

 Score = 93.2 bits (230), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 103/210 (49%), Gaps = 35/210 (16%)

Query: 92  SSTKPFSSLNFLQEPRKLDQLKLNALPQEELRRXXXXXXXXXXXXXXXXXXXXXXSYYLN 151
           +S    +S++FL +P+++ Q+ ++  P+EE++R                      +  L 
Sbjct: 82  TSLNSLNSMDFLYKPQRVTQMNVDKFPEEEVKR----------------NTDLNKNIRLV 125

Query: 152 DNDTDAFKEEQENEDEISPIT--QVPANAKIPFP--VPNNAYME--------VNRIKPVY 199
            + + A  EE+   + +SPI   ++   + I     + NN   E        +  + P+Y
Sbjct: 126 TSGSVAKDEEETGREYMSPIDLPEISPRSTIQSSEFIQNNKTQEGVDERYDGITPLSPIY 185

Query: 200 KKSGELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHFANTLPVR 259
           KKSGELLK SLKRRS+SLP T  I   +LR  N        A  + RSKSVHF    PV+
Sbjct: 186 KKSGELLKSSLKRRSKSLPSTSEILQKSLRFEND-------AMEMVRSKSVHFDQKAPVK 238

Query: 260 FFSKDESPIIVAESHEITNELNFKHKPLQR 289
           +F +DESP  V    E  N LN  HKP+ R
Sbjct: 239 YFREDESPSTVNMMAEFDNLLNLMHKPVNR 268

>YIL045W (PIG2) [2622] chr9 (271160..272776) Protein that interacts
           with Gsy2p, possible regulatory subunit for the
           PP1-family protein phosphatase Glc7p [1617 bp, 538 aa]
          Length = 538

 Score =  150 bits (380), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 72/157 (45%), Positives = 105/157 (66%), Gaps = 17/157 (10%)

Query: 405 LTSEKSVIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYIXXXXXX 464
           + + K ++GLY+KNFP L+++N +SLKLNIF+N S+G+ VFLQ++ L             
Sbjct: 353 IGNSKRIVGLYNKNFPILSDRNRKSLKLNIFLNLSRGRPVFLQEITL------------L 400

Query: 465 XXXXXKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKF 524
                  IIG+  V+NIYFDKK++++YTWD WR++ + E +Y S+A  I+PGSNMD+FKF
Sbjct: 401 TGFHNMVIIGKVFVKNIYFDKKIIVRYTWDAWRTFHESECVYFSNANGILPGSNMDIFKF 460

Query: 525 LIDDV----NKSVSKCHLEFCIQYQTRN-EKERKEFW 556
            IDD+    +K  +   LEFCIQY T   ++ RKE+W
Sbjct: 461 SIDDIHNPNDKDSNISQLEFCIQYLTWGVDRSRKEYW 497

 Score = 99.4 bits (246), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 101/202 (50%), Gaps = 24/202 (11%)

Query: 97  FSSLNFLQEPRKLDQLKLNALPQEELRRXXXXXXXXXXXXXXXXXXX----XXXSYYLND 152
            +SL FL +PR+L  +KL+ LPQ+EL+R                          ++  + 
Sbjct: 50  LNSLEFLHKPRRLSNVKLHRLPQDELQRNTDMNKGMYFNGKQVHAHHPFINSGANFNAHH 109

Query: 153 NDTDAFKEEQENEDEISPITQVPANAKIPFPVPNNAYMEVNRIKPVYKKSGELLKPSLKR 212
            D     EE   EDEISP++         +    N     N   P+YKKSGEL+K SLKR
Sbjct: 110 QDVSKLGEE---EDEISPLSH----DNFQYESEENG----NPSPPIYKKSGELVKSSLKR 158

Query: 213 RSQSLPVTP----NISNLNLRRIN-GHANGNDRAHHLARSKSVHFANTLPVRFFSKDESP 267
           RS+SLP+TP    N +    + +N  H +       L RSKSVHF   LP++ F+++E P
Sbjct: 159 RSKSLPITPKSIFNKTGSKSKHVNLDHVD----TRLLQRSKSVHFDRVLPIKLFNENEKP 214

Query: 268 IIVAESHEITNELNFKHKPLQR 289
           I V +     + LNFKHKPL R
Sbjct: 215 IDVGKQMVQQDVLNFKHKPLTR 236

>Sklu_2260.6 YIL045W, Contig c2260 9086-10285 reverse complement
          Length = 399

 Score =  138 bits (347), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 103/168 (61%), Gaps = 28/168 (16%)

Query: 402 TTTLTSEKSVIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYIXXX 461
           T + +S   V GLY+KNFP L+NKNP SLKLNIF+N + GK+VFLQDL+L    +Y+   
Sbjct: 219 TASGSSMPPVPGLYNKNFPILSNKNPTSLKLNIFLNIAHGKQVFLQDLSLLGDGNYV--- 275

Query: 462 XXXXXXXXKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDV 521
                      +G+ LV+NI +DK+V+++YTWD W +  D++ ++ S    ++PG NMD+
Sbjct: 276 -----------VGKVLVKNICYDKQVIVRYTWDQWNTTHDVQCVWFSSGDIVLPGMNMDM 324

Query: 522 FKFLID-------------DVNKSVSKCHLEFCIQYQTRNEKERKEFW 556
           FKF++D             D +K   +  ++FCI+Y TR+   R+E W
Sbjct: 325 FKFVVDVPVDSAEATLATTDPDKEGGR-EVQFCIRYTTRDGNYREEHW 371

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 52/96 (54%), Gaps = 12/96 (12%)

Query: 196 KPVYKKSGELLKPSLKR--RSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHF- 252
           KP+ KKSGEL+K SLK+  RS+SLP TP         I              RSKSVHF 
Sbjct: 93  KPIRKKSGELVKSSLKQHHRSKSLPATPTGREPRTEII--------IMEPPKRSKSVHFD 144

Query: 253 -ANTLPVRFFSKDESPIIVAESHEITNELNFKHKPL 287
             + + V++F KDE P+ VA+     ++L+F  K L
Sbjct: 145 QRDVVSVKYFQKDERPVEVAQREVEEDQLSFTPKQL 180

>CAGL0L00803g 98548..101031 some similarities with sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 or sp|P40187
           Saccharomyces cerevisiae YIL045w PIG2, hypothetical
           start
          Length = 827

 Score =  138 bits (348), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 103/173 (59%), Gaps = 18/173 (10%)

Query: 402 TTTLTSEKSVIGLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQ----NDY 457
           ++T   E+ +  L SKNFPTL +K  +SLKLNIF+N +  KKV LQ+++L++Q    N Y
Sbjct: 642 SSTSKKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDKKVLLQEVSLNVQKRKSNYY 701

Query: 458 --------IXXXXXXXXXXXKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSD 509
                   I             I G  LV+NIYFDKKV ++YTWD+WRS  ++E++YV  
Sbjct: 702 NSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVSIRYTWDHWRSCNEVESMYVGS 761

Query: 510 AKQIIPGSNMDVFKFLIDDVNKSVSKC------HLEFCIQYQTRNEKERKEFW 556
               +PGS MD+F+F+ID+   S  +        LEFCIQY TR+   R+E+W
Sbjct: 762 GNNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRELEFCIQYTTRSNTAREEYW 814

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 65/94 (69%), Gaps = 2/94 (2%)

Query: 197 PVYKKSGELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHFANTL 256
           PVYKKSGEL+K SLKRRS+SLPVTPN SN   +   G    N R   L RSKSVHF   L
Sbjct: 452 PVYKKSGELVKSSLKRRSKSLPVTPN-SNRRTQNSRGVRMNNPR-DQLIRSKSVHFDQRL 509

Query: 257 PVRFFSKDESPIIVAESHEITNELNFKHKPLQRS 290
           PV++F K+ESP +V+   E  + L+F+HKPL RS
Sbjct: 510 PVKYFFKEESPSVVSIRDEEDDVLSFQHKPLVRS 543

>ADL083C [1658] [Homologous to ScYIL045W (PIG2) - SH; ScYER054C
           (GIP2) - SH] (537421..538485) [1065 bp, 354 aa]
          Length = 354

 Score =  115 bits (289), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 82/143 (57%), Gaps = 15/143 (10%)

Query: 414 LYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYIXXXXXXXXXXXKYII 473
           L + NFP L NK+P  L LNIF+N +  +KVFLQDL+L                    + 
Sbjct: 214 LRNVNFPILANKDPAVLTLNIFLNIAYNRKVFLQDLSLD---------------SMLVMT 258

Query: 474 GRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLIDDVNKSV 533
           GR LV+NI++DK V+++YTWDNW    D  ++++S    ++PG +MD+F+F ID      
Sbjct: 259 GRVLVKNIHYDKSVIVRYTWDNWAHTSDTASVWISSGNAVLPGKDMDLFEFAIDVPAPVS 318

Query: 534 SKCHLEFCIQYQTRNEKERKEFW 556
               LEFCI+YQ R+  + +  W
Sbjct: 319 GTPRLEFCIRYQVRDNSDFQTHW 341

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 15/75 (20%)

Query: 212 RRSQSLPVTPNISNLNLRRINGHANGNDRAHHLARSKSVHFAN--TLPVRFFSKDESPII 269
           +RS SLP TP  +   L+R  G          + RSKSVHF N   + V++F+ DES ++
Sbjct: 105 QRSNSLPGTPTSA---LKRPGG----------VRRSKSVHFDNRDVVSVKYFNSDESTLL 151

Query: 270 VAESHEITNELNFKH 284
           VA +    ++L  + 
Sbjct: 152 VAHAQSFEDQLRLRQ 166

>Kwal_23.5764
          Length = 462

 Score =  111 bits (278), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 90/164 (54%), Gaps = 34/164 (20%)

Query: 413 GLYSKNFPTLNNKNPRSLKLNIFVNYSKGKKVFLQDLNLHIQNDYIXXXXXXXXXXXKYI 472
           GLY  NF TL + +  SLK NIF+N +     FLQ+L+L I + +             Y+
Sbjct: 284 GLYHANFATLADDDQCSLKSNIFLNIAHNSSCFLQELSL-IGDQH-------------YL 329

Query: 473 IGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLID----- 527
           +G  LV+N+Y++K V+++YT D+WR+ RDIE ++ S    ++PG +MD FK +ID     
Sbjct: 330 VGHVLVKNVYYEKTVLVRYTRDSWRTSRDIECVWASSGDDVLPGMHMDRFKLVIDLAGLQ 389

Query: 528 --DVNKSVSKCH-------------LEFCIQYQTRNEKERKEFW 556
             D ++  +  H             L+FCIQY +R+   R E+W
Sbjct: 390 EGDTSRDSTPSHDSAGHACQLSTVRLQFCIQYVSRDANSRVEYW 433

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 59/105 (56%), Gaps = 11/105 (10%)

Query: 182 FPVPNNAYMEVNRIKP-VYKKSGELLKPSLK--RRSQSLPVTPNISNLNLRRINGHANGN 238
           FP   ++ +      P V KKSGE+++PSLK  +RS+SLP TP+    + +R+ G     
Sbjct: 109 FPAEEDSVVADAAAPPLVRKKSGEVVRPSLKMAQRSRSLPATPSDREPD-KRLGGPPAAG 167

Query: 239 DRAHHLARSKSVHF--ANTLPVRFFSKDESPIIVAESHEITNELN 281
            +     RSKSVHF   + +  ++F +++SP+ VAE   +   L+
Sbjct: 168 PK-----RSKSVHFDQRDVVKFKYFWQEDSPLDVAEQDVLEGPLD 207

>KLLA0F27533g 2549457..2550953 weakly similar to sp|P40036
           Saccharomyces cerevisiae YER054c GIP2 GLC7P-interacting
           protein, hypothetical start
          Length = 498

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 64/114 (56%), Gaps = 18/114 (15%)

Query: 446 LQDLNLHIQNDYIXXXXXXXXXXXKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAI 505
           LQDL L  Q                 +IG  +V NI ++K+V+++YT D+W+S +D+E++
Sbjct: 385 LQDLRLDTQG--------------HMLIGNVIVRNISYEKRVIVRYTLDSWKSQQDVESV 430

Query: 506 YVSDAKQIIPGS---NMDVFKFLIDDVNKSVSKCHLEFCIQYQTRNEKERKEFW 556
           ++++   +  G+   ++DVF+F I D+ K  +  H+E CI YQTR      + W
Sbjct: 431 WITNHCNLKSGTGAIDIDVFQFAI-DLGKINTIEHIEMCILYQTREGSSWIDHW 483

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 16/88 (18%)

Query: 185 PNNAYMEVNRIKPVYKKSGELLKPSLKRRSQSLPVTPNISNLNLRRINGHANGNDRAHHL 244
           P + Y++  ++  ++     LL      RS+SLP +P         + G  +   R    
Sbjct: 147 PEDRYLDSRKLSAIFNPPSILLT-----RSKSLPTSP---------LEGRVSQEQRPPVF 192

Query: 245 ARSKSVHFANT--LPVRFFSKDESPIIV 270
            RSKSVHFA +    V++F +DESP+ +
Sbjct: 193 KRSKSVHFAQSEKFEVKYFREDESPLFL 220

>YOR178C (GAC1) [4975] chr15 complement(667860..670241) Regulatory
           subunit for protein serine/threonine phosphatase Glc7p
           [2382 bp, 793 aa]
          Length = 793

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 21/94 (22%)

Query: 472 IIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLID---- 527
           I G   V+N+ F+K + +K+T+++W   RDI  +  +  + I   SN+D FKF ID    
Sbjct: 258 ITGLVYVKNLSFEKYLEIKFTFNSW---RDIHYVTANFNRTI--NSNVDEFKFTIDLNSL 312

Query: 528 ----------DVNKSVSKC--HLEFCIQYQTRNE 549
                      + K+ S C  ++E C +Y   NE
Sbjct: 313 KYILLIKRIITMEKNTSSCPLNIELCCRYDVNNE 346

>Scas_526.4
          Length = 915

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 70/151 (46%), Gaps = 34/151 (22%)

Query: 414 LYSKNFPTLNNKNPR-SLKLNIFVNYSKGKKVFLQDLNLHIQNDYIXXXXXXXXXXXKYI 472
           L S N  T ++ N + SL++++F N+ +G+ + L  LN    N                +
Sbjct: 263 LKSSNISTFHDTNKKNSLEVSLF-NFLQGQNIRLHSLNQDSNN-------------SSKL 308

Query: 473 IGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLID----- 527
           IG   V N+ F+K + +K+++++W   +DI  +     K +   SN+D FKF+ID     
Sbjct: 309 IGLIYVNNLNFEKFIEIKFSFNHW---KDIHYVTAFLNKSVT--SNIDEFKFVIDLNSLK 363

Query: 528 ---DVNKSVSK------CHLEFCIQYQTRNE 549
               V   +S        ++E C +Y   NE
Sbjct: 364 FFLQVKNLLSSKLPKNNLNMELCCRYDVNNE 394

>YLR273C (PIG1) [3666] chr12 complement(689085..691031) Protein that
           interacts with Gsy2p, possible regulatory subunit for
           the PP1 family protein phosphatase Glc7p [1947 bp, 648
           aa]
          Length = 648

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 472 IIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLID 527
           I G   V N+ F+KK+ +K+T +NW     I A Y    K + P  ++D FKF+ID
Sbjct: 224 IWGLIFVNNLNFEKKIEIKFTLNNWADIHYINAHY---NKSVTP--HVDEFKFIID 274

>Kwal_56.23262
          Length = 429

 Score = 36.6 bits (83), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 452 HIQNDYIXXXXXXXXXXXKYIIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAK 511
           H+Q   I           K + G   V N+ F+K + +K+T++NW   RD+  +     +
Sbjct: 16  HLQGHNIKLNRISACLDSKKLQGLIYVANLNFEKSLEIKFTFNNW---RDVHYVAAHHHR 72

Query: 512 QIIPGSNMDVFKFLID 527
            I     +D FKF ID
Sbjct: 73  SITDA--IDEFKFTID 86

>CAGL0H04037g complement(379169..381916) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 915

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 5/56 (8%)

Query: 472 IIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLID 527
           I+G+ LV+N+ ++K + +KYT++NW    DI  I     K I   + +D F+F I+
Sbjct: 298 IVGKILVKNLNYEKFIEVKYTFNNW---NDIHYITAYFTKSI--SAEIDEFEFKIN 348

>AGR275C [4586] [Homologous to ScYOR178C (GAC1) - SH; ScYLR273C
           (PIG1) - SH] (1254768..1256807) [2040 bp, 679 aa]
          Length = 679

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 5/56 (8%)

Query: 472 IIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLID 527
           I G   V N++F+K + +K+++D W++   + A Y+         S +D F+F+ID
Sbjct: 286 IKGSLYVTNLHFEKFIEVKFSFDEWKNIHYVTAQYLKTVT-----SKVDEFQFIID 336

>Kwal_47.17085
          Length = 2113

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 9/79 (11%)

Query: 166  DEISPIT-QVPANAKIPFPVPNNAYME--VNRIKP-VYKKSGELLKPSLKRRSQSLPVTP 221
            D +S  T Q+    KI    P+NA ++  V R+K  VY K G+L +P L R  +S  V  
Sbjct: 1369 DTVSSTTEQLLQKQKILICAPSNAAVDELVIRLKSGVYDKEGQLFQPKLVRVGRSDAVNS 1428

Query: 222  NISNLNL-----RRINGHA 235
             I +L L     +++NG +
Sbjct: 1429 AIKDLTLEEQVDKKLNGKS 1447

>Scas_659.21
          Length = 594

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 472 IIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLID 527
           ++G  LV NI F+K + +K+T++NW +    +  Y + +  +      D FKF ID
Sbjct: 223 LVGLILVNNIQFEKNIEVKFTFNNWENIC-YQVAYFNRSLNV----KFDEFKFTID 273

>Scas_521.1
          Length = 579

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 472 IIGRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLID 527
           ++G  LV NI F+K + +K+T++NW +    +  Y + +      +  D FKF ID
Sbjct: 205 LVGLILVNNIQFEKNIEVKFTFNNWENIC-YQVAYFNRSLN----AKFDEFKFTID 255

>CAGL0F04917g complement(499132..501180) weakly similar to sp|P28006
           Saccharomyces cerevisiae YOR178c GAC1 ser/thr
           phosphoprotein phosphatase 1, hypothetical start
          Length = 682

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 42/96 (43%), Gaps = 25/96 (26%)

Query: 474 GRALVENIYFDKKVVLKYTWDNWRSYRDIEAIYVSDAKQIIPGSNMDVFKFLIDDV---- 529
           G   V N+ F+K + +K++++NW   +DI     +  K I    ++D F+F ID +    
Sbjct: 194 GLIYVNNLNFEKFIEVKFSFNNW---KDIHYATATYNKSIT--DHIDEFRFTIDVMTFKY 248

Query: 530 --------------NKSVSKCHL--EFCIQYQTRNE 549
                         N+  + C L  + C +Y   NE
Sbjct: 249 ILKSKGLIYCDSYSNEDCTYCDLSMDLCCRYDVNNE 284

>KLLA0F14443g complement(1338526..1341213) weakly similar to
           sp|P36117 Saccharomyces cerevisiae YKR021w, start by
           similarity
          Length = 895

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 34/53 (64%), Gaps = 5/53 (9%)

Query: 488 VLKYTWDNWRSYRDIEAI---YVSDAKQIIPGSNMDVFKFLIDDVNKSVSKCH 537
           V+K+TW  ++S  D++++     ++   ++ GSN  +F+ L DD++K +++ H
Sbjct: 109 VVKHTWPFFQS--DLQSVPNNQSTEPADLLKGSNASLFRPLHDDMDKPMARRH 159

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,958,893
Number of extensions: 643066
Number of successful extensions: 2255
Number of sequences better than 10.0: 34
Number of HSP's gapped: 2273
Number of HSP's successfully gapped: 44
Length of query: 582
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 475
Effective length of database: 12,891,983
Effective search space: 6123691925
Effective search space used: 6123691925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)