Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.4060860830940.0
YIL046W (MET30)64059423590.0
CAGL0L00781g67363821800.0
Kwal_23.576962759720590.0
ADL082C56957819540.0
KLLA0F27511g62363918670.0
CAGL0L02629g7953963121e-29
YFL009W (CDC4)7794913022e-28
YCR072C5153592982e-28
Scas_707.227303442881e-26
Kwal_23.50357443692853e-26
Kwal_23.63245143412672e-24
AGL024W7563452683e-24
Sklu_2173.25153712628e-24
KLLA0D07546g6473932649e-24
AER263C5133212592e-23
Scas_720.955153422583e-23
KLLA0C08547g5153652548e-23
Scas_721.115*3181892461e-22
ACR137W4252732492e-22
Scas_592.4*3181892442e-22
YMR116C (ASC1)3191832372e-21
AFR199C3341722363e-21
CAGL0J03476g5173362396e-21
AEL246C8152952417e-21
KLLA0E23529g8262972401e-20
YJL112W (MDV1)7142992391e-20
Kwal_26.87764332142323e-20
CAGL0G04345g7112372345e-20
YBR198C (TAF5)7982992302e-19
Sklu_2420.24412722243e-19
Scas_721.328221922273e-19
KLLA0F11231g4342982216e-19
KLLA0E12287g3261982178e-19
YGL137W (SEC27)8892912249e-19
AEL314W7152722231e-18
CAGL0H08932g9022882231e-18
Scas_630.66212522221e-18
CAGL0M05335g8061792212e-18
Scas_711.116953382166e-18
CAGL0H03729g3032942097e-18
KLLA0F04884g12122392151e-17
Kwal_27.126677213282141e-17
Sklu_2431.127491732141e-17
CAGL0I03718g12012392151e-17
YDL145C (COP1)12012392151e-17
CAGL0D02090g2771792042e-17
Scas_603.55892752103e-17
KLLA0F10263g6822102113e-17
Kwal_27.120537551852104e-17
Scas_624.1112052392114e-17
Kwal_56.2452612102392105e-17
YPL151C (PRP46)4512902075e-17
YKR036C (CAF4)6592712078e-17
Kwal_23.64297501552071e-16
AFL118W8322832061e-16
AGL234W6291722051e-16
Kwal_26.75702181491941e-16
ADR077C12042392052e-16
CAGL0M02277g4272672003e-16
KLLA0B01958g8902832025e-16
Scas_695.153273061955e-16
Scas_629.126714671997e-16
KLLA0D04840g3032941883e-15
YCR084C (TUP1)7131991925e-15
CAGL0E00561g8361771901e-14
YNL006W (LST8)3032901841e-14
CAGL0C03608g6433011881e-14
Kwal_0.2123032991822e-14
CAGL0C02937g4672131862e-14
YCR057C (PWP2)9231611855e-14
KLLA0F21406g7052041836e-14
AAL009C3032941778e-14
Sklu_2442.23032991761e-13
Scas_713.509832481812e-13
AAR057W9221601802e-13
CAGL0C00737g8162091783e-13
CAGL0K09284g9111601774e-13
Sklu_2160.37601571774e-13
CAGL0L10890g4573701754e-13
AEL269C4551691736e-13
YLR129W (DIP2)9432931741e-12
Scas_720.83d9151601731e-12
CAGL0M04279g9403671731e-12
Scas_631.174741971692e-12
KLLA0C07425g4443521692e-12
CAGL0L03201g5792081693e-12
AGL196C9352811694e-12
Scas_558.37251651685e-12
AER448W7141751676e-12
Scas_679.288151151668e-12
CAGL0A02772g4411781631e-11
Kwal_33.155917141541641e-11
Sklu_2172.62631161572e-11
KLLA0D16390g9361211632e-11
Kwal_26.89754453181612e-11
YLR222C (UTP13)8171151622e-11
CAGL0K00275g7151551613e-11
Kwal_56.239209371151604e-11
YOR269W (PAC1)4943231585e-11
YKL213C (DOA1)7151661595e-11
KLLA0C08976g9112361595e-11
Kwal_23.62409131611587e-11
Kwal_27.115858231191589e-11
ADR176W4613151551e-10
AER337W4453531541e-10
AGR207C3202561521e-10
KLLA0E24508g3271611512e-10
Sklu_1880.34711791532e-10
YBR175W (SWD3)3151281493e-10
Scas_658.14421741505e-10
Scas_721.73251441477e-10
KLLA0E07942g3901311461e-09
Kwal_23.53514741241471e-09
YDR364C (CDC40)4551791461e-09
YKL021C (MAK11)4681561471e-09
KLLA0F13244g8141401471e-09
AER255C4671741452e-09
AGR180W8063201462e-09
ACR091W3281541413e-09
KLLA0E21263g4291841424e-09
YOR272W (YTM1)4603131425e-09
Kwal_56.241637291201435e-09
Scas_685.113841561406e-09
Scas_692.294563101407e-09
Kwal_33.151364733231407e-09
CAGL0M06193g3161911388e-09
KLLA0E07073g4521661408e-09
KLLA0B14410g7061901409e-09
CAGL0M08646g3371581389e-09
KLLA0E21879g3331591371e-08
YDR267C3301551361e-08
Kwal_27.122393161291362e-08
ADL184W4491661372e-08
Scas_720.457551241382e-08
Kwal_14.8843951571362e-08
CAGL0F06853g3881311362e-08
Scas_692.254882661362e-08
KLLA0E18986g9901321372e-08
Kwal_26.89534583081353e-08
YPR178W (PRP4)4652581353e-08
YLR429W (CRN1)6512081363e-08
Scas_717.68908821354e-08
Sklu_2318.17111631354e-08
KLLA0C07513g4393121335e-08
YNL317W (PFS2)4651491335e-08
Kwal_55.215593511741325e-08
Scas_585.84601721327e-08
Scas_719.526282201328e-08
YGL004C (RPN14)417901319e-08
Kwal_55.220674511541311e-07
CAGL0M04081g4551531311e-07
Sklu_1963.23141601291e-07
CAGL0G09845g5002861301e-07
KLLA0D02530g7071431311e-07
ACR166W3881311273e-07
Scas_659.94753191273e-07
Sklu_2416.54591541273e-07
KLLA0F16038g8621051274e-07
KLLA0E11297g5121771264e-07
KLLA0F22000g7931671264e-07
CAGL0J04818g6541881265e-07
AER114W6331851256e-07
CAGL0D05588g4773231247e-07
KLLA0A08866g423731221e-06
Sklu_2430.9966761231e-06
Kwal_26.7655743801231e-06
Scas_615.113491691211e-06
KLLA0F15598g4783221221e-06
AFL056C9761431221e-06
KLLA0E04741g4591641211e-06
CAGL0L02761g4192581212e-06
YMR102C8342201222e-06
Kwal_55.214505031801202e-06
Kwal_26.86284222631202e-06
YMR146C (TIF34)347661183e-06
CAGL0A00561g412741193e-06
CAGL0G03399g3691051183e-06
Kwal_33.154757831541193e-06
Scas_700.27*4331601174e-06
Scas_721.1288511791185e-06
YER066W1851261116e-06
ABL024W734671168e-06
ADL322C5011801158e-06
Kwal_27.11126996551151e-05
CAGL0J06512g5451811141e-05
Sklu_2364.45551831141e-05
CAGL0L06952g347661131e-05
YLL011W (SOF1)4891581141e-05
Kwal_47.175675901831141e-05
AFL009C4131111131e-05
CAGL0K03377g978781142e-05
YOR212W (STE4)4232581122e-05
AAL157C4792921122e-05
Sklu_2291.4997971132e-05
ACR017W4231771112e-05
Scas_465.41002721122e-05
AFL007C5511931112e-05
Kwal_47.175554171231103e-05
Scas_680.11347651103e-05
CAGL0A00605g6401611104e-05
Scas_718.6*5461661104e-05
KLLA0B12804g8522191104e-05
Scas_571.46011411086e-05
AGL301C3611311076e-05
Kwal_27.10785367981077e-05
Kwal_27.125865091841077e-05
Kwal_34.158183492631068e-05
Scas_660.7*6031101078e-05
Scas_512.3534571061e-04
Sklu_1659.2613901061e-04
Scas_397.2410881051e-04
YGL003C (CDH1)5661821061e-04
Sklu_2423.1944691061e-04
Sklu_1926.5509981032e-04
ACR097W467701032e-04
AGR168W8251281042e-04
Sklu_2406.114262611032e-04
Kwal_27.10385536911032e-04
Kwal_55.211445703241024e-04
YGR200C (ELP2)788931024e-04
Kwal_56.243993691971004e-04
CAGL0J10340g338165996e-04
Scas_705.25711471006e-04
CAGL0C01441g1005971006e-04
Sklu_1710.1240129976e-04
Scas_605.18424263997e-04
Sklu_675.130869987e-04
Scas_719.309402251007e-04
Sklu_2332.736796997e-04
YHR186C (KOG1)15571731008e-04
Kwal_14.1235607204998e-04
Kwal_26.7736507275988e-04
CAGL0K00957g793139999e-04
CAGL0K12188g53571980.001
YLR409C (UTP21)939214980.001
Scas_510.536296970.001
KLLA0A08822g582143970.001
AFL014C557191970.001
AER081C102361970.001
Scas_660.8510269970.001
CAGL0K05599g71070970.002
KLLA0D06787g436135960.002
Sklu_1870.2569206960.002
CAGL0D04884g563129950.002
KLLA0E20779g371126940.002
YBR103W (SIF2)53584950.002
Scas_702.16816100950.003
YPL183C101358950.003
CAGL0J01287g610107940.003
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.40
         (608 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.40                                                          1196   0.0  
YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that ...   913   0.0  
CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces cer...   844   0.0  
Kwal_23.5769                                                          797   0.0  
ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH] (538948..5...   757   0.0  
KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces...   723   0.0  
CAGL0L02629g complement(307323..309710) similar to sp|P07834 Sac...   124   1e-29
YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and co...   120   2e-28
YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein ...   119   2e-28
Scas_707.22                                                           115   1e-26
Kwal_23.5035                                                          114   3e-26
Kwal_23.6324                                                          107   2e-24
AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -...   107   3e-24
Sklu_2173.2 YCR072C, Contig c2173 2732-4279                           105   8e-24
KLLA0D07546g complement(647984..649927) some similarities with s...   106   9e-24
AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)...   104   2e-23
Scas_720.95                                                           103   3e-23
KLLA0C08547g 749737..751284 highly similar to sp|P25382 Saccharo...   102   8e-23
Scas_721.115*                                                          99   1e-22
ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH] complement...   100   2e-22
Scas_592.4*                                                            99   2e-22
YMR116C (ASC1) [4073] chr13 complement(499455..499877,500151..50...    96   2e-21
AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH] (799876..80...    96   3e-21
CAGL0J03476g 331933..333486 highly similar to sp|P25382 Saccharo...    97   6e-21
AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH] (172849..1...    97   7e-21
KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces...    97   1e-20
YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in...    97   1e-20
Kwal_26.8776                                                           94   3e-20
CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces c...    95   5e-20
YBR198C (TAF5) [381] chr2 complement(616084..618480) Component o...    93   2e-19
Sklu_2420.2 YPL151C, Contig c2420 3924-5249                            91   3e-19
Scas_721.32                                                            92   3e-19
KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417 S...    90   6e-19
KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to ...    88   8e-19
YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741) Coat...    91   9e-19
AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C (...    91   1e-18
CAGL0H08932g join(871668..871685,872089..874779) highly similar ...    91   1e-18
Scas_630.6                                                             90   1e-18
CAGL0M05335g complement(569132..571552) similar to sp|P38129 Sac...    90   2e-18
Scas_711.11                                                            88   6e-18
CAGL0H03729g 342948..343859 highly similar to sp|P41318 Saccharo...    85   7e-18
KLLA0F04884g complement(478044..481682) similar to sp|P53622 Sac...    87   1e-17
Kwal_27.12667                                                          87   1e-17
Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement      87   1e-17
CAGL0I03718g complement(317565..321170) highly similar to sp|P53...    87   1e-17
YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer (C...    87   1e-17
CAGL0D02090g join(214357..214893,215564..215860) highly similar ...    83   2e-17
Scas_603.5                                                             86   3e-17
KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA Kluy...    86   3e-17
Kwal_27.12053                                                          86   4e-17
Scas_624.11                                                            86   4e-17
Kwal_56.24526                                                          86   5e-17
YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative...    84   5e-17
YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein t...    84   8e-17
Kwal_23.6429                                                           84   1e-16
AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH] complement...    84   1e-16
AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH] complement(...    84   1e-16
Kwal_26.7570                                                           79   1e-16
ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH] (843171..84...    84   2e-16
CAGL0M02277g complement(271836..273119) highly similar to sp|Q12...    82   3e-16
KLLA0B01958g join(170646..170663,170896..173550) similar to sp|P...    82   5e-16
Scas_695.15                                                            80   5e-16
Scas_629.12                                                            81   7e-16
KLLA0D04840g 413362..414273 highly similar to sp|P41318 Saccharo...    77   3e-15
YCR084C (TUP1) [608] chr3 complement(260307..262448) General rep...    79   5e-15
CAGL0E00561g 49750..52260 some similarities with sp|P16649 Sacch...    78   1e-14
YNL006W (LST8) [4579] chr14 (620066..620977) Protein required fo...    75   1e-14
CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces c...    77   1e-14
Kwal_0.212                                                             75   2e-14
CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces c...    76   2e-14
YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential p...    76   5e-14
KLLA0F21406g complement(1996260..1998377) similar to sp|P47025 S...    75   6e-14
AAL009C [178] [Homologous to ScYNL006W (LST8) - SH] (325785..326...    73   8e-14
Sklu_2442.2 YNL006W, Contig c2442 3831-4742                            72   1e-13
Scas_713.50                                                            74   2e-13
AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH] complement(4...    74   2e-13
CAGL0C00737g complement(75028..77478) similar to tr|Q05946 Sacch...    73   3e-13
CAGL0K09284g 914937..917672 highly similar to sp|P25635 Saccharo...    73   4e-13
Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement         73   4e-13
CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024 Saccha...    72   4e-13
AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH] (134760..13...    71   6e-13
YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 sno...    72   1e-12
Scas_720.83d                                                           71   1e-12
CAGL0M04279g 469040..471862 highly similar to sp|Q12220 Saccharo...    71   1e-12
Scas_631.17                                                            70   2e-12
KLLA0C07425g complement(647673..649007) highly similar to sp|Q12...    70   2e-12
CAGL0L03201g complement(366795..368534) some similarities with s...    70   3e-12
AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH] (328838..33...    70   4e-12
Scas_558.3                                                             69   5e-12
AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH] complement(...    69   6e-12
Scas_679.28                                                            69   8e-12
CAGL0A02772g complement(289274..290599) similar to sp|P40968 Sac...    67   1e-11
Kwal_33.15591                                                          68   1e-11
Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement       65   2e-11
KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces...    67   2e-11
Kwal_26.8975                                                           67   2e-11
YLR222C (UTP13) [3622] chr12 complement(579320..581773) Componen...    67   2e-11
CAGL0K00275g complement(25300..27447) similar to sp|P36037 Sacch...    67   3e-11
Kwal_56.23920                                                          66   4e-11
YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in...    65   5e-11
YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein req...    66   5e-11
KLLA0C08976g 784536..787271 highly similar to sgd|S0000653 Sacch...    66   5e-11
Kwal_23.6240                                                           65   7e-11
Kwal_27.11585                                                          65   9e-11
ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH] complement(...    64   1e-10
AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH] complement(...    64   1e-10
AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH] (1146710..1...    63   1e-10
KLLA0E24508g complement(2175775..2176758) similar to sp|P38123 S...    63   2e-10
Sklu_1880.3 YDR364C, Contig c1880 4293-5708                            64   2e-10
YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and...    62   3e-10
Scas_658.1                                                             62   5e-10
Scas_721.7                                                             61   7e-10
KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces c...    61   1e-09
Kwal_23.5351                                                           61   1e-09
YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein...    61   1e-09
YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein ...    61   1e-09
KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomy...    61   1e-09
AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH] (1107932.....    60   2e-09
AGR180W [4491] [Homologous to ScYLR222C - SH] complement(1090647...    61   2e-09
ACR091W [1138] [Homologous to ScYDR267C - SH] complement(520609....    59   3e-09
KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces...    59   4e-09
YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associa...    59   5e-09
Kwal_56.24163                                                          60   5e-09
Scas_685.11                                                            59   6e-09
Scas_692.29                                                            59   7e-09
Kwal_33.15136                                                          59   7e-09
CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces c...    58   8e-09
KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces c...    59   8e-09
KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces...    59   9e-09
CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces c...    58   9e-09
KLLA0E21879g complement(1944865..1945866) similar to sgd|S000267...    57   1e-08
YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Prote...    57   1e-08
Kwal_27.12239                                                          57   2e-08
ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH] complement(...    57   2e-08
Scas_720.45                                                            58   2e-08
Kwal_14.884                                                            57   2e-08
CAGL0F06853g 671942..673108 highly similar to sp|P20484 Saccharo...    57   2e-08
Scas_692.25                                                            57   2e-08
KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomy...    57   2e-08
Kwal_26.8953                                                           57   3e-08
YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associa...    57   3e-08
YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-bind...    57   3e-08
Scas_717.68                                                            57   4e-08
Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement          57   4e-08
KLLA0C07513g complement(656060..657379) similar to sp|P39946 Sac...    56   5e-08
YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation facto...    56   5e-08
Kwal_55.21559                                                          55   5e-08
Scas_585.8                                                             55   7e-08
Scas_719.52                                                            55   8e-08
YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein c...    55   9e-08
Kwal_55.22067                                                          55   1e-07
CAGL0M04081g complement(450572..451939) highly similar to sp|P42...    55   1e-07
Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement         54   1e-07
CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces c...    55   1e-07
KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777....    55   1e-07
ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH] complement...    54   3e-07
Scas_659.9                                                             54   3e-07
Sklu_2416.5 YNL317W, Contig c2416 8692-10071                           54   3e-07
KLLA0F16038g complement(1487475..1490063) weakly similar to ca|C...    54   4e-07
KLLA0E11297g complement(994770..996308) similar to sp|P38262 Sac...    53   4e-07
KLLA0F22000g complement(2044973..2047354) similar to sp|P42935 S...    53   4e-07
CAGL0J04818g 455846..457810 highly similar to sp|Q06440 Saccharo...    53   5e-07
AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH] complement(...    53   6e-07
CAGL0D05588g 533235..534668 highly similar to sp|P33750 Saccharo...    52   7e-07
KLLA0A08866g 776960..778231 weakly similar to sp|P53196 Saccharo...    52   1e-06
Sklu_2430.9 YMR102C, Contig c2430 15497-18397                          52   1e-06
Kwal_26.7655                                                           52   1e-06
Scas_615.11                                                            51   1e-06
KLLA0F15598g 1439610..1441046 highly similar to sp|P33750 Saccha...    52   1e-06
AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146) [...    52   1e-06
KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces c...    51   1e-06
CAGL0L02761g complement(320826..322085) similar to sp|P18851 Sac...    51   2e-06
YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protei...    52   2e-06
Kwal_55.21450                                                          51   2e-06
Kwal_26.8628                                                           51   2e-06
YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translat...    50   3e-06
CAGL0A00561g complement(63710..64948) similar to sp|P53196 Sacch...    50   3e-06
CAGL0G03399g complement(325879..326988) highly similar to sp|P40...    50   3e-06
Kwal_33.15475                                                          50   3e-06
Scas_700.27*                                                           50   4e-06
Scas_721.128                                                           50   5e-06
YER066W (YER066W) [1497] chr5 (290240..290797) Protein containin...    47   6e-06
ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH] com...    49   8e-06
ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH] (128830..13...    49   8e-06
Kwal_27.11126                                                          49   1e-05
CAGL0J06512g complement(620516..622153) similar to sp|Q04199 Sac...    49   1e-05
Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement         49   1e-05
CAGL0L06952g complement(780793..781836) highly similar to sp|P40...    48   1e-05
YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component o...    49   1e-05
Kwal_47.17567                                                          49   1e-05
AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248) [...    48   1e-05
CAGL0K03377g complement(306529..309465) similar to sp|Q03177 Sac...    49   2e-05
YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the...    48   2e-05
AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516...    48   2e-05
Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement         48   2e-05
ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH] complement(...    47   2e-05
Scas_465.4                                                             48   2e-05
AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH] (424004..42...    47   2e-05
Kwal_47.17555                                                          47   3e-05
Scas_680.11                                                            47   3e-05
CAGL0A00605g complement(67281..69203) similar to sp|P53197 Sacch...    47   4e-05
Scas_718.6*                                                            47   4e-05
KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177 Saccha...    47   4e-05
Scas_571.4                                                             46   6e-05
AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH] (137221..13...    46   6e-05
Kwal_27.10785                                                          46   7e-05
Kwal_27.12586                                                          46   7e-05
Kwal_34.15818                                                          45   8e-05
Scas_660.7*                                                            46   8e-05
Scas_512.3                                                             45   1e-04
Sklu_1659.2 YMR092C, Contig c1659 410-2251                             45   1e-04
Scas_397.2                                                             45   1e-04
YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of...    45   1e-04
Sklu_2423.1 YLR409C, Contig c2423 869-3703                             45   1e-04
Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement         44   2e-04
ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH] complement(...    44   2e-04
AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH] complement(...    45   2e-04
Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement      44   2e-04
Kwal_27.10385                                                          44   2e-04
Kwal_55.21144                                                          44   4e-04
YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa sub...    44   4e-04
Kwal_56.24399                                                          43   4e-04
CAGL0J10340g complement(1008637..1009653) highly similar to sp|P...    43   6e-04
Scas_705.2                                                             43   6e-04
CAGL0C01441g complement(156930..159947) similar to tr|Q08924 Sac...    43   6e-04
Sklu_1710.1 YDR267C, Contig c1710 17-739                               42   6e-04
Scas_605.18                                                            43   7e-04
Sklu_675.1 YMR146C, Contig c675 761-1687                               42   7e-04
Scas_719.30                                                            43   7e-04
Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement       43   7e-04
YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component ...    43   8e-04
Kwal_14.1235                                                           43   8e-04
Kwal_26.7736                                                           42   8e-04
CAGL0K00957g 94828..97209 similar to sp|P42935 Saccharomyces cer...    43   9e-04
CAGL0K12188g 1191188..1192795 similar to sp|P38262 Saccharomyces...    42   0.001
YLR409C (UTP21) [3786] chr12 complement(934411..937230) Member o...    42   0.001
Scas_510.5                                                             42   0.001
KLLA0A08822g 772565..774313 similar to sp|P53197 Saccharomyces c...    42   0.001
AFL014C [3179] [Homologous to ScYGL116W (CDC20) - SH] (409496..4...    42   0.001
AER081C [2586] [Homologous to ScYLR409C - SH] (785301..788372) [...    42   0.001
Scas_660.8                                                             42   0.001
CAGL0K05599g 544932..547064 similar to tr|Q08496 Saccharomyces c...    42   0.002
KLLA0D06787g 586289..587599 gi|4809177|gb|AAD30127.1|AF136180_1 ...    42   0.002
Sklu_1870.2 YLR055C, Contig c1870 1126-2835 reverse complement         42   0.002
CAGL0D04884g 475678..477369 highly similar to tr|Q06506 Saccharo...    41   0.002
KLLA0E20779g complement(1841092..1842207) similar to sp|P40066 S...    41   0.002
YBR103W (SIF2) [292] chr2 (447666..449273) Protein involved in t...    41   0.002
Scas_702.16                                                            41   0.003
YPL183C (YPL183C) [5265] chr16 complement(199494..202535) Protei...    41   0.003
CAGL0J01287g 120215..122047 similar to sp|P46680 Saccharomyces c...    41   0.003
KLLA0A04928g 439349..441934 similar to sp|P32479 Saccharomyces c...    41   0.003
CAGL0B03575g complement(357525..358784) similar to sp|P39984 Sac...    40   0.003
YCL039W (GID7) [504] chr3 (52645..54882) Protein of unknown func...    41   0.003
YER107C (GLE2) [1539] chr5 complement(373444..374541) Nuclear po...    40   0.003
Sklu_2435.13 YPR137W, Contig c2435 18346-20073                         41   0.003
CAGL0M09845g 975007..977817 highly similar to sp|Q06078 Saccharo...    41   0.003
Scas_670.21                                                            40   0.004
Kwal_47.17465                                                          40   0.004
ADR264C [2005] [Homologous to ScYMR146C (TIF34) - SH] (1158218.....    40   0.004
Scas_721.29                                                            40   0.005
Kwal_56.24596                                                          40   0.005
ACL116W [933] [Homologous to ScYGR200C (ELP2) - SH] complement(1...    40   0.006
KLLA0D00814g complement(76687..77913) similar to sp|P39984 Sacch...    40   0.007
YMR092C (AIP1) [4050] chr13 complement(451631..453478) Actin int...    40   0.007
Kwal_14.1710                                                           39   0.009
Kwal_33.13515                                                          39   0.010
CAGL0J01265g complement(118375..119928) highly similar to sp|Q04...    39   0.011
CAGL0L08140g 892201..898470 similar to sp|P25356 Saccharomyces c...    39   0.013
CAGL0E02805g complement(265137..267659) similar to sp|P32479 Sac...    39   0.014
YGL100W (SEH1) [1883] chr7 (313235..314284) Protein found in com...    38   0.015
Scas_652.16                                                            38   0.015
YBR195C (MSI1) [378] chr2 complement(610571..611839) Chromatin a...    38   0.016
AER280C [2782] [Homologous to ScYML102W (CAC2) - SH] (1148956..1...    38   0.017
KLLA0F06754g complement(650475..651509) similar to sp|P53011 Sac...    38   0.017
Sklu_2364.2 YGL004C, Contig c2364 1650-2885 reverse complement         38   0.019
YLR208W (SEC13) [3609] chr12 (559553..560446) Component of the C...    38   0.019
Scas_693.22                                                            38   0.021
KLLA0F13772g 1276532..1278094 highly similar to sp|Q04305 Saccha...    38   0.021
Sklu_1645.2 YGL116W, Contig c1645 887-2650 reverse complement          38   0.022
Kwal_56.24332                                                          38   0.022
YPR137W (RRP9) [5555] chr16 (802353..804074) Protein component o...    38   0.022
Scas_595.3*                                                            38   0.024
Kwal_23.4118                                                           38   0.025
Scas_442.2*                                                            38   0.028
Sklu_2371.4 YDR030C, Contig c2371 8070-9506 reverse complement         37   0.030
YKL018W (SWD2) [3238] chr11 (403745..404734) Component of SET1 a...    37   0.031
ABL043W [549] [Homologous to ScYMR092C (AIP1) - SH] complement(3...    37   0.035
KLLA0F19734g 1826828..1830229 similar to sgd|S0002535 Saccharomy...    37   0.036
KLLA0B02827g 254447..257275 similar to sp|Q06078 Saccharomyces c...    37   0.039
AAR102C [288] [Homologous to ScYPR137W (RRP9) - SH] (526057..527...    37   0.040
CAGL0M05291g complement(566250..567509) similar to sp|P13712 Sac...    37   0.043
ABL044C [548] [Homologous to ScYMR093W - SH] (312378..313934) [1...    37   0.044
CAGL0L09757g complement(1046898..1047878) highly similar to sp|P...    37   0.047
KLLA0B11077g complement(970761..972464) similar to sgd|S0006341 ...    37   0.050
Scas_542.5                                                             36   0.059
Scas_642.1                                                             37   0.062
Scas_684.14                                                            37   0.067
KLLA0D12760g complement(1090428..1091909) weakly similar to sgd|...    36   0.069
YBL008W (HIR1) [186] chr2 (209618..212140) Histone transcription...    37   0.073
Scas_699.5                                                             36   0.085
AFR153W [3345] [Homologous to ScYLR055C (SPT8) - SH] complement(...    36   0.085
CAGL0J08998g 882655..886500 highly similar to sp|P38968 Saccharo...    36   0.094
YDR128W (YDR128W) [975] chr4 (709543..712989) Protein containing...    36   0.098
YDL195W (SEC31) [678] chr4 (107209..111030) Component (p150) of ...    36   0.099
Kwal_14.906                                                            35   0.11 
Scas_701.45                                                            36   0.12 
Kwal_56.23207                                                          36   0.12 
KLLA0C16643g complement(1457590..1458498) highly similar to sp|Q...    35   0.12 
Kwal_56.23685                                                          36   0.12 
Sklu_2317.3 YDR142C, Contig c2317 5804-6910                            35   0.12 
Scas_674.20                                                            35   0.12 
KLLA0E18964g complement(1676876..1680310) similar to sp|P53010 S...    36   0.13 
CAGL0J07854g complement(765463..766761) similar to sp|P53851 Sac...    35   0.14 
KLLA0F10791g complement(991642..993279) similar to sp|P26309 Sac...    35   0.14 
Sklu_2233.2 YMR049C, Contig c2233 5630-8059 reverse complement         35   0.14 
KLLA0F21076g 1966373..1969036 highly similar to sp|Q9P4C0 Kluyve...    35   0.14 
Sklu_2114.2 YDR128W, Contig c2114 598-4020 reverse complement          35   0.14 
Kwal_56.22345                                                          35   0.16 
Scas_656.15                                                            35   0.16 
AFR715C [3908] [Homologous to ScYCL039W - SH] (1752847..1754997)...    35   0.16 
AGR067W [4377] [Homologous to ScYDR128W - SH] complement(842182....    35   0.16 
KLLA0E18139g 1608371..1609351 highly similar to sp|P36104 Saccha...    35   0.17 
KLLA0F08811g complement(819834..821744) some similarities with s...    35   0.17 
CAGL0F07337g complement(714870..716735) similar to sp|P26309 Sac...    35   0.18 
AEL154C [2352] [Homologous to ScYBR281C - SH] (339962..342628) [...    35   0.18 
ACR085C [1132] [Homologous to NOHBY] (508364..511228) [2865 bp, ...    35   0.23 
YGL116W (CDC20) [1869] chr7 (289810..291642) Activator of anapha...    35   0.23 
CAGL0B00748g 65727..68165 similar to sp|P25569 Saccharomyces cer...    35   0.25 
Scas_657.13                                                            34   0.26 
YDL156W (YDL156W) [714] chr4 (174919..176487) Protein containing...    35   0.27 
Scas_706.24                                                            34   0.28 
CAGL0J08778g 866175..867071 highly similar to sp|Q04491 Saccharo...    34   0.28 
Sklu_2384.3 YKL018W, Contig c2384 6547-7533                            34   0.28 
ACL099W [950] [Homologous to ScYKL018W (SWD2) - SH] complement(1...    34   0.30 
Kwal_56.24478                                                          35   0.31 
YPL247C (YPL247C) [5203] chr16 complement(82625..84196) Protein ...    34   0.32 
Scas_646.14                                                            34   0.33 
ACR116W [1163] [Homologous to ScYPL139C (UME1) - SH] complement(...    34   0.33 
YBR097W (VPS15) [288] chr2 (436908..441272) Serine/threonine pro...    34   0.33 
KLLA0F07403g 697593..698636 similar to sp|P40217 Saccharomyces c...    34   0.37 
CAGL0H00781g complement(77292..78833) similar to tr|Q12523 Sacch...    34   0.37 
Kwal_33.14971                                                          34   0.41 
Kwal_56.24661                                                          34   0.45 
Kwal_26.7738                                                           34   0.47 
Scas_715.22                                                            33   0.51 
CAGL0M13409g complement(1316268..1320851) similar to sp|P38873 S...    34   0.54 
ACR199C [1246] [Homologous to ScYLR208W (SEC13) - SH] (698881..6...    33   0.58 
Kwal_33.13148                                                          33   0.62 
KLLA0C16533g complement(1448866..1450404) similar to sgd|S000231...    33   0.65 
ADR230W [1971] [Homologous to ScYOR080W (DIA2) - SH] complement(...    33   0.81 
KLLA0E19613g complement(1733708..1735426) similar to sp|P21304 S...    33   0.83 
AGR177C [4488] [Homologous to ScYDR219C - SH] (1082418..1083875)...    33   0.89 
ABR101C [693] [Homologous to ScYMR049C (ERB1) - SH] (567357..569...    33   0.89 
YMR049C (ERB1) [4011] chr13 complement(368093..370516) Protein w...    33   0.91 
KLLA0B11924g complement(1043344..1047582) similar to sp|P22219 S...    33   0.93 
Scas_469.3                                                             33   0.97 
Sklu_1048.1 YIR012W, Contig c1048 895-2196                             32   1.1  
KLLA0D15873g 1334131..1335426 similar to sp|P35184 Saccharomyces...    32   1.1  
KLLA0E11143g 983669..985150 similar to sp|Q04199 Saccharomyces c...    32   1.1  
AFL038C [3155] [Homologous to ScYGL100W (SEH1) - SH] (367581..36...    32   1.1  
Kwal_47.18825                                                          32   1.1  
Kwal_56.23035                                                          32   1.2  
AFR634W [3826] [Homologous to ScYNL253W - SH] complement(1593772...    32   1.2  
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         32   1.3  
Sklu_2113.2 YCL039W, Contig c2113 2538-4865                            32   1.3  
AAR078W [264] [Homologous to ScYLR196W (PWP1) - SH] complement(4...    32   1.3  
Scas_661.19                                                            32   1.4  
AFR398W [3590] [Homologous to ScYDR398W - SH] complement(1152603...    32   1.4  
CAGL0A04037g complement(399371..401122) highly similar to sp|P21...    32   1.4  
YBR281C (YBR281C) [459] chr2 complement(764928..767564) Member o...    32   1.5  
Kwal_14.1597                                                           32   1.5  
Kwal_56.24577                                                          32   1.6  
Scas_649.10                                                            32   1.6  
YDR219C (YDR219C) [1056] chr4 complement(905447..906844) Protein...    32   1.6  
Kwal_55.21884                                                          32   1.7  
KLLA0F26653g 2461876..2464251 similar to sp|Q04660 Saccharomyces...    32   1.8  
YLR196W (PWP1) [3599] chr12 (543970..545700) Protein containing ...    32   1.8  
CAGL0L04950g complement(562491..564908) highly similar to sp|Q04...    32   1.9  
YKL121W (YKL121W) [3144] chr11 (213788..216346) Protein containi...    32   2.0  
YLR055C (SPT8) [3472] chr12 complement(251273..253081) Component...    32   2.0  
CAGL0B02013g 184252..187614 highly similar to tr|Q03897 Saccharo...    32   2.1  
AGR242C [4553] [Homologous to ScYIR012W (SQT1) - SH] (1203152..1...    32   2.3  
Scas_700.47                                                            32   2.4  
YGL094C (PAN2) [1889] chr7 complement(331119..334466) Component ...    32   2.5  
AEL250C [2256] [Homologous to ScYBR195C (MSI1) - SH] (168010..16...    31   2.5  
AGL190W [4122] [Homologous to ScYDR142C (PEX7) - SH] complement(...    31   2.7  
KLLA0F13750g complement(1274110..1275972) similar to sp|P46680 S...    31   2.7  
KLLA0C01177g 89978..92131 weakly similar to sp|P25569 Saccharomy...    31   2.7  
Kwal_33.14248                                                          31   2.8  
YDR488C (PAC11) [1304] chr4 complement(1429176..1430777) Dynein ...    31   2.8  
CAGL0M01430g 164428..166683 highly similar to tr|Q06679 Saccharo...    31   2.9  
Sklu_1731.4 YJL069C, Contig c1731 3709-5439 reverse complement         31   2.9  
ADR331C [2072] [Homologous to ScYHR186C - SH] (1285564..1290252)...    31   3.0  
KLLA0F02013g 183770..185470 similar to sp|P40362 Saccharomyces c...    31   3.2  
KLLA0E21043g 1872227..1876192 similar to sgd|S0005498 Saccharomy...    31   3.2  
Kwal_27.12070                                                          31   3.3  
Sklu_1985.3 YLR196W, Contig c1985 4838-6544 reverse complement         31   3.4  
Scas_617.6                                                             31   3.5  
AFL157C [3038] [Homologous to ScYPL247C - SH] (140404..141720) [...    31   3.8  
Scas_715.35                                                            31   3.8  
Kwal_55.22076                                                          31   3.9  
KLLA0A09471g complement(827264..831784) similar to sp|P38873 Sac...    31   4.5  
KLLA0E03982g 371642..372760 similar to sp|P39108 Saccharomyces c...    30   5.3  
YEL056W (HAT2) [1372] chr5 (47168..48373) Histone acetyltransfer...    30   6.1  
CAGL0K11638g complement(1123343..1125121) weakly similar to sp|Q...    30   6.1  
Scas_640.18                                                            30   6.5  
Kwal_0.49                                                              30   6.6  
Scas_589.13                                                            30   6.8  
Scas_675.18                                                            30   6.8  
Kwal_47.17310                                                          30   7.0  
Scas_712.34                                                            30   7.3  
Kwal_0.40                                                              30   7.6  
YGR225W (AMA1) [2174] chr7 (945146..946328,946422..946927) Prote...    30   7.9  
Scas_641.25                                                            30   7.9  
YML102W (CAC2) [3869] chr13 (68294..69700) Chromatin assembly co...    30   9.0  
CAGL0I03542g 299881..301485 similar to tr|Q12510 Saccharomyces c...    29   9.6  

>Scas_704.40
          Length = 608

 Score = 1196 bits (3094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/608 (94%), Positives = 577/608 (94%)

Query: 1   MKRKINSNDNEIERELIRSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYN 60
           MKRKINSNDNEIERELIRSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYN
Sbjct: 1   MKRKINSNDNEIERELIRSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYN 60

Query: 61  QDLKRFKDLNDNITKLPAQEQAEIHHIISKFNKSNDKLRKLILDGILASSCFPQLSYISS 120
           QDLKRFKDLNDNITKLPAQEQAEIHHIISKFNKSNDKLRKLILDGILASSCFPQLSYISS
Sbjct: 61  QDLKRFKDLNDNITKLPAQEQAEIHHIISKFNKSNDKLRKLILDGILASSCFPQLSYISS 120

Query: 121 QVSNMIRIDFISILPQELSLKILSYLDCQSLCNATKVCRKWQILADDDRVWYHMCEQHID 180
           QVSNMIRIDFISILPQELSLKILSYLDCQSLCNATKVCRKWQILADDDRVWYHMCEQHID
Sbjct: 121 QVSNMIRIDFISILPQELSLKILSYLDCQSLCNATKVCRKWQILADDDRVWYHMCEQHID 180

Query: 181 RKCPNCGWGLPLLHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWR 240
           RKCPNCGWGLPLLHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWR
Sbjct: 181 RKCPNCGWGLPLLHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWR 240

Query: 241 KGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY 300
           KGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY
Sbjct: 241 KGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY 300

Query: 301 FDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV 360
           FDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV
Sbjct: 301 FDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV 360

Query: 361 ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV
Sbjct: 361 ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420

Query: 421 IPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHL 480
           IPLTIIDAENLVVDNISGSNEGDDEP                NDEENQTLDKSIPYPTHL
Sbjct: 421 IPLTIIDAENLVVDNISGSNEGDDEPASTTTPTAAIAAEAATNDEENQTLDKSIPYPTHL 480

Query: 481 LSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCM 540
           LSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCM
Sbjct: 481 LSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCM 540

Query: 541 HTFHGKRLQPQDEEGSTHLXXXXXXXXXXXXXXXPVQNKVSPIACVSIGDSEFFSGDELG 600
           HTFHGKRLQPQDEEGSTHL               PVQNKVSPIACVSIGDSEFFSGDELG
Sbjct: 541 HTFHGKRLQPQDEEGSTHLASTSNATGTSTSTANPVQNKVSPIACVSIGDSEFFSGDELG 600

Query: 601 CVKMYKFD 608
           CVKMYKFD
Sbjct: 601 CVKMYKFD 608

>YIL046W (MET30) [2621] chr9 (268650..270572) F-box protein that
           targets proteins for ubiquitination by interacting with
           the SCF complex (Skp1p-Cdc53p-Cdc34p), regulates sulfur
           assimilation genes in response to S-adenosylmethionine
           levels, contains five WD (WD-40) repeats [1923 bp, 640
           aa]
          Length = 640

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/594 (73%), Positives = 496/594 (83%), Gaps = 29/594 (4%)

Query: 15  ELIRSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYNQDLKRFKDLNDNIT 74
           +L  ++   R+ P     LP++NFTKFCYRHNP+I  SPTHTACY QDLKR +++N NI 
Sbjct: 73  DLATNDSGTRVQP-----LPEYNFTKFCYRHNPDIQFSPTHTACYKQDLKRTQEINANIA 127

Query: 75  KLPAQEQAEIHHIISKFNKSNDKLRKLILDGILASSCFPQLSYISSQVSNMIRIDFISIL 134
           KLP QEQ++IHHIISK++ SNDK+RKLILDGIL++SCFPQLSYISS V++MI+IDFISIL
Sbjct: 128 KLPLQEQSDIHHIISKYSNSNDKIRKLILDGILSTSCFPQLSYISSLVTHMIKIDFISIL 187

Query: 135 PQELSLKILSYLDCQSLCNATKVCRKWQILADDDRVWYHMCEQHIDRKCPNCGWGLPLLH 194
           PQELSLKILSYLDCQSLCNAT+VCRKWQ LADDDRVWYHMCEQHIDRKCPNCGWGLPLLH
Sbjct: 188 PQELSLKILSYLDCQSLCNATRVCRKWQKLADDDRVWYHMCEQHIDRKCPNCGWGLPLLH 247

Query: 195 MKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMD 254
           MKRAR  +N++  ++N     D   +  RPWKVIYRERFKVESNWRKG+C++QEFKGHMD
Sbjct: 248 MKRARIQQNSTGSSSN----ADIQTQTTRPWKVIYRERFKVESNWRKGHCRIQEFKGHMD 303

Query: 255 GVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKT 314
           GVLTLQFNYRLLFTGSYDST+ IWDL + KLIRRLSGH+DGVKTLYFD+ KL+TGSLDKT
Sbjct: 304 GVLTLQFNYRLLFTGSYDSTIGIWDLFTGKLIRRLSGHSDGVKTLYFDDRKLITGSLDKT 363

Query: 315 IRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEW 374
           IRVWNY TGECISTYRGH+DSV+SVD+++K+IVSGSADKTVK+WHVESRTCYTLRGHTEW
Sbjct: 364 IRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGHTEW 423

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVD 434
           VNCVKLHPKSF+CFS SDDTTIRMWDIRTNSCLKVFRGHVGQVQK+IPLTI D ENL  D
Sbjct: 424 VNCVKLHPKSFSCFSCSDDTTIRMWDIRTNSCLKVFRGHVGQVQKIIPLTIKDVENLATD 483

Query: 435 NISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV 494
           N S  +   D+P                ++E+   LD++IPYPTHLLSC LDNTIKLWDV
Sbjct: 484 NTSDGSSPQDDP----TMTDGADESDTPSNEQETVLDENIPYPTHLLSCGLDNTIKLWDV 539

Query: 495 QTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEE 554
           +TG+CIRTQFGHVEGVWDIAADNFRIISGSHDGSIK+WDLQSGKCMHTF+G+RLQ + + 
Sbjct: 540 KTGKCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKVWDLQSGKCMHTFNGRRLQRETQH 599

Query: 555 GSTHLXXXXXXXXXXXXXXXPVQNKVSPIACVSIGDSEFFSGDELGCVKMYKFD 608
             T                  + +KV+PIACV IGDSE FSGDE GCVKMYKFD
Sbjct: 600 TQTQ----------------SLGDKVAPIACVCIGDSECFSGDEFGCVKMYKFD 637

>CAGL0L00781g 95506..97527 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30, hypothetical start
          Length = 673

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/638 (65%), Positives = 480/638 (75%), Gaps = 87/638 (13%)

Query: 31  SALPQFNFTKFCYRHNPEILSSPTHTACYNQDLKRFKDLNDNITKLP-AQEQAEIHHIIS 89
           S LP+ NF ++CYRHNPEI +S TH  CY QD++R K +N+ I++L   +EQA+IHHIIS
Sbjct: 60  SVLPRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKISQLACPKEQADIHHIIS 119

Query: 90  KFNKSNDKLRKLILDGILASSCFPQLSYISSQVSNMIRIDFISILPQELSLKILSYLDCQ 149
           K+  SNDK+RKLILDGIL SSCFPQLSYI+  ++ MI+IDFIS+LPQELSLKIL YLDCQ
Sbjct: 120 KYTNSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDFISVLPQELSLKILGYLDCQ 179

Query: 150 SLCNATKVCRKWQILADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRAR---------- 199
           SLCNA+ VC+ W +LADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRAR          
Sbjct: 180 SLCNASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARVCYIKAKNPN 239

Query: 200 --------------------------------FVKNASICATNNTCT--------KDSNG 219
                                           F  N    A+NNT +        +  NG
Sbjct: 240 TTVNDRKMIQDNDNRISPLTDRTQGNESPGATFSTNVCTTASNNTVSGSKSSGQGQQENG 299

Query: 220 KL-MRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIW 278
           +   + WK++YRERFKVESNWRKG C +QEFKGHMDGVLTLQFNYRLLFTGSYD+TVAIW
Sbjct: 300 RCRQKSWKMVYRERFKVESNWRKGLCTIQEFKGHMDGVLTLQFNYRLLFTGSYDTTVAIW 359

Query: 279 DLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS 338
           DL + KLIRRL+GH+DGVKTLYFD+ KL+TGSLDKTIRVWNY TGECISTYRGHTDSVMS
Sbjct: 360 DLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSLDKTIRVWNYITGECISTYRGHTDSVMS 419

Query: 339 VDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
           VD+ KKIIVSGSADKTVK+WHVESRTCYTL+GHTEWVNCVKLHPKSF+C+S SDDTTIRM
Sbjct: 420 VDSHKKIIVSGSADKTVKVWHVESRTCYTLKGHTEWVNCVKLHPKSFSCYSCSDDTTIRM 479

Query: 399 WDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVV--------DNISGSNEGDDEPXXXX 450
           WDIRTN+CL+VFRGHVGQVQKVIPLTIIDA+NLV         D+I+ +  G+D+P    
Sbjct: 480 WDIRTNTCLRVFRGHVGQVQKVIPLTIIDAQNLVTHERKPGEEDDIASNGTGEDDPENGV 539

Query: 451 XXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV 510
                            + LDK +PYPTHLLSC+LDNTIKLW+V++G+CIRTQFGHVEGV
Sbjct: 540 NG--------------QRELDKKMPYPTHLLSCALDNTIKLWEVRSGRCIRTQFGHVEGV 585

Query: 511 WDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEEGSTHLXXXXXXXXXXX 570
           WDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG++L+  D   S++            
Sbjct: 586 WDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLKGSDVNTSSNPDHDE------- 638

Query: 571 XXXXPVQNKVSPIACVSIGDSEFFSGDELGCVKMYKFD 608
                 + K +P+ACV IGDSE FSGDE GCVKMYKFD
Sbjct: 639 ------RTKSAPVACVCIGDSECFSGDEFGCVKMYKFD 670

>Kwal_23.5769
          Length = 627

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/597 (62%), Positives = 449/597 (75%), Gaps = 58/597 (9%)

Query: 18  RSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYNQDLKRFKDLNDNITKLP 77
           R+NK  R        LPQ+NF +FCYRHNP+   S THTACY QD +R + LN  I +L 
Sbjct: 83  RTNKRVR-------GLPQYNFLRFCYRHNPDFQHSQTHTACYMQDQQRHQKLNKKIEQLE 135

Query: 78  AQEQAEIHHIISKFNKSNDKLRKLILDGILASSCFPQLSYISSQVSNMIRIDFISILPQE 137
            +EQ ++ ++++ F   ND++RKL+L+G+LA+ CFPQLS+++S+V  MI+IDFIS LP+E
Sbjct: 136 PEEQRQVQNVLTTFAGCNDRIRKLLLEGLLANCCFPQLSFVASEVQKMIKIDFISTLPEE 195

Query: 138 LSLKILSYLDCQSLCNATKVCRKWQILADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKR 197
           ++LKIL YLDC+SLCNA +VCR+WQ +ADDD+VWYHMC+QHIDRKCPNCGWGLPLLHMKR
Sbjct: 196 VALKILGYLDCESLCNAARVCRRWQQMADDDKVWYHMCQQHIDRKCPNCGWGLPLLHMKR 255

Query: 198 ARFV------KNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKG 251
           ARF+      K     A N     ++  +  RPWKVIYRERFKVESNWRKG   +QEFKG
Sbjct: 256 ARFIEPPAESKPGQKGAGNPPVASETTTRKTRPWKVIYRERFKVESNWRKGTAHIQEFKG 315

Query: 252 HMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSL 311
           HMDGVL+LQFNYRLLFTGSYDSTVAIWDL + KL+RRL+GH DGVK +YFD  KL+TGSL
Sbjct: 316 HMDGVLSLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVKAIYFDGQKLITGSL 375

Query: 312 DKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGH 371
           D+ IRVWNY TG C++ Y GH+DSV+SVD++KKIIVSGSADKTVK+WHVESRTCYTLRGH
Sbjct: 376 DRMIRVWNYVTGACVAAYPGHSDSVLSVDSYKKIIVSGSADKTVKVWHVESRTCYTLRGH 435

Query: 372 TEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENL 431
           TEWV  VKLHPKSFTCFSGSDDTTIRMWDIR+N+C+KVFRGHVGQVQKV+PLTI+D ENL
Sbjct: 436 TEWVGTVKLHPKSFTCFSGSDDTTIRMWDIRSNTCVKVFRGHVGQVQKVLPLTILDTENL 495

Query: 432 VVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKL 491
           V D  S      D P                 D +   LD S+PYP+HLLSCSLDNTIKL
Sbjct: 496 VTDRTS------DPPRNEATTAQDPP------DGQLSALDDSLPYPSHLLSCSLDNTIKL 543

Query: 492 WDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQ 551
           W+V+TG+C+RT FGHVEG+WDIAADNFRI+SG+HD ++K+WDLQSGKC+HTF   +    
Sbjct: 544 WEVRTGKCVRTHFGHVEGIWDIAADNFRIVSGAHDKTVKVWDLQSGKCIHTFDSHQ---- 599

Query: 552 DEEGSTHLXXXXXXXXXXXXXXXPVQNKVSPIACVSIGDSEFFSGDELGCVKMYKFD 608
                                        +PI CV IGDSEF SGDELGCVK+++FD
Sbjct: 600 -----------------------------APITCVGIGDSEFVSGDELGCVKVHRFD 627

>ADL082C [1659] [Homologous to ScYIL046W (MET30) - SH]
           (538948..540657) [1710 bp, 569 aa]
          Length = 569

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/578 (62%), Positives = 431/578 (74%), Gaps = 53/578 (9%)

Query: 34  PQFNFTKFCYRHNPEILSSPTHTACYNQDLKRFKDLNDNITKLPAQ-EQAEIHHIISKFN 92
           PQ+NF ++CYRHNP+I ++PT   C  Q+ +R ++    + +L ++ E+  +   +  F+
Sbjct: 40  PQYNFVRYCYRHNPDIQAAPTQVRCVRQEQQRREEWQARVGELSSEGERQVVQEAVRLFD 99

Query: 93  KSNDKLRKLILDGILASSCFPQLSYISSQVSNMIRIDFISILPQELSLKILSYLDCQSLC 152
            SNDKLRKL+L+G+L  SCFPQLS+IS+Q+  +I+IDFIS LP+E++LKIL YLDCQSLC
Sbjct: 100 SSNDKLRKLMLEGMLLKSCFPQLSFISTQLQKLIKIDFISALPEEVALKILGYLDCQSLC 159

Query: 153 NATKVCRKWQILADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARFVKNASICATNNT 212
           +A  VCR+WQ LADDD VWYHMCEQHIDRKCP CGWGLPLLHMKRAR++K+    A+   
Sbjct: 160 SAAAVCRRWQELADDDTVWYHMCEQHIDRKCPKCGWGLPLLHMKRARYIKSDKASASKGE 219

Query: 213 CTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYD 272
             +D+    MRPWKV+YRERFKVESNWRKG  ++QEFKGHMDGVL+LQ   +LL TGSYD
Sbjct: 220 -GEDAPQSRMRPWKVVYRERFKVESNWRKGIYRIQEFKGHMDGVLSLQLTNKLLLTGSYD 278

Query: 273 STVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGH 332
           STVAIWDL + KLIRRLSGHTDGVK L FD+ KL+TGSLDKTIRVWNY TG C+STYRGH
Sbjct: 279 STVAIWDLATGKLIRRLSGHTDGVKALRFDDQKLITGSLDKTIRVWNYVTGACVSTYRGH 338

Query: 333 TDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSD 392
            DSV+SVD+F+K+IVSGSADKTVK+WHVESRTCYTLRGHT WVNCVKLHPKSFTCFSGSD
Sbjct: 339 QDSVLSVDSFRKLIVSGSADKTVKVWHVESRTCYTLRGHTGWVNCVKLHPKSFTCFSGSD 398

Query: 393 DTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXX 452
           D TIRMWDIRTN+C++VF GHVGQVQKVIPLT+    +L+ D        D         
Sbjct: 399 DMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTL--GSDLIEDPKDAVVPPD--------- 447

Query: 453 XXXXXXXXXXNDEENQT--LDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV 510
                     +D   Q    D S+PYPTHLLSCSLDNTIKLW+V+TG CIRTQFGHVEGV
Sbjct: 448 -----ATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIRTQFGHVEGV 502

Query: 511 WDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEEGSTHLXXXXXXXXXXX 570
           WDIAADNFRI+SGSHD S K+WDLQ+GKCMHTF G                         
Sbjct: 503 WDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIH----------------------- 539

Query: 571 XXXXPVQNKVSPIACVSIGDSEFFSGDELGCVKMYKFD 608
                     +P+ACV IGDSEF SGDELGCVK+Y FD
Sbjct: 540 ----------APVACVGIGDSEFVSGDELGCVKLYNFD 567

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 87/198 (43%), Gaps = 44/198 (22%)

Query: 249 FKGHMDGVLTLQFNYRLL--FTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY------ 300
            +GH   V  ++ + +    F+GS D T+ +WD+ +N  +R   GH   V+ +       
Sbjct: 374 LRGHTGWVNCVKLHPKSFTCFSGSDDMTIRMWDIRTNTCVRVFHGHVGQVQKVIPLTLGS 433

Query: 301 ----------------------------FDEA-----KLVTGSLDKTIRVWNYKTGECIS 327
                                       FD +      L++ SLD TI++WN KTG CI 
Sbjct: 434 DLIEDPKDAVVPPDATAPAHDPSVQAANFDHSLPYPTHLLSCSLDNTIKLWNVKTGACIR 493

Query: 328 TYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFT 386
           T  GH + V  + A    IVSGS D++ K+W +++  C +T  G    V CV +    F 
Sbjct: 494 TQFGHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVACVGIGDSEFV 553

Query: 387 CFSGSDDTTIRMWDIRTN 404
             SG +   +++++  T 
Sbjct: 554 --SGDELGCVKLYNFDTT 569

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 1/85 (1%)

Query: 238 NWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK 297
           N + G C   +F GH++GV  +  +   + +GS+D +  +WDL + K +    G    V 
Sbjct: 485 NVKTGACIRTQF-GHVEGVWDIAADNFRIVSGSHDRSCKVWDLQTGKCMHTFVGIHAPVA 543

Query: 298 TLYFDEAKLVTGSLDKTIRVWNYKT 322
            +   +++ V+G     ++++N+ T
Sbjct: 544 CVGIGDSEFVSGDELGCVKLYNFDT 568

>KLLA0F27511g 2546533..2548404 similar to sp|P39014 Saccharomyces
           cerevisiae YIL046w MET30 involved in regulation of
           sulfur assimilation genes and cell cycle progression,
           start by similarity
          Length = 623

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/639 (57%), Positives = 432/639 (67%), Gaps = 96/639 (15%)

Query: 4   KINSNDNEIERELIRSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYNQDL 63
           K+N N+ EI+                 S +PQFNF KFCYRHNP+I  +   +  + QD 
Sbjct: 45  KVNQNNEEIQ---------------LPSEMPQFNFFKFCYRHNPDIQHTCKDSMVF-QDQ 88

Query: 64  KRFKDLNDNITKLPAQ-EQAEIHHIISKFNKSNDKLRKLILDGILASSCFPQLSYISSQV 122
            R +   + +  L  + ++A I   +  F  SNDK+R+L+L+GIL   CFPQLSYI+ +V
Sbjct: 89  VRSEKWMEKMKALDKESDRAIIKQTLDNFQHSNDKIRRLMLEGILQLCCFPQLSYIADEV 148

Query: 123 SNMIRIDFISILPQELSLKILSYLDCQSLCNATKVCRKWQILADDDRVWYHMCEQHIDRK 182
             +I+IDFIS LP+ELSLKIL YLDCQSLC A+  C++W+ LADDDRVWYHMCEQHIDRK
Sbjct: 149 KQLIKIDFISTLPEELSLKILGYLDCQSLCIASLTCKRWKTLADDDRVWYHMCEQHIDRK 208

Query: 183 CPNCGWGLPLLHMKRARFVK--------------------------------NASICATN 210
           CPNCGWGLPLLHMKRAR++                                 N       
Sbjct: 209 CPNCGWGLPLLHMKRARYLPVNEAHVHNQNGNQFQNVANGNGNEIGGGKSLINPGNSPNQ 268

Query: 211 NTCTKDSNGKLM-RPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTG 269
               +  N +   RPWKVIYRERF+VESNWR G C++Q FKGHMDGVL+L+FN+RLLFTG
Sbjct: 269 TVAARARNSRYYTRPWKVIYRERFQVESNWRNGRCRIQLFKGHMDGVLSLKFNHRLLFTG 328

Query: 270 SYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTY 329
           SYDSTVAIWD  S  LIRRL+GHTDGVK +YFD+ K++T SLDKTIRVWNY TG CISTY
Sbjct: 329 SYDSTVAIWDTKSGNLIRRLTGHTDGVKGIYFDDQKMITASLDKTIRVWNYITGSCISTY 388

Query: 330 RGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFS 389
           RGH DSV+SVD++KKIIVS SADKTVK+WHVESRTCYTLRGHTEWVNCVKLHPKSFTC+S
Sbjct: 389 RGHQDSVLSVDSYKKIIVSASADKTVKVWHVESRTCYTLRGHTEWVNCVKLHPKSFTCYS 448

Query: 390 GSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXX 449
            SDD T+RMWDIRTNSC+KVFRGHVGQVQKVIPLTI D ENLVVD      E    P   
Sbjct: 449 SSDDKTLRMWDIRTNSCIKVFRGHVGQVQKVIPLTIKDTENLVVDE---KIEKVPNPELE 505

Query: 450 XXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEG 509
                         D+     D ++ YPTHLLSCSLDNTIKLW+V +G+CIRTQFGHVEG
Sbjct: 506 EDFA----------DDCTGIFDPNLKYPTHLLSCSLDNTIKLWEVSSGRCIRTQFGHVEG 555

Query: 510 VWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEEGSTHLXXXXXXXXXX 569
           VWDIAADNFRI+SGSHD SIK+WDLQ+GKC+ TF G +                      
Sbjct: 556 VWDIAADNFRIVSGSHDKSIKVWDLQNGKCIQTFTGHK---------------------- 593

Query: 570 XXXXXPVQNKVSPIACVSIGDSEFFSGDELGCVKMYKFD 608
                      +PI CV IGDS F SGDELG VKM+ FD
Sbjct: 594 -----------APIVCVGIGDSSFVSGDELGEVKMWHFD 621

>CAGL0L02629g complement(307323..309710) similar to sp|P07834
           Saccharomyces cerevisiae YFL009w CDC4 cell division
           control, hypothetical start
          Length = 795

 Score =  124 bits (312), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 108/396 (27%), Positives = 172/396 (43%), Gaps = 71/396 (17%)

Query: 71  DNITKLPAQEQAEIHHIISKFNKSNDKLR-KLILDGILASSCFPQLSYISSQVSNMIRID 129
           D I +   +E+AE   +++    S   +    ++  +L+     +LS IS+ + + ++ D
Sbjct: 200 DLIEEYKDKERAETERLLATIKASLGAVNMNHLIYSLLSGMHRSELSDISTLLRDNLKRD 259

Query: 130 FISILPQELSLKILSYLDCQSLCNATKVCRKW-QILADDDRVWYHMCEQHIDRKCPNCGW 188
           F++ LP E++LKIL+ L  +S+ N  +V + W +++     +W H+              
Sbjct: 260 FVTSLPLEITLKILNKLPFESISNCLQVSKSWNRLINGTPALWKHLL------------- 306

Query: 189 GLPLLHMKRARFVKNASICATNNTCTKDSNGKLMRPW--KVIYRERF----KVESNWRKG 242
            L    + +  F K   +           N KL  P+     YR+ F     +  NW   
Sbjct: 307 -LSESFVSKDSFDKKYPV----------ENNKLDPPFDNDSRYRQDFLMNCSILQNWYNP 355

Query: 243 NC--QVQEFKGHMDGVLT-LQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL 299
           +   Q    KGHM  V+T LQF    + TG+ D  + I+D  + K +  LSGH  GV  L
Sbjct: 356 DFIPQRTTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWAL 415

Query: 300 -YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK----KIIVSGSADKT 354
            Y     LV+GS D+++R+WN   G+C   ++GHT +V  +D  +    K IV+GS D T
Sbjct: 416 KYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRCLDIVEHEGVKYIVTGSRDNT 475

Query: 355 VKIW--------------------------HVESRTCY---TLRGHTEWVNCVKLHPKSF 385
           + IW                          H      Y    LRGH   V  V  H +  
Sbjct: 476 LHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLRGHIASVRTVSGHGR-- 533

Query: 386 TCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI 421
              SGS D  + +WDI    CL +  GH  ++   I
Sbjct: 534 IVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYSTI 569

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 70/135 (51%), Gaps = 22/135 (16%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--E 303
           V   +GH+  V T+  + R++ +GSYD+ + +WD+   K +  L GHTD + +  +D   
Sbjct: 515 VGVLRGHIASVRTVSGHGRIVISGSYDNNLIVWDIIQMKCLYILMGHTDRIYSTIYDYKR 574

Query: 304 AKLVTGSLDKTIRVWN----YKTGECIS----------------TYRGHTDSVMSVDAFK 343
            + ++ S+D TI++W+    +  GEC++                T +GHT  V  +    
Sbjct: 575 NRCISASMDSTIKIWDLQNIWNNGECVNVTNATVPCTKITGPMMTLQGHTALVGLLKLSD 634

Query: 344 KIIVSGSADKTVKIW 358
           K +VS +AD +++ W
Sbjct: 635 KFLVSAAADGSLRGW 649

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 107/245 (43%), Gaps = 34/245 (13%)

Query: 327 STYRGHTDSVMSVDAFK-KIIVSGSADKTVKIW-HVESRTCYTLRGHTEWVNCVKLHPKS 384
           +T +GH  SV++   F+   +++G+ DK ++I+  +  +    L GH   V  +K +  +
Sbjct: 362 TTLKGHMTSVVTCLQFEDNYVITGADDKMIRIYDSITKKFLIELSGHDGGVWALK-YAGN 420

Query: 385 FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLV------------ 432
               SGS D ++R+W+I    C  VF+GH   V+    L I++ E +             
Sbjct: 421 GILVSGSTDRSVRIWNIHLGKCTHVFKGHTSTVRC---LDIVEHEGVKYIVTGSRDNTLH 477

Query: 433 ---VDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIP-------YPTHLLS 482
              +  +S SN  +  P                N      L   I        +   ++S
Sbjct: 478 IWKLPQMSDSNIDEGMPNVYSNNGPLFFHSPEENPYFVGVLRGHIASVRTVSGHGRIVIS 537

Query: 483 CSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAAD--NFRIISGSHDGSIKIWDLQ----S 536
            S DN + +WD+   +C+    GH + ++    D    R IS S D +IKIWDLQ    +
Sbjct: 538 GSYDNNLIVWDIIQMKCLYILMGHTDRIYSTIYDYKRNRCISASMDSTIKIWDLQNIWNN 597

Query: 537 GKCMH 541
           G+C++
Sbjct: 598 GECVN 602

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKIWDLQSG 537
           ++++ + D  I+++D  T + +    GH  GVW +  A N  ++SGS D S++IW++  G
Sbjct: 381 YVITGADDKMIRIYDSITKKFLIELSGHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLG 440

Query: 538 KCMHTFHG 545
           KC H F G
Sbjct: 441 KCTHVFKG 448

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 55/127 (43%), Gaps = 27/127 (21%)

Query: 249 FKGHMDGVLTLQFNYRL--LFTGSYDSTVAIWDL--------CSNKL------------I 286
             GH D + +  ++Y+     + S DST+ IWDL        C N              +
Sbjct: 558 LMGHTDRIYSTIYDYKRNRCISASMDSTIKIWDLQNIWNNGECVNVTNATVPCTKITGPM 617

Query: 287 RRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF---K 343
             L GHT  V  L   +  LV+ + D ++R W+  + +    +  H +++ ++  F    
Sbjct: 618 MTLQGHTALVGLLKLSDKFLVSAAADGSLRGWD--SSDYSRKFAYHHNNLSAITTFYMTD 675

Query: 344 KIIVSGS 350
            I+VSGS
Sbjct: 676 NILVSGS 682

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 24/41 (58%)

Query: 505 GHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           GH+  V  ++     +ISGS+D ++ +WD+   KC++   G
Sbjct: 520 GHIASVRTVSGHGRIVISGSYDNNLIVWDIIQMKCLYILMG 560

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 38/89 (42%), Gaps = 20/89 (22%)

Query: 481 LSCSLDNTIKLWDVQT----GQCIR----------------TQFGHVEGVWDIAADNFRI 520
           +S S+D+TIK+WD+Q     G+C+                 T  GH   V  +   +  +
Sbjct: 578 ISASMDSTIKIWDLQNIWNNGECVNVTNATVPCTKITGPMMTLQGHTALVGLLKLSDKFL 637

Query: 521 ISGSHDGSIKIWDLQSGKCMHTFHGKRLQ 549
           +S + DGS++ WD         +H   L 
Sbjct: 638 VSAAADGSLRGWDSSDYSRKFAYHHNNLS 666

>YFL009W (CDC4) [1673] chr6 (116139..118478) F-box protein and
           component of the SCF-Cdc4p complex
           (Skp1p-Cdc53p-Cdc34p-Cdc4p) which targets Sic1p, Far1p,
           Cdc6p, Ctf13p and Gcn4p for ubiquitin-dependent
           degradation, has WD (WD-40) repeats [2340 bp, 779 aa]
          Length = 779

 Score =  120 bits (302), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 122/491 (24%), Positives = 193/491 (39%), Gaps = 129/491 (26%)

Query: 114 QLSYISSQVSNMIRIDFISILPQELSLKILSYLDCQSLCNATKVCRKW-QILADDDRVWY 172
           +LS + + + + ++ D I+ LP E+SLKI +YL  + + N+  V + W +I+     +W 
Sbjct: 258 ELSDLGTLIKDNLKRDLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWK 317

Query: 173 HM--CEQHIDRKCPNCGWGLPLLHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYR 230
            +   E  +  K      G   L++K ++               K S    +R   + + 
Sbjct: 318 KLLISENFVSPK------GFNSLNLKLSQ------------KYPKLSQQDRLR---LSFL 356

Query: 231 ERFKVESNWR--KGNCQVQEFKGHMDGVLT-LQFNYRLLFTGSYDSTVAIWDLCSNKLIR 287
           E   +  NW   K   Q    +GHM  V+T LQF    + TG+ D  + ++D  + K + 
Sbjct: 357 ENIFILKNWYNPKFVPQRTTLRGHMTSVITCLQFEDNYVITGADDKMIRVYDSINKKFLL 416

Query: 288 RLSGHTDGVKTL-YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--- 343
           +LSGH  GV  L Y     LV+GS D+T+RVW+ K G C   ++GH  +V  +D  +   
Sbjct: 417 QLSGHDGGVWALKYAHGGILVSGSTDRTVRVWDIKKGCCTHVFKGHNSTVRCLDIVEYKN 476

Query: 344 -KIIVSGSADKTVKIW---------------------HVESRTCY---TLRGHTEWVNCV 378
            K IV+GS D T+ +W                     H      Y    LRGH   V  V
Sbjct: 477 IKYIVTGSRDNTLHVWKLPKESSVPDHGEEHDYPLVFHTPEENPYFVGVLRGHMASVRTV 536

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
             H       SGS D T+ +WD+    CL +  GH  ++      TI D E         
Sbjct: 537 SGHGN--IVVSGSYDNTLIVWDVAQMKCLYILSGHTDRIYS----TIYDHER-------- 582

Query: 439 SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQT-- 496
                                                     +S S+D TI++WD++   
Sbjct: 583 ---------------------------------------KRCISASMDTTIRIWDLENIW 603

Query: 497 --GQC----------------IRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGK 538
             G+C                + T  GH   V  +   +  ++S + DGSI+ WD     
Sbjct: 604 NNGECSYATNSASPCAKILGAMYTLQGHTALVGLLRLSDKFLVSAAADGSIRGWDANDYS 663

Query: 539 CMHTFHGKRLQ 549
              ++H   L 
Sbjct: 664 RKFSYHHTNLS 674

>YCR072C (YCR072C) [597] chr3 complement(240800..242347) Protein of
           unknown function, member of WD (WD-40) repeat family
           [1548 bp, 515 aa]
          Length = 515

 Score =  119 bits (298), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 102/359 (28%), Positives = 157/359 (43%), Gaps = 55/359 (15%)

Query: 230 RERFKVESNWRKGNCQVQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSNKLI 286
           R  FKV+   R  +       GH   +L   F       + TG+ D+T  IWD  +   +
Sbjct: 124 RAVFKVKPVTRSSSA----IAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPM 179

Query: 287 RRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECIS-TYRGHTDSVMSVD--- 340
             L GH + V  + +  D   + TGS+D TIR+W+ K+G+C+    RGH+  + S+    
Sbjct: 180 HTLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEP 239

Query: 341 ------AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDD 393
                   K  + S S D T+KIW   SR C YT+ GHT  V+CVK   +    +SGS D
Sbjct: 240 IHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGL-LYSGSHD 298

Query: 394 TTIRMWDIRTNS-CLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXX 452
            T+R+WDI +   C+ + + H   V  +   T         D+        +E       
Sbjct: 299 RTVRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALE 358

Query: 453 XXXXXXXXXXNDEE----------------------------NQTLDKSI---PYPTHLL 481
                     N EE                            +Q L   +   P   +++
Sbjct: 359 NYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIV 418

Query: 482 SCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGK 538
           S S DN+IKLWD + G+ I T  GHV  V+ +A  +D   ++S S D ++K+WD+++ K
Sbjct: 419 SASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRK 477

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 95/225 (42%), Gaps = 50/225 (22%)

Query: 244 CQVQEFKGHMDGVLTLQFNYR-LLFTGSYDSTVAIWDL-----CSNKL------IRRLSG 291
           CQ     GH + V  +++  + LL++GS+D TV +WD+     C N L      +  LS 
Sbjct: 270 CQYT-MSGHTNSVSCVKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSL 328

Query: 292 HTD-GVKTLYFD------------------------------EAKLVTGSLDKTIRVWN- 319
            TD  ++   FD                              E  +VT S D T+ +WN 
Sbjct: 329 STDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNP 388

Query: 320 YKTGECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHV-ESRTCYTLRGHTEWV 375
            K+ + I+   GH   V  V AF    + IVS S D ++K+W   + +   T RGH   V
Sbjct: 389 LKSTKPIARMTGHQKLVNHV-AFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASV 447

Query: 376 NCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
             V          S S DTT+++WD+RT        GH  +V  V
Sbjct: 448 YQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTV 492

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 6/124 (4%)

Query: 241 KGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT 298
           K    +    GH   V  + F  + R + + S+D+++ +WD    K I    GH   V  
Sbjct: 390 KSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQ 449

Query: 299 LYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKT 354
           + +  D   LV+ S D T++VW+ +T +      GH D V +VD     K + SG  DK 
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKM 509

Query: 355 VKIW 358
           V++W
Sbjct: 510 VRLW 513

>Scas_707.22
          Length = 730

 Score =  115 bits (288), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 93/344 (27%), Positives = 151/344 (43%), Gaps = 59/344 (17%)

Query: 106 ILASSCFPQLSYISSQVSNMIRIDFISILPQELSLKILSYLDCQSLCNATKVCRKWQ-IL 164
           IL++     LS ++S ++  ++ D +S LP E++LKI  +L    + N   VC  W  I+
Sbjct: 234 ILSNLNRTALSDLNSVLNGNLKRDIVSSLPIEIALKIFQHLSYDDIFNCQSVCSNWNAII 293

Query: 165 ADDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARFVKNASICATNNTCTKDSNGKLMRP 224
                +W ++                    +    FV    +   NN  +          
Sbjct: 294 NTTPLLWKNL--------------------LISESFVSAQEVANNNNKSSF--------- 324

Query: 225 WKVIYRERFKVESNWRKGNCQVQE--FKGHMDGVLT-LQFNYRLLFTGSYDSTVAIWDLC 281
           +K  + E  ++  NW   + + +     GH   V+T LQF    + TG+ D  + I+D  
Sbjct: 325 FKEKFIESLRILQNWYNPSFKPERTTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDAR 384

Query: 282 SNKLIRRLSGHTDGVKTLYFD-EAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MS 338
           S K ++ LSGH  GV  L +D +  +V+GS D+++R+W+ K G C   ++GHT +V  + 
Sbjct: 385 SKKFLKELSGHEGGVWALKYDADGIIVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLE 444

Query: 339 VDAFK--KIIVSGSADKTVKIWHV--------ESRTCY-----------TLRGHTEWVNC 377
           +  +K  K IV+GS D T+ +W +        E    Y            LRGH   V  
Sbjct: 445 IVTYKNMKYIVTGSRDNTLHVWKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRT 504

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI 421
           +  H       SGS D  + +WDI    CL V  GH  ++   I
Sbjct: 505 ISGHGN--IVISGSYDNNLMVWDIAQMKCLYVLIGHTDRIYSTI 546

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 86/187 (45%), Gaps = 36/187 (19%)

Query: 225 WKVIYRERFK-----VESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWD 279
           WK+I  E+F      V +   +    V   +GHM  V T+  +  ++ +GSYD+ + +WD
Sbjct: 466 WKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHGNIVISGSYDNNLMVWD 525

Query: 280 LCSNKLIRRLSGHTDGVKTLYFD--EAKLVTGSLDKTIRVWN----YKTGECISTYRGHT 333
           +   K +  L GHTD + +  +D    + ++ S+D TI+VW+    +  G C        
Sbjct: 526 IAQMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNC-------- 577

Query: 334 DSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDD 393
                       I++ SA    KI    + +  TL+GHT  V  ++L  K     S + D
Sbjct: 578 -----------TIITNSATPCTKI----TGSMLTLQGHTALVGLLRLSDKYL--VSAAAD 620

Query: 394 TTIRMWD 400
            ++R WD
Sbjct: 621 GSLRGWD 627

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/304 (24%), Positives = 127/304 (41%), Gaps = 56/304 (18%)

Query: 289 LSGHTDGVKT-LYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKI 345
           L+GH   V T L F++  ++TG+ D+ +R+++ ++ + +    GH   V  +  DA   I
Sbjct: 351 LTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDA-DGI 409

Query: 346 IVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKL--HPKSFTCFSGSDDTTIRMWDI- 401
           IVSGS D++V+IW ++   C +  +GHT  V C+++  +       +GS D T+ +W + 
Sbjct: 410 IVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWKLI 469

Query: 402 -----------------RTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDD 444
                                 + V RGH+  V+     TI    N+V   ISGS + + 
Sbjct: 470 KEEKFDGELPMVYNTPEENPYFVGVLRGHMASVR-----TISGHGNIV---ISGSYDNNL 521

Query: 445 EPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV----QTGQC- 499
                             +   +   D         +S S+D+TIK+WD+      G C 
Sbjct: 522 MVWDIAQMKCLYVLIGHTDRIYSTIYDHK---RQRCISASMDSTIKVWDLDNIWNNGNCT 578

Query: 500 ---------------IRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 544
                          + T  GH   V  +   +  ++S + DGS++ WD        ++H
Sbjct: 579 IITNSATPCTKITGSMLTLQGHTALVGLLRLSDKYLVSAAADGSLRGWDSNDYSRKFSYH 638

Query: 545 GKRL 548
              L
Sbjct: 639 HNNL 642

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 101/230 (43%), Gaps = 18/230 (7%)

Query: 327 STYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKS 384
           +T  GH  SV++   F+   +++G+ D+ ++I+   S+     L GH   V  +K     
Sbjct: 349 TTLTGHATSVVTCLQFEDDYVITGADDRQLRIYDARSKKFLKELSGHEGGVWALKYDADG 408

Query: 385 FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVV---DN------ 435
               SGS D ++R+WDI+   C  VF+GH   V+ +  +T  + + +V    DN      
Sbjct: 409 I-IVSGSTDRSVRIWDIKRGCCTHVFKGHTSTVRCLEIVTYKNMKYIVTGSRDNTLHVWK 467

Query: 436 ISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQ 495
           +    + D E                       ++     +   ++S S DN + +WD+ 
Sbjct: 468 LIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHGNIVISGSYDNNLMVWDIA 527

Query: 496 TGQCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDL----QSGKC 539
             +C+    GH + ++    D+   R IS S D +IK+WDL     +G C
Sbjct: 528 QMKCLYVLIGHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNC 577

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 55/125 (44%), Gaps = 27/125 (21%)

Query: 251 GHMDGVLTLQFNYRLL--FTGSYDSTVAIWDL------------------CS--NKLIRR 288
           GH D + +  ++++     + S DST+ +WDL                  C+     +  
Sbjct: 537 GHTDRIYSTIYDHKRQRCISASMDSTIKVWDLDNIWNNGNCTIITNSATPCTKITGSMLT 596

Query: 289 LSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF---KKI 345
           L GHT  V  L   +  LV+ + D ++R W+  + +    +  H +++ ++  F     I
Sbjct: 597 LQGHTALVGLLRLSDKYLVSAAADGSLRGWD--SNDYSRKFSYHHNNLSAITTFYMNDNI 654

Query: 346 IVSGS 350
           +VSGS
Sbjct: 655 LVSGS 659

>Kwal_23.5035
          Length = 744

 Score =  114 bits (285), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 101/369 (27%), Positives = 159/369 (43%), Gaps = 74/369 (20%)

Query: 94  SNDKLRKLILDGILASSCFPQLSYISSQVSNMIRIDFISILPQELSLKILSYLDCQSLCN 153
           S+   R L+   +++     +LS + + V + ++ DFI+ LP E+S+ IL+ L  + +  
Sbjct: 227 SDSAYRNLVFQ-LISKLSRSELSDLGTLVKDNLKRDFITSLPLEVSMNILTNLGFEDISR 285

Query: 154 ATKVCRKWQ-ILADDDRVWYHMC---------EQHIDRKCP---NCGWGLPLLH--MKRA 198
              V + W  ++ D   +W  +          E H   + P   N G     LH    R 
Sbjct: 286 CLSVSKAWNSLIRDTSYLWRTLLVTENFITVEEYHKYSQGPQQLNSGH----LHEDFFRL 341

Query: 199 RFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLT 258
            F++N +                ++ W   Y  +FK      +G+         M  V  
Sbjct: 342 HFMENRA---------------YLKNW---YDSKFKPHRTTLRGHT--------MKIVTC 375

Query: 259 LQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKTIRV 317
           LQF    + TG+ D  + ++D  + K I +LSGH  GV  L Y  +  LV+GS D+++RV
Sbjct: 376 LQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGILVSGSTDRSVRV 435

Query: 318 WNYKTGECISTYRGHTDSVMSVDAF----KKIIVSGSADKTVKIWHVES--------RTC 365
           WN K+G+C   ++GHT +V  +D      KK IV+GS D T+ +W + +          C
Sbjct: 436 WNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWKLPNCNAEDYNPEVC 495

Query: 366 Y-------------TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
                          LRGH   V  V  H       SGS D  + +WDI    CL V  G
Sbjct: 496 EVFNTTDANPYFVGVLRGHMAAVRTVSGHGN--IVVSGSYDFNLMVWDIAQMKCLYVLTG 553

Query: 413 HVGQVQKVI 421
           H  ++   I
Sbjct: 554 HTDRIYSTI 562

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 82/187 (43%), Gaps = 23/187 (12%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--E 303
           V   +GHM  V T+  +  ++ +GSYD  + +WD+   K +  L+GHTD + +  +D   
Sbjct: 508 VGVLRGHMAAVRTVSGHGNIVVSGSYDFNLMVWDIAQMKCLYVLTGHTDRIYSTIYDYQR 567

Query: 304 AKLVTGSLDKTIRVWNY----KTGECIS----------------TYRGHTDSVMSVDAFK 343
            + ++  +D T++VW+     K G C +                T +GHT  V  +    
Sbjct: 568 NRCISAGMDSTVKVWDLADVSKNGPCTTITSSNNPCTKVTGSSITLQGHTALVGLLGLSD 627

Query: 344 KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           K +VS  AD  ++ W  E+ T      H +       +       SGS+     ++++R+
Sbjct: 628 KFLVSAGADGILRGWDSENYTRQFAYHHKDLSAITTFYVNDNILVSGSEG-NFNIYNLRS 686

Query: 404 NSCLKVF 410
              +  +
Sbjct: 687 GKLIHSY 693

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 98/232 (42%), Gaps = 20/232 (8%)

Query: 327 STYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKS 384
           +T RGHT  +++   F+   +++G+ DK ++++  ++    T L GH   V  +K +   
Sbjct: 363 TTLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALK-YGHD 421

Query: 385 FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQ---------KVIPLTIIDAENLVVDN 435
               SGS D ++R+W+I++  C  VF+GH   V+         K   +T      L V  
Sbjct: 422 GILVSGSTDRSVRVWNIKSGKCTHVFKGHTSTVRCLDIVEHNGKKFIVTGSRDHTLHVWK 481

Query: 436 ISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQ--TLDKSIPYPTHLLSCSLDNTIKLWD 493
           +   N  D  P                         +     +   ++S S D  + +WD
Sbjct: 482 LPNCNAEDYNPEVCEVFNTTDANPYFVGVLRGHMAAVRTVSGHGNIVVSGSYDFNLMVWD 541

Query: 494 VQTGQCIRTQFGHVEGVWDIAAD--NFRIISGSHDGSIKIWDL----QSGKC 539
           +   +C+    GH + ++    D    R IS   D ++K+WDL    ++G C
Sbjct: 542 IAQMKCLYVLTGHTDRIYSTIYDYQRNRCISAGMDSTVKVWDLADVSKNGPC 593

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRI-ISGSHDGSIKIWDLQSG 537
           ++++ + D  I+++D +T + I    GH  GVW +   +  I +SGS D S+++W+++SG
Sbjct: 382 YVITGADDKMIRVYDAKTEKFITQLSGHDGGVWALKYGHDGILVSGSTDRSVRVWNIKSG 441

Query: 538 KCMHTFHG 545
           KC H F G
Sbjct: 442 KCTHVFKG 449

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (58%)

Query: 505 GHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           GH+  V  ++     ++SGS+D ++ +WD+   KC++   G
Sbjct: 513 GHMAAVRTVSGHGNIVVSGSYDFNLMVWDIAQMKCLYVLTG 553

>Kwal_23.6324
          Length = 514

 Score =  107 bits (267), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 98/341 (28%), Positives = 146/341 (42%), Gaps = 39/341 (11%)

Query: 227 VIYRER--FKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRL---LFTGSYDSTVAIWDLC 281
           ++Y  R  FKV    R  +       GH   +L   F       + TGS D+T  IWD  
Sbjct: 118 IVYTPRAVFKVRPVTRSSSA----IAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDCN 173

Query: 282 SNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECIS-TYRGHTDSVMS 338
           +N  +  L GH + V  + +  D   + TGS+D TIR+W+   GE      RGH   + S
Sbjct: 174 TNTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITS 233

Query: 339 VD---------AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCF 388
           +            +  + S S D T+KIW    R C  TL GHT  V+CVK   +    +
Sbjct: 234 LTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGI-LY 292

Query: 389 SGSDDTTIRMWDIRTNS-CLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPX 447
           SGS D TIR WD+     C+ + + H   +     L++     L V     + E    P 
Sbjct: 293 SGSHDKTIRAWDMAAGGKCINILKSHAHWINH---LSLNTDYALRVGAFDHTGEKPSSPE 349

Query: 448 XXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWD-VQTGQCIRTQFGH 506
                           + + + L         +++ S D T+ LWD ++  + I    GH
Sbjct: 350 EARAKALKNYEKIAKKNGQLEEL---------MVTASDDFTMYLWDPLKASKPITRMTGH 400

Query: 507 VEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
            + V  +A   D   I+S S D SIK+WD ++G  + TF G
Sbjct: 401 QKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRG 441

 Score = 93.2 bits (230), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 87/324 (26%), Positives = 149/324 (45%), Gaps = 50/324 (15%)

Query: 243 NCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNK---LIRRLSGHTDGVK 297
           N  +   KGH + VL + +  +  L+ TGS D+T+ +WD  SNK       L GH   + 
Sbjct: 175 NTPMYTLKGHFNWVLCVAWCPDGELIATGSMDNTIRLWD--SNKGESYGEALRGHAKWIT 232

Query: 298 TLYF---------DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD-AFKKIIV 347
           +L +         D+ +L + S D TI++W+     C+ T  GHT+SV  V    + I+ 
Sbjct: 233 SLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGILY 292

Query: 348 SGSADKTVKIWHVES--RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
           SGS DKT++ W + +  +    L+ H  W+N + L+   +    G+ D T         +
Sbjct: 293 SGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLN-TDYALRVGAFDHTGEKPSSPEEA 351

Query: 406 CLKVFRGHV------GQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXX 459
             K  + +       GQ+++++     D    + D +  S     +P             
Sbjct: 352 RAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKAS-----KPITRMTG------- 399

Query: 460 XXXNDEENQTLDKSI---PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-- 514
                  +Q L   +   P   +++S S DN+IKLWD + G  I T  GHV  V+ +A  
Sbjct: 400 -------HQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQVAWS 452

Query: 515 ADNFRIISGSHDGSIKIWDLQSGK 538
           +D   ++S S D ++K+WD+++ K
Sbjct: 453 SDCRLLVSCSKDTTLKVWDVRTKK 476

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 96/234 (41%), Gaps = 54/234 (23%)

Query: 241 KGNCQVQEFKGHMDGVLTLQF---------NYRLLFTGSYDSTVAIWDLCSNKLIRRLSG 291
           KG    +  +GH   + +L +         +   L + S D T+ IWD      +  LSG
Sbjct: 216 KGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLASASKDGTIKIWDTTRRVCVLTLSG 275

Query: 292 HTDGVKTL-YFDEAKLVTGSLDKTIRVWNYKTG-ECISTYRGH----------TDSVMSV 339
           HT+ V  + +     L +GS DKTIR W+   G +CI+  + H          TD  + V
Sbjct: 276 HTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRV 335

Query: 340 DAF-------------------------------KKIIVSGSADKTVKIWHV--ESRTCY 366
            AF                               ++++V+ S D T+ +W     S+   
Sbjct: 336 GAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPIT 395

Query: 367 TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
            + GH + VN V   P      S S D +I++WD R  + +  FRGHV  V +V
Sbjct: 396 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQV 449

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 94/223 (42%), Gaps = 49/223 (21%)

Query: 246 VQEFKGHMDGVLTLQFNYR-LLFTGSYDSTVAIWDL-----CSNKL------IRRLSGHT 293
           V    GH + V  +++  R +L++GS+D T+  WD+     C N L      I  LS +T
Sbjct: 270 VLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAGGKCINILKSHAHWINHLSLNT 329

Query: 294 D-----------GVKTLYFDEAK--------------------LVTGSLDKTIRVWN-YK 321
           D           G K    +EA+                    +VT S D T+ +W+  K
Sbjct: 330 DYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLK 389

Query: 322 TGECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNC 377
             + I+   GH   V  V AF    + IVS S D ++K+W   + T   T RGH   V  
Sbjct: 390 ASKPITRMTGHQKLVNHV-AFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQ 448

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           V          S S DTT+++WD+RT        GH  +V  V
Sbjct: 449 VAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTV 491

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 6/124 (4%)

Query: 241 KGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT 298
           K +  +    GH   V  + F  + R + + S+D+++ +WD  +   I    GH   V  
Sbjct: 389 KASKPITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRNGTFIATFRGHVASVYQ 448

Query: 299 LYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKT 354
           + +  D   LV+ S D T++VW+ +T +      GH D V +VD     K + S   DK 
Sbjct: 449 VAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSVDGKRVCSAGKDKM 508

Query: 355 VKIW 358
           V+IW
Sbjct: 509 VRIW 512

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 45/79 (56%), Gaps = 4/79 (5%)

Query: 246 VQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ + KL   L GH D V T+ +  
Sbjct: 436 IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHNDEVYTVDWSV 495

Query: 302 DEAKLVTGSLDKTIRVWNY 320
           D  ++ +   DK +R+W +
Sbjct: 496 DGKRVCSAGKDKMVRIWTH 514

>AGL024W [4287] [Homologous to ScYFL009W (CDC4) - SH; ScYER066W -
           NSH] complement(667539..669809) [2271 bp, 756 aa]
          Length = 756

 Score =  107 bits (268), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 94/345 (27%), Positives = 149/345 (43%), Gaps = 64/345 (18%)

Query: 114 QLSYISSQVSNMIRIDFISILPQELSLKILSYLDCQSLCNATKVCRKWQ-ILADDDRVWY 172
           +LS +S+ + + ++ DF+  LP E+S+ IL+ LD + +C+   V R W  ++ +   +W 
Sbjct: 242 ELSDLSTYLKDHLKRDFLQYLPMEVSMNILNNLDFEDICSCLLVNRTWNNLIRNSPYLWK 301

Query: 173 HM--CEQHIDRKC--PNCGWGLPLLHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVI 228
           HM   E  +   C    C   +P  H    R + N S                   +++ 
Sbjct: 302 HMMLSEGFVTEDCFSSYCD-SIPEKH----RHLPNPS-----------------DRFRLD 339

Query: 229 YRERFKVESNW-----RKGNCQVQEFKGHMDGVLT-LQFNYRLLFTGSYDSTVAIWDLCS 282
           + E   +  NW     R G   +    GH   V+T  QF    + TG+ D  + ++D   
Sbjct: 340 FLENRWLLENWCNPCYRPGRTCLD---GHRTKVVTCFQFEGNYIITGADDKRINVYDADR 396

Query: 283 NKLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDA 341
            +    L GH  GV  L Y  +  LV+GS D+T+R+WN K G+C   +RGHT +V  +D 
Sbjct: 397 EQFKLELVGHEGGVWALKYAGDEILVSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDV 456

Query: 342 FK----KIIVSGSADKTVKIWH-------------------VESRTCY--TLRGHTEWVN 376
            +    K +V+GS D T+ +W                    +E    +   LRGH   V 
Sbjct: 457 VEHGGIKYVVTGSRDNTLHVWKLPDPNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVR 516

Query: 377 CVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI 421
            V  H       SGS D  + +WDI     L V  GH  ++   +
Sbjct: 517 TVSGHGN--IVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTL 559

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 123/299 (41%), Gaps = 54/299 (18%)

Query: 289 LSGHTDGVKTLY-FDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD-AFKKII 346
           L GH   V T + F+   ++TG+ DK I V++    +      GH   V ++  A  +I+
Sbjct: 362 LDGHRTKVVTCFQFEGNYIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEIL 421

Query: 347 VSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKL--HPKSFTCFSGSDDTTIRMW---- 399
           VSGS D+TV+IW+V++  C +  RGHT  V C+ +  H       +GS D T+ +W    
Sbjct: 422 VSGSTDRTVRIWNVKAGKCTHVFRGHTSTVRCLDVVEHGGIKYVVTGSRDNTLHVWKLPD 481

Query: 400 ----DIRTNSC------------LKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGD 443
               D   N+             + V RGH+  V+     T+    N+VV   SGS + +
Sbjct: 482 PNSPDYNPNAMRQFNSIEDNPFFVGVLRGHMASVR-----TVSGHGNIVV---SGSYDHN 533

Query: 444 DEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV--------- 494
                              +   +   D         +S S+D T+K+WD+         
Sbjct: 534 LMVWDIAKMKLLYVLTGHTDRIYSTLYDHK---RKRCISASMDTTVKVWDLSDINNNGPV 590

Query: 495 ---------QTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 544
                    +    +RT  GH   V  +   +  ++S + DGS++ WD        +FH
Sbjct: 591 SQINSTSALKVSGSVRTLCGHTALVGLLGLSDKYLVSAAADGSLRGWDASDYSKRFSFH 649

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 78/178 (43%), Gaps = 21/178 (11%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--E 303
           V   +GHM  V T+  +  ++ +GSYD  + +WD+   KL+  L+GHTD + +  +D   
Sbjct: 505 VGVLRGHMASVRTVSGHGNIVVSGSYDHNLMVWDIAKMKLLYVLTGHTDRIYSTLYDHKR 564

Query: 304 AKLVTGSLDKTIRVWN------------------YKTGECISTYRGHTDSVMSVDAFKKI 345
            + ++ S+D T++VW+                   K    + T  GHT  V  +    K 
Sbjct: 565 KRCISASMDTTVKVWDLSDINNNGPVSQINSTSALKVSGSVRTLCGHTALVGLLGLSDKY 624

Query: 346 IVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           +VS +AD +++ W     +      HT                SGS+     ++D+RT
Sbjct: 625 LVSAAADGSLRGWDASDYSKRFSFHHTNQSAITTFFVSDNILVSGSEH-QFNIYDLRT 681

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 3/69 (4%)

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQS 536
           ++++ + D  I ++D    Q      GH  GVW +  A D   ++SGS D +++IW++++
Sbjct: 379 YIITGADDKRINVYDADREQFKLELVGHEGGVWALKYAGDEI-LVSGSTDRTVRIWNVKA 437

Query: 537 GKCMHTFHG 545
           GKC H F G
Sbjct: 438 GKCTHVFRG 446

>Sklu_2173.2 YCR072C, Contig c2173 2732-4279
          Length = 515

 Score =  105 bits (262), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 99/371 (26%), Positives = 152/371 (40%), Gaps = 61/371 (16%)

Query: 230 RERFKVESNWRKGNCQVQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSNKLI 286
           R  FKV+   R  +       GH   +L   F       + TG+ D+T  IWD  +   +
Sbjct: 124 RAVFKVKPVTRSSSA----IAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPM 179

Query: 287 RRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECIS-TYRGHTDSVMSVD--- 340
             L GH + V  + +  D   + TGS+D TIR+W    G+ +    RGH   + S+    
Sbjct: 180 STLKGHFNWVLCVSWSPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEP 239

Query: 341 ------AFKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDD 393
                   K  + S S D T+KIW    R C  TL GHT  V+C+K   +    +SGS D
Sbjct: 240 IHLVKPGQKPRLASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGV-LYSGSHD 298

Query: 394 TTIRMWDIRTNS-CLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXX 452
            TIR WD+     C+ + + H   V     L++     L +     ++E    P      
Sbjct: 299 KTIRAWDMNLGGKCINILKSHAHWVNH---LSLSTDYALRIGAFDHTSEKPSTPEEAQKR 355

Query: 453 XXXXXXXXXXNDEENQTL------------------DKSI----------------PYPT 478
                      + E + L                   K I                P   
Sbjct: 356 ALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGR 415

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQS 536
           H++S S DN+IKLW+ + G+ I T  GHV  V+ +A  +D   ++S S D ++K+WD+++
Sbjct: 416 HIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKT 475

Query: 537 GKCMHTFHGKR 547
            K      G +
Sbjct: 476 KKLAVDLPGHK 486

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 76/141 (53%), Gaps = 6/141 (4%)

Query: 265 LLFTGSYDSTVAIWD-LCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           L+ T S D T+ +W+ L S K I R++GH   V  + F  D   +V+ S D +I++WN +
Sbjct: 373 LMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWNGR 432

Query: 322 TGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCV 378
            G+ IST+RGH  SV  V      +++VS S D T+K+W V+++     L GH + V  V
Sbjct: 433 DGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTV 492

Query: 379 KLHPKSFTCFSGSDDTTIRMW 399
                     SG  D  +R+W
Sbjct: 493 DWSVDGKRVCSGGKDKMVRLW 513

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 92/220 (41%), Gaps = 49/220 (22%)

Query: 249 FKGHMDGVLTLQFNYR-LLFTGSYDSTVAIWDL-----CSNKL------IRRLSGHTD-G 295
             GH   V  +++  + +L++GS+D T+  WD+     C N L      +  LS  TD  
Sbjct: 274 LSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYA 333

Query: 296 VKTLYFD------------------------------EAKLVTGSLDKTIRVWN-YKTGE 324
           ++   FD                              E  +VT S D T+ +WN  K+ +
Sbjct: 334 LRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTK 393

Query: 325 CISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHV-ESRTCYTLRGHTEWVNCVKL 380
            I+   GH   V  V AF    + IVS S D ++K+W+  + +   T RGH   V  V  
Sbjct: 394 PITRMTGHQKLVNHV-AFSPDGRHIVSASFDNSIKLWNGRDGKFISTFRGHVASVYQVAW 452

Query: 381 HPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                   S S DTT+++WD++T        GH  +V  V
Sbjct: 453 SSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTV 492

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 246 VQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ + KL   L GH D V T+ +  
Sbjct: 437 ISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSV 496

Query: 302 DEAKLVTGSLDKTIRVWNY 320
           D  ++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRLWTH 515

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIW 532
           L+SCS D T+K+WDV+T +      GH + V+  D + D  R+ SG  D  +++W
Sbjct: 459 LVSCSKDTTLKVWDVKTKKLAVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513

>KLLA0D07546g complement(647984..649927) some similarities with
           sp|P07834 Saccharomyces cerevisiae YFL009w CDC4 cell
           division control protein, hypothetical start
          Length = 647

 Score =  106 bits (264), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 103/393 (26%), Positives = 168/393 (42%), Gaps = 80/393 (20%)

Query: 77  PAQEQAEIHHII-------SKFNKSNDKLRKLILDGILASSCFPQLSYISSQVSNMIRID 129
           P  E+  I  +I       S      + L  LI  G++++    QLS + S +++ ++ D
Sbjct: 92  PEVEEPSIDEVIGTTVARLSSTTSHPNALTSLIF-GLVSNMDRTQLSDLVSIITDNLKRD 150

Query: 130 FISILPQELSLKILSYLDCQSLCNATKVCRKWQILADDDRV---WYHMCEQHI-DRKCPN 185
               LP E+++KIL  L  + +     V R W  L ++  V   W  + E  + + + P+
Sbjct: 151 LFQSLPNEITVKILLNLSSEDIFACLLVNRNWNRLIEEAPVVWKWLMLNEGFVTEDQFPS 210

Query: 186 CGWGLPLLHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKV---ESNWRKG 242
               LP                             L+ P      +RF++   E+NW   
Sbjct: 211 YCNSLP------------------------SKYKHLINP-----DDRFRLDFLENNWCLQ 241

Query: 243 NCQVQEFK-------GHMDGVLT-LQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTD 294
           N     +K       GH   V+T LQF    + TG+ D  + ++D  ++  +  L+GH  
Sbjct: 242 NWYDPNYKPGRTCLDGHSTNVVTCLQFENNYIITGADDKKINVYDAENDLFLLELNGHEG 301

Query: 295 GVKTLYFDEAK-LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK----KIIVSG 349
           GV  L F + K LV+GS D+++R+WN +TG+C   ++GHT +V  ++  +    K IV+G
Sbjct: 302 GVWALKFVDGKILVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTG 361

Query: 350 SADKTVKIWHVES--------------RT-------CYTLRGHTEWVNCVKLHPKSFTCF 388
           S D T+ +W +                RT          LRGH   V  V  H +     
Sbjct: 362 SRDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGHGR--IVI 419

Query: 389 SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI 421
           SGS D  + +WDI +   L +  GH  +V   I
Sbjct: 420 SGSYDHNLMVWDIISMKLLYILTGHTDRVYSTI 452

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 75/303 (24%), Positives = 125/303 (41%), Gaps = 54/303 (17%)

Query: 289 LSGHTDGVKT-LYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK-KII 346
           L GH+  V T L F+   ++TG+ DK I V++ +    +    GH   V ++     KI+
Sbjct: 255 LDGHSTNVVTCLQFENNYIITGADDKKINVYDAENDLFLLELNGHEGGVWALKFVDGKIL 314

Query: 347 VSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKL--HPKSFTCFSGSDDTTIRMWDI-- 401
           VSGS D++V+IW++E+  C +  +GHT  V C+++  +  S    +GS D T+ +W +  
Sbjct: 315 VSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGSRDNTLHVWKLPP 374

Query: 402 --------------RTNS----CLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGD 443
                         RT       + V RGH+  V+ V           +V  ISGS + +
Sbjct: 375 MKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTV------SGHGRIV--ISGSYDHN 426

Query: 444 DEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQT------- 496
                              +   +   D         +S S+D T+ +WD++        
Sbjct: 427 LMVWDIISMKLLYILTGHTDRVYSTIYDYK---RNRCISASMDTTVMIWDLENIENNGTT 483

Query: 497 -----GQCIRT------QFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
                G  I+        +GH   V  +   N  ++S + DGSI+ WD        +FH 
Sbjct: 484 TTINDGASIKVVGSMKCLYGHTALVGLLCLSNKFLVSAAADGSIRGWDPNDYSRKFSFHH 543

Query: 546 KRL 548
             L
Sbjct: 544 TNL 546

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (49%), Gaps = 20/133 (15%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--E 303
           V   +GHM  V T+  + R++ +GSYD  + +WD+ S KL+  L+GHTD V +  +D   
Sbjct: 398 VGVLRGHMSSVRTVSGHGRIVISGSYDHNLMVWDIISMKLLYILTGHTDRVYSTIYDYKR 457

Query: 304 AKLVTGSLDKTIRVWNYKTGECIST------------------YRGHTDSVMSVDAFKKI 345
            + ++ S+D T+ +W+ +  E   T                    GHT  V  +    K 
Sbjct: 458 NRCISASMDTTVMIWDLENIENNGTTTTINDGASIKVVGSMKCLYGHTALVGLLCLSNKF 517

Query: 346 IVSGSADKTVKIW 358
           +VS +AD +++ W
Sbjct: 518 LVSAAADGSIRGW 530

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 102/234 (43%), Gaps = 20/234 (8%)

Query: 319 NYKTGE-CISTYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRT-CYTLRGHTEWV 375
           NYK G  C+    GH+ +V++   F+   I++G+ DK + ++  E+      L GH   V
Sbjct: 247 NYKPGRTCLD---GHSTNVVTCLQFENNYIITGADDKKINVYDAENDLFLLELNGHEGGV 303

Query: 376 NCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDN 435
             +K         SGS D ++R+W+I T  C  VF+GH   V+ +  +   D++ +V  +
Sbjct: 304 WALKFVDGKI-LVSGSTDRSVRIWNIETGKCTHVFKGHTSTVRCLEVVEYGDSKYIVTGS 362

Query: 436 ISGSNEGDDEPXXXXXXXXXXXXXXXXNDEEN-----------QTLDKSIPYPTHLLSCS 484
              +      P                  EEN            ++     +   ++S S
Sbjct: 363 RDNTLHVWKLPPMKELDKGSQEPIFYRTPEENPYFVGVLRGHMSSVRTVSGHGRIVISGS 422

Query: 485 LDNTIKLWDVQTGQCIRTQFGHVEGVWDIAAD--NFRIISGSHDGSIKIWDLQS 536
            D+ + +WD+ + + +    GH + V+    D    R IS S D ++ IWDL++
Sbjct: 423 YDHNLMVWDIISMKLLYILTGHTDRVYSTIYDYKRNRCISASMDTTVMIWDLEN 476

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 25/125 (20%)

Query: 249 FKGHMDGVLTLQFNYRL--LFTGSYDSTVAIWDL---------------CSNKLI---RR 288
             GH D V +  ++Y+     + S D+TV IWDL                S K++   + 
Sbjct: 441 LTGHTDRVYSTIYDYKRNRCISASMDTTVMIWDLENIENNGTTTTINDGASIKVVGSMKC 500

Query: 289 LSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK---KI 345
           L GHT  V  L      LV+ + D +IR W+    +    +  H  ++ ++ +F     I
Sbjct: 501 LYGHTALVGLLCLSNKFLVSAAADGSIRGWD--PNDYSRKFSFHHTNLAAITSFSMNDNI 558

Query: 346 IVSGS 350
           +VSGS
Sbjct: 559 LVSGS 563

>AER263C [2765] [Homologous to ScYCR072C - SH] (1118228..1119769)
           [1542 bp, 513 aa]
          Length = 513

 Score =  104 bits (259), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 141/321 (43%), Gaps = 50/321 (15%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTG 323
           + TG+ D+T  IWD  +   +  L GH++ V  + +  D   + TGS+D TIR+W+ + G
Sbjct: 157 MVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSEKG 216

Query: 324 ECIS-TYRGHTDSVMSVD---------AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHT 372
           + +    RGHT  + S+            K  + S S D T+KIW    R C YTL GHT
Sbjct: 217 QSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSGHT 276

Query: 373 EWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS-CLKVFRGHVGQVQKVIPLTIIDAENL 431
             V+C+K   ++   +S S D T+R WD+     C+ + + H   V   + L+   A  +
Sbjct: 277 SSVSCIKWGGRNV-LYSASHDRTVRCWDMAAGGKCINILKSHAHWVNH-LSLSTDYALRM 334

Query: 432 VVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHL----------- 480
              + +G+     E                    E   +  S  +  +L           
Sbjct: 335 GPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPIL 394

Query: 481 ---------------------LSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADN 517
                                +S S DN+IKLWD + G+ I T  GHV  V+ +A  +D 
Sbjct: 395 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDC 454

Query: 518 FRIISGSHDGSIKIWDLQSGK 538
             ++S S D ++K+WD+++ K
Sbjct: 455 RLLVSCSKDTTLKVWDVKTRK 475

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 62/125 (49%), Gaps = 11/125 (8%)

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVE 361
           +++VTG+ D T R+W+  T   + T +GH++ V+ V   A  ++I +GS D T+++W  E
Sbjct: 155 SRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVIATGSMDATIRLWDSE 214

Query: 362 SRTCY--TLRGHTEWVNCVKLHPKSFT-------CFSGSDDTTIRMWDIRTNSCLKVFRG 412
                   LRGHT+W+  +   P             S S D TI++WD     C+    G
Sbjct: 215 KGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSG 274

Query: 413 HVGQV 417
           H   V
Sbjct: 275 HTSSV 279

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 92/234 (39%), Gaps = 54/234 (23%)

Query: 241 KGNCQVQEFKGHMDGVLTLQFN---------YRLLFTGSYDSTVAIWDLCSNKLIRRLSG 291
           KG       +GH   + +L +             L + S D T+ IWD      I  LSG
Sbjct: 215 KGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIKIWDTTRRVCIYTLSG 274

Query: 292 HTDGVKTL-YFDEAKLVTGSLDKTIRVWNYKTG-ECISTYRGH----------TDSVMSV 339
           HT  V  + +     L + S D+T+R W+   G +CI+  + H          TD  + +
Sbjct: 275 HTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLSTDYALRM 334

Query: 340 DAF-------------------------------KKIIVSGSADKTVKIWHV--ESRTCY 366
             F                               ++++V+GS D T+ +W+    S+   
Sbjct: 335 GPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLKGSKPIL 394

Query: 367 TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
            + GH + VN V   P      S S D +I++WD R    +  FRGHV  V +V
Sbjct: 395 RMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQV 448

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 88/223 (39%), Gaps = 61/223 (27%)

Query: 327 STYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSF 385
           S +  HT S M         V+G+ D T +IW  +++T   TL+GH+ WV CV       
Sbjct: 147 SAFAPHTSSRM---------VTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGE 197

Query: 386 TCFSGSDDTTIRMWDIRTNSCLK-VFRGHVGQVQKVI--PLTIIDAENLVVDNISGSNEG 442
              +GS D TIR+WD      L    RGH   +  +   P+ ++              + 
Sbjct: 198 VIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLV--------------KP 243

Query: 443 DDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRT 502
            ++P                                 L S S D TIK+WD     CI T
Sbjct: 244 GEKP--------------------------------RLASASKDGTIKIWDTTRRVCIYT 271

Query: 503 QFGHVEGVWDIAADNFRII-SGSHDGSIKIWDLQS-GKCMHTF 543
             GH   V  I      ++ S SHD +++ WD+ + GKC++  
Sbjct: 272 LSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKCINIL 314

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 61/124 (49%), Gaps = 6/124 (4%)

Query: 241 KGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT 298
           KG+  +    GH   V  + F  + R + + S+D+++ +WD    K I    GH   V  
Sbjct: 388 KGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQ 447

Query: 299 LYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKT 354
           + +  D   LV+ S D T++VW+ KT +      GH D V +VD     K + SG  DK 
Sbjct: 448 VAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKM 507

Query: 355 VKIW 358
           V++W
Sbjct: 508 VRLW 511

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 91/223 (40%), Gaps = 49/223 (21%)

Query: 246 VQEFKGHMDGVLTLQFNYR-LLFTGSYDSTVAIWDL-----CSNKL------IRRLSGHT 293
           +    GH   V  +++  R +L++ S+D TV  WD+     C N L      +  LS  T
Sbjct: 269 IYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKCINILKSHAHWVNHLSLST 328

Query: 294 D-----------GVKTLYFDEAK--------------------LVTGSLDKTIRVWN-YK 321
           D           G K    ++A+                    +VTGS D T+ +WN  K
Sbjct: 329 DYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMVTGSDDFTMYLWNPLK 388

Query: 322 TGECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHV-ESRTCYTLRGHTEWVNC 377
             + I    GH   V  V AF    + IVS S D ++K+W   + +   T RGH   V  
Sbjct: 389 GSKPILRMTGHQKLVNHV-AFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQ 447

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           V          S S DTT+++WD++T        GH  +V  V
Sbjct: 448 VAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTV 490

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 246 VQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ + KL   L GH D V T+ +  
Sbjct: 435 IATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTVDWSV 494

Query: 302 DEAKLVTGSLDKTIRVWNY 320
           D  ++ +G  DK +R+W +
Sbjct: 495 DGKRVCSGGKDKMVRLWTH 513

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 10/76 (13%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQF-GHVEGVWDIA---------ADNFRIISGSHDGSI 529
           + + S+D TI+LWD + GQ +     GH + +  ++          +  R+ S S DG+I
Sbjct: 199 IATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTI 258

Query: 530 KIWDLQSGKCMHTFHG 545
           KIWD     C++T  G
Sbjct: 259 KIWDTTRRVCIYTLSG 274

>Scas_720.95
          Length = 515

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 96/342 (28%), Positives = 161/342 (47%), Gaps = 41/342 (11%)

Query: 227 VIYRER--FKVESNWRKGNCQVQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLC 281
           +IY  R  FKV+   R  +       GH   +L   F       + TG+ D+T  IWD  
Sbjct: 119 LIYTPRAVFKVKPVTRSSSA----IAGHGSTILCSAFAPNTSSRMVTGAGDNTARIWDCD 174

Query: 282 SNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECIS-TYRGHTDSVMS 338
           +      L+GH + V  + +  +   + TGS+D TIR+W+ K G+ +    RGH   + S
Sbjct: 175 TQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKWITS 234

Query: 339 VDAFKKI----------IVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTC 387
           + A++ I          + S S D T++IW +  R C YT+ GHT  V+C+K   +    
Sbjct: 235 L-AWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGI-I 292

Query: 388 FSGSDDTTIRMWDIRTNS-CLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEP 446
           +SGS D T+R+WD+  +  C+ + + H   V   + L+   A  +   + +G+     +P
Sbjct: 293 YSGSHDKTVRVWDMNADGKCINILKSHAHWVNH-LSLSTDYALRVGAFDHTGA-----QP 346

Query: 447 XXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWD-VQTGQCIRTQFG 505
                             ++N  L++       +++ S D T+ LW+ +++ + I    G
Sbjct: 347 ASAKDARDKALANYEKVVKKNGKLEE------LMVTASDDFTMFLWNPLKSNKPIARMTG 400

Query: 506 HVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           H + V  +A   D   I+S S D SIK+WD + GK + TF G
Sbjct: 401 HQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRG 442

 Score = 94.4 bits (233), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 153/332 (46%), Gaps = 44/332 (13%)

Query: 243 NCQVQEFK----GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNK-LIRRLSGHTDG 295
           +C  Q  K    GH + VL + +  N  ++ TGS D+T+ +WD    K L   L GH   
Sbjct: 172 DCDTQTPKATLTGHFNWVLCVSYCPNGEVIATGSMDNTIRLWDSKDGKPLGDALRGHLKW 231

Query: 296 VKTLYFD---------EAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD-AFKKI 345
           + +L ++           +L + S D TIR+W+     C+ T  GHT+SV  +  + + I
Sbjct: 232 ITSLAWEPIHLVKPGESPRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWSGQGI 291

Query: 346 IVSGSADKTVKIW--HVESRTCYTLRGHTEWVNCVKL---HPKSFTCFSGSDDTTIRMWD 400
           I SGS DKTV++W  + + +    L+ H  WVN + L   +      F  +        D
Sbjct: 292 IYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKD 351

Query: 401 IRTNSCL---KVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXX 457
            R  +     KV + + G++++++ +T  D   + + N   SN+    P           
Sbjct: 352 ARDKALANYEKVVKKN-GKLEELM-VTASDDFTMFLWNPLKSNK----PIARMTGHQKLV 405

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--A 515
                +           P   +++S S DN+IKLWD + G+ I T  GHV  V+ +A  A
Sbjct: 406 NHVAFS-----------PDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSA 454

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMHTFHGKR 547
           D   ++S S D ++K+WD+++ K      G +
Sbjct: 455 DCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHK 486

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 60/124 (48%), Gaps = 6/124 (4%)

Query: 241 KGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT 298
           K N  +    GH   V  + F  + R + + S+D+++ +WD    K I    GH   V  
Sbjct: 390 KSNKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQ 449

Query: 299 LYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKT 354
           + +  D   LV+ S D T++VW+ +T +      GH D V +VD     K + SG  DK 
Sbjct: 450 VAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKM 509

Query: 355 VKIW 358
           V+IW
Sbjct: 510 VRIW 513

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 94/220 (42%), Gaps = 49/220 (22%)

Query: 249 FKGHMDGVLTLQFNYR-LLFTGSYDSTVAIWDL-----CSNKL------IRRLSGHTD-G 295
             GH + V  ++++ + ++++GS+D TV +WD+     C N L      +  LS  TD  
Sbjct: 274 MSGHTNSVSCIKWSGQGIIYSGSHDKTVRVWDMNADGKCINILKSHAHWVNHLSLSTDYA 333

Query: 296 VKTLYFD------------------------------EAKLVTGSLDKTIRVWN-YKTGE 324
           ++   FD                              E  +VT S D T+ +WN  K+ +
Sbjct: 334 LRVGAFDHTGAQPASAKDARDKALANYEKVVKKNGKLEELMVTASDDFTMFLWNPLKSNK 393

Query: 325 CISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWH-VESRTCYTLRGHTEWVNCVKL 380
            I+   GH   V  V AF    + IVS S D ++K+W   + +   T RGH   V  V  
Sbjct: 394 PIARMTGHQKLVNHV-AFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAW 452

Query: 381 HPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                   S S DTT+++WD+RT        GH  +V  V
Sbjct: 453 SADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTV 492

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 246 VQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ + KL   L GH D V T+ +  
Sbjct: 437 ISTFRGHVASVYQVAWSADCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSV 496

Query: 302 DEAKLVTGSLDKTIRVWNY 320
           D  ++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

>KLLA0C08547g 749737..751284 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 515

 Score =  102 bits (254), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 100/365 (27%), Positives = 151/365 (41%), Gaps = 59/365 (16%)

Query: 227 VIYRER--FKVESNWRKGNCQVQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLC 281
           ++Y  R  FKV+   R  +       GH   +L   F       + TG+ D+T  IWD  
Sbjct: 119 LVYTPRAIFKVKPVTRSSSA----IAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDCD 174

Query: 282 SNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECIS-TYRGHTDSVMS 338
           +   +  L GH + V    +  D   + TGS+D TIR+W    G+      RGH+  + S
Sbjct: 175 TQTRMCTLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITS 234

Query: 339 VD---------AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCF 388
           +            K  + + S D T+KIW    R C  TL GHT  V+CVK   K+   +
Sbjct: 235 LSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNV-LY 293

Query: 389 SGSDDTTIRMWDIRTNS-CLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPX 447
           SGS D TIR WD+  N  C+ + + H   V   + L+   A  L   +  G      E  
Sbjct: 294 SGSHDKTIRCWDMNLNGKCINILKSHAHWVNH-LSLSTDYALRLGAFDHKGETPASPEEA 352

Query: 448 XXXXXXXXXXXXXXXNDEENQTLDKS--------------------------------IP 475
                           D E   +  S                                 P
Sbjct: 353 QQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP 412

Query: 476 YPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWD 533
              +++S S DN+IKLWD + G+ + T  GHV  V+ +A  +D   ++S S D ++K+WD
Sbjct: 413 DGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 472

Query: 534 LQSGK 538
           +++ K
Sbjct: 473 VKTRK 477

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 82/205 (40%), Gaps = 54/205 (26%)

Query: 346 IVSGSADKTVKIWH--VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI-R 402
           +V+G+ D T  IW    ++R C TL+GH  WV C    P      +GS D TIR+W+  +
Sbjct: 159 MVTGAGDNTACIWDCDTQTRMC-TLQGHHNWVLCCSWSPDGELIATGSMDNTIRLWESSK 217

Query: 403 TNSCLKVFRGHVGQVQKVI--PLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXX 460
                   RGH   +  +   P+ ++              +  D+P              
Sbjct: 218 GKPYGDALRGHSKWITSLSWEPIHLV--------------KPGDKP-------------- 249

Query: 461 XXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRI 520
                              L + S D TIK+WD     C+ T  GH   V  +      +
Sbjct: 250 ------------------RLATASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWGGKNV 291

Query: 521 I-SGSHDGSIKIWDLQ-SGKCMHTF 543
           + SGSHD +I+ WD+  +GKC++  
Sbjct: 292 LYSGSHDKTIRCWDMNLNGKCINIL 316

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +    GH   V  + F  + R + + S+D+++ +WD    K +    GH   V  + +  
Sbjct: 395 ITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSS 454

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIW 358
           D   LV+ S D T++VW+ KT +      GH D V +VD     K + SG  DK V+IW
Sbjct: 455 DCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 91/218 (41%), Gaps = 49/218 (22%)

Query: 251 GHMDGVLTLQFNYR-LLFTGSYDSTVAIWDL-----CSNKL------IRRLSGHTD-GVK 297
           GH   V  +++  + +L++GS+D T+  WD+     C N L      +  LS  TD  ++
Sbjct: 276 GHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALR 335

Query: 298 TLYFD------------------------------EAKLVTGSLDKTIRVWN-YKTGECI 326
              FD                              E  +VT S D T+ +WN  K+ + I
Sbjct: 336 LGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPI 395

Query: 327 STYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWH-VESRTCYTLRGHTEWVNCVKLHP 382
           +   GH   V  V AF    + IVS S D ++K+W   + +   T RGH   V  V    
Sbjct: 396 TRMTGHQKLVNHV-AFSPDGRYIVSASFDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSS 454

Query: 383 KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                 S S DTT+++WD++T        GH  +V  V
Sbjct: 455 DCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 492

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 246 VQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ + KL   L GH D V T+ +  
Sbjct: 437 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSV 496

Query: 302 DEAKLVTGSLDKTIRVWNY 320
           D  ++ +G  DK +R+W +
Sbjct: 497 DGKRVCSGGKDKMVRIWTH 515

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIW 532
           L+SCS D T+K+WDV+T +      GH + V+  D + D  R+ SG  D  ++IW
Sbjct: 459 LVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMVRIW 513

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 10/76 (13%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQF-GHVEGVWDIA---------ADNFRIISGSHDGSI 529
           + + S+DNTI+LW+   G+       GH + +  ++          D  R+ + S DG+I
Sbjct: 201 IATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLATASKDGTI 260

Query: 530 KIWDLQSGKCMHTFHG 545
           KIWD     C+ T  G
Sbjct: 261 KIWDTTRRVCLLTLCG 276

>Scas_721.115*
          Length = 318

 Score = 99.4 bits (246), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 95/189 (50%), Gaps = 17/189 (8%)

Query: 249 FKGHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKL-----IRRLSGHTDGVK--T 298
            +GH   V +L  +     LL +GS D T+  W L  +       +R   GH+  V+  T
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 299 LYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVK 356
           L  D A  ++ S DKT+R+W+  TGE    + GH   VMSV  D    +I+SGS DKT+K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 357 IWHVESRTCYTLRGHTEWVNCVKLHPK-----SFTCFSGSDDTTIRMWDIRTNSCLKVFR 411
           +W ++ +   TL GH +WV+ V++ P      S T  S  +D  ++ W++        F 
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 412 GHVGQVQKV 420
           GH G V  V
Sbjct: 193 GHNGNVNTV 201

 Score = 65.1 bits (157), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 109/280 (38%), Gaps = 69/280 (24%)

Query: 289 LSGHTDGVKTLYFDEAK---LVTGSLDKTIRVW-----NYKTGECISTYRGHT----DSV 336
           L GH   V +L     +   L++GS DKT+  W     + K G  + +++GH+    D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 337 MSVDAFKKIIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTT 395
           ++ D      +S S DKT+++W V +   Y    GH   V  V +  K+    SGS D T
Sbjct: 73  LTQDG--AYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKT 130

Query: 396 IRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXX 455
           I++W I+   CL    GH   V +V               I+ +++ DD           
Sbjct: 131 IKVWTIK-GQCLATLLGHNDWVSQV--------------RIAPTDQNDDS---------- 165

Query: 456 XXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA 515
                                   ++S   D  +K W++   Q      GH   V  + A
Sbjct: 166 ----------------------VTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTA 203

Query: 516 --DNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDE 553
             D   I S   DG I +W+L   K M+T     L  QDE
Sbjct: 204 SPDGTLIASAGKDGEIMLWNLAEKKAMYT-----LSAQDE 238

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 87/210 (41%), Gaps = 28/210 (13%)

Query: 189 GLPLLHMK-RARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQ 247
           G+P+   K  +  V++ ++          S  K +R W V   E +             Q
Sbjct: 55  GVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETY-------------Q 101

Query: 248 EFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF---- 301
            F GH   V+++  + +  ++ +GS D T+ +W +   + +  L GH D V  +      
Sbjct: 102 RFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAPTD 160

Query: 302 ---DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVK 356
              D   +++   DK ++ WN    +  + + GH  +V +V A     +I S   D  + 
Sbjct: 161 QNDDSVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTVTASPDGTLIASAGKDGEIM 220

Query: 357 IWHV-ESRTCYTLRGHTEWVNCVKLHPKSF 385
           +W++ E +  YTL    E V  +   P  +
Sbjct: 221 LWNLAEKKAMYTLSAQDE-VFALAFSPNRY 249

>ACR137W [1184] [Homologous to ScYPL151C (PRP46) - SH]
           complement(590077..591354) [1278 bp, 425 aa]
          Length = 425

 Score =  100 bits (249), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/273 (28%), Positives = 114/273 (41%), Gaps = 60/273 (21%)

Query: 284 KLIRRLSGHTDGVKTL---YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MS 338
           KL R ++GHT  V+ +     D A   TGS D TIRVW+  TG+   T +GH  +V  + 
Sbjct: 104 KLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDIC 163

Query: 339 VDAFKKIIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIR 397
           + A    + S S DK VK W +E  T      G    V+ V LHP      S   D+ +R
Sbjct: 164 ISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVR 223

Query: 398 MWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXX 457
           +WDIR+ SC+    GH G + KV                                     
Sbjct: 224 VWDIRSRSCVLTLAGHRGPINKV------------------------------------- 246

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAAD- 516
                         + +P    ++SCS D T+KLWD+  G+ ++T   H   V D+A + 
Sbjct: 247 --------------RCLPVDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNP 292

Query: 517 -NFRIISGSHDGSIKIWDLQSGKCMHTFHGKRL 548
             F   S   D  I+ W L  G+ +  F+ + L
Sbjct: 293 TEFSFASACTD-DIRSWKLVDGQLLTNFNSEAL 324

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 76/158 (48%), Gaps = 5/158 (3%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKLVTGSLDKTIRVWNYKTGEC 325
           TGS DST+ +WDL + KL   L GH   V+ +        + + S DK ++ W+ +    
Sbjct: 131 TGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYMFSASQDKLVKCWDLERNTV 190

Query: 326 ISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHP 382
           +  + G    V SVD      +IVS   D  V++W + SR+C  TL GH   +N V+  P
Sbjct: 191 VRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLP 250

Query: 383 KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                 S S D T+++WD+     +K    H   V+ +
Sbjct: 251 VDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDL 288

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 94/211 (44%), Gaps = 47/211 (22%)

Query: 358 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCFS-GSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
           WH   +    + GHT WV CV + P     F+ GS+D+TIR+WD+ T       +GH+  
Sbjct: 99  WHAPWKLTRVINGHTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMT 158

Query: 417 VQKVI-----PLTIIDAE-----------NLVVDNISGSNEGDDEPXXXXXXXXXXXXXX 460
           V+ +      P     ++           N VV +  G+  G                  
Sbjct: 159 VRDICISARHPYMFSASQDKLVKCWDLERNTVVRDFHGTLSG------------------ 200

Query: 461 XXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH---VEGVWDIAADN 517
             + + + +LD        ++S   D+ +++WD+++  C+ T  GH   +  V  +  D 
Sbjct: 201 VHSVDLHPSLDL-------IVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDP 253

Query: 518 FRIISGSHDGSIKIWDLQSGKCMHTF-HGKR 547
            +I+S S D ++K+WDL +GK M T  H KR
Sbjct: 254 -QIVSCSTDATVKLWDLVAGKPMKTLTHHKR 283

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 52/99 (52%), Gaps = 6/99 (6%)

Query: 243 NCQVQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGH---TDGVK 297
           N  V++F G + GV  + L  +  L+ +   DS V +WD+ S   +  L+GH    + V+
Sbjct: 188 NTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVR 247

Query: 298 TLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV 336
            L  D  ++V+ S D T+++W+   G+ + T   H  +V
Sbjct: 248 CLPVD-PQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNV 285

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/154 (20%), Positives = 63/154 (40%), Gaps = 1/154 (0%)

Query: 270 SYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSL-DKTIRVWNYKTGECIST 328
           S D+TV +WDL + K ++ L+ H   V+ L F+  +    S     IR W    G+ ++ 
Sbjct: 259 STDATVKLWDLVAGKPMKTLTHHKRNVRDLAFNPTEFSFASACTDDIRSWKLVDGQLLTN 318

Query: 329 YRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCF 388
           +      +++  A  +  V  +   T ++   + +T +  +          L  +     
Sbjct: 319 FNSEALGIVNTLACNQDGVLFAGGDTGELSFFDYKTGHKFQKLETTAMPGSLESEKGVLA 378

Query: 389 SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP 422
           S  D T +R+     +  +K+++   G  Q   P
Sbjct: 379 STFDRTGLRLLTCERDKSIKIWKHIDGATQDSHP 412

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQD 552
           DN    +GS+D +I++WDL +GK   T  G  +  +D
Sbjct: 125 DNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRD 161

>Scas_592.4*
          Length = 318

 Score = 98.6 bits (244), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 63/189 (33%), Positives = 95/189 (50%), Gaps = 17/189 (8%)

Query: 249 FKGHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKL-----IRRLSGHTDGVK--T 298
            +GH   V +L  +     LL +GS D T+  W L  +       +R   GH+  V+  T
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 299 LYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVK 356
           L  D A  ++ S DKT+R+W+  TGE    + GH   VMSV  D    +I+SGS DKT+K
Sbjct: 73  LTQDGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKTIK 132

Query: 357 IWHVESRTCYTLRGHTEWVNCVKLHPK-----SFTCFSGSDDTTIRMWDIRTNSCLKVFR 411
           +W ++ +   TL GH +WV+ V++ P      + T  S  +D  ++ W++        F 
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLNQFQIEADFV 192

Query: 412 GHVGQVQKV 420
           GH G V  V
Sbjct: 193 GHNGNVNAV 201

 Score = 65.1 bits (157), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 109/280 (38%), Gaps = 69/280 (24%)

Query: 289 LSGHTDGVKTLYFDEAK---LVTGSLDKTIRVW-----NYKTGECISTYRGHT----DSV 336
           L GH   V +L     +   L++GS DKT+  W     + K G  + +++GH+    D  
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 337 MSVDAFKKIIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTT 395
           ++ D      +S S DKT+++W V +   Y    GH   V  V +  K+    SGS D T
Sbjct: 73  LTQDG--AYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGSRDKT 130

Query: 396 IRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXX 455
           I++W I+   CL    GH   V +V               I+ +++ DD           
Sbjct: 131 IKVWTIK-GQCLATLLGHNDWVSQV--------------RIAPTDQNDD----------- 164

Query: 456 XXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA 515
                                   ++S   D  +K W++   Q      GH   V  + A
Sbjct: 165 ---------------------AVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTA 203

Query: 516 --DNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDE 553
             D   I S   DG I +W+L   K M+T     L  QDE
Sbjct: 204 SPDGTLIASAGKDGEIMLWNLAEKKAMYT-----LSAQDE 238

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 87/210 (41%), Gaps = 28/210 (13%)

Query: 189 GLPLLHMK-RARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQ 247
           G+P+   K  +  V++ ++          S  K +R W V   E +             Q
Sbjct: 55  GVPVRSFKGHSHIVQDCTLTQDGAYALSASWDKTLRLWDVATGETY-------------Q 101

Query: 248 EFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF---- 301
            F GH   V+++  + +  ++ +GS D T+ +W +   + +  L GH D V  +      
Sbjct: 102 RFVGHKSDVMSVAIDRKASMIISGSRDKTIKVWTI-KGQCLATLLGHNDWVSQVRIAPTD 160

Query: 302 ---DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVK 356
              D   +++   DK ++ WN    +  + + GH  +V +V A     +I S   D  + 
Sbjct: 161 QNDDAVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNAVTASPDGTLIASAGKDGEIM 220

Query: 357 IWHV-ESRTCYTLRGHTEWVNCVKLHPKSF 385
           +W++ E +  YTL    E V  +   P  +
Sbjct: 221 LWNLAEKKAMYTLSAQDE-VFSLAFSPNRY 249

>YMR116C (ASC1) [4073] chr13
           complement(499455..499877,500151..500687) Ribosomal
           protein of the 40S ribosomal subunit that influences
           translational efficiency and cell size, contains two WD
           (WD-40) repeats [960 bp, 319 aa]
          Length = 319

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/183 (33%), Positives = 93/183 (50%), Gaps = 18/183 (9%)

Query: 249 FKGHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKL-----IRRLSGHTDGVK--T 298
            +GH   V +L  +     LL + S D T+  W L  +       +R   GH+  V+  T
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDCT 72

Query: 299 LYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVK 356
           L  D A  ++ S DKT+R+W+  TGE    + GH   VMSVD  KK  +I+SGS DKT+K
Sbjct: 73  LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIK 132

Query: 357 IWHVESRTCYTLRGHTEWVNCVKLHPK------SFTCFSGSDDTTIRMWDIRTNSCLKVF 410
           +W ++ +   TL GH +WV+ V++ P       S T  S  +D  ++ W++        F
Sbjct: 133 VWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADF 192

Query: 411 RGH 413
            GH
Sbjct: 193 IGH 195

 Score = 77.0 bits (188), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/190 (28%), Positives = 90/190 (47%), Gaps = 18/190 (9%)

Query: 233 FKVESNWRKGNCQVQEFKGH----MDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRR 288
           +K+  + +K    V+ FKGH     D  LT    Y L  + S+D T+ +WD+ + +  +R
Sbjct: 45  WKLTGDDQKFGVPVRSFKGHSHIVQDCTLTADGAYAL--SASWDKTLRLWDVATGETYQR 102

Query: 289 LSGHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV------- 339
             GH   V ++  D+  + +++GS DKTI+VW  K G+C++T  GH D V  V       
Sbjct: 103 FVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEK 161

Query: 340 -DAFKKIIVSGSADKTVKIWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIR 397
            D     I+S   DK VK W++ + +      GH   +N +   P      S   D  I 
Sbjct: 162 ADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIM 221

Query: 398 MWDIRTNSCL 407
           +W++     +
Sbjct: 222 LWNLAAKKAM 231

 Score = 51.2 bits (121), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 92/241 (38%), Gaps = 28/241 (11%)

Query: 328 TYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESR------TCYTLRGHTEWVNCV 378
           T  GH   V S+        +++S S DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHSHIVQDC 71

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            L        S S D T+R+WD+ T    + F GH   V  V     ID +  ++  ISG
Sbjct: 72  TLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSV----DIDKKASMI--ISG 125

Query: 439 SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTL----DKSIPYPTHLLSCSLDNTIKLWDV 494
           S   D                   ND  +Q      +K+      ++S   D  +K W++
Sbjct: 126 SR--DKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 495 QTGQCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQD 552
              Q      GH   +  + A  D   I S   DG I +W+L + K M+T     L  QD
Sbjct: 184 NQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYT-----LSAQD 238

Query: 553 E 553
           E
Sbjct: 239 E 239

>AFR199C [3391] [Homologous to ScYMR116C (ASC1) - SH]
           (799876..800298,800493..801074) [1005 bp, 334 aa]
          Length = 334

 Score = 95.5 bits (236), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 88/172 (51%), Gaps = 14/172 (8%)

Query: 265 LLFTGSYDSTVAIWDLCSNKL-----IRRLSGHTDGVK--TLYFDEAKLVTGSLDKTIRV 317
           +L +GS D T+  W L          +R   GH+  V+  T+  D    ++ S DKT+R+
Sbjct: 48  MLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRL 107

Query: 318 WNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWV 375
           W+ ++G+CI  + GH   VMSV  D     IVS S DKTVK+W+       TL GH +WV
Sbjct: 108 WDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWV 167

Query: 376 NCVKLHPK-----SFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP 422
           + V++ P      + T  S   D  +++WD+++ +    F GH   V  V P
Sbjct: 168 SNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTP 219

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 97/214 (45%), Gaps = 25/214 (11%)

Query: 208 ATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVL--TLQFNYRL 265
           A  N     S  K +  WK+   ++        +    V+ FKGH   V   T+  + + 
Sbjct: 44  AQPNMLLSGSRDKTLITWKLTGEDQ--------QYGVPVRSFKGHSHIVQDCTVTHDGKY 95

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKLVTGSLDKTIRVWNYKTG 323
             + S+D T+ +WDL S K I+R  GH   V ++  D    ++V+ S DKT++VWN   G
Sbjct: 96  ALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWN-TVG 154

Query: 324 ECISTYRGHTDSVMSV---------DAFKKIIVSGSADKTVKIWHVESRTCYT-LRGHTE 373
           +C+ T  GH D V +V         DA    ++S   DK VK+W ++S T      GH  
Sbjct: 155 DCVVTLLGHNDWVSNVRIAPSEKSDDAVT--VISAGMDKVVKVWDLQSFTIEADFIGHNN 212

Query: 374 WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCL 407
           +V  V   P      S   D  I +W++   + L
Sbjct: 213 YVTTVTPSPDGSIFASAGKDGQIILWNLNEKTAL 246

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 106/271 (39%), Gaps = 60/271 (22%)

Query: 289 LSGHTDGVKTLYFDEAK---LVTGSLDKTIRVW-----NYKTGECISTYRGHTDSVM--S 338
           L GH   V +L    A+   L++GS DKT+  W     + + G  + +++GH+  V   +
Sbjct: 29  LEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCT 88

Query: 339 VDAFKKIIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIR 397
           V    K  +S S DKT+++W ++S  C     GH   V  V + P++    S S D T++
Sbjct: 89  VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVK 148

Query: 398 MWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXX 457
           +W+     C+    GH   V  V               I+ S + DD             
Sbjct: 149 VWN-TVGDCVVTLLGHNDWVSNV--------------RIAPSEKSDD------------- 180

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AA 515
                                 ++S  +D  +K+WD+Q+        GH   V  +  + 
Sbjct: 181 -------------------AVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSP 221

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMHTFHGK 546
           D     S   DG I +W+L     ++T   K
Sbjct: 222 DGSIFASAGKDGQIILWNLNEKTALYTLDAK 252

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 91/235 (38%), Gaps = 70/235 (29%)

Query: 328 TYRGHTDSVMSVD---AFKKIIVSGSADKTVKIWHVESR------TCYTLRGHTEWV-NC 377
           T  GH   V S+    A   +++SGS DKT+  W +            + +GH+  V +C
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNIS 437
              H   +   S S D T+R+WD+++  C+K F GH   V  V                 
Sbjct: 88  TVTHDGKY-ALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSV----------------- 129

Query: 438 GSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTG 497
                                          ++D   P  T ++S S D T+K+W+   G
Sbjct: 130 -------------------------------SID---PRATQIVSASRDKTVKVWNT-VG 154

Query: 498 QCIRTQFGHVEGVWDI-------AADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
            C+ T  GH + V ++       + D   +IS   D  +K+WDLQS      F G
Sbjct: 155 DCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIG 209

 Score = 48.9 bits (115), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 469 TLDKSIPYPTHLLSCSLDNTIKLW-----DVQTGQCIRTQFGHVEGVWD--IAADNFRII 521
           +L  S   P  LLS S D T+  W     D Q G  +R+  GH   V D  +  D    +
Sbjct: 38  SLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYAL 97

Query: 522 SGSHDGSIKIWDLQSGKCMHTFHGKR 547
           S S D ++++WDLQSGKC+  F G +
Sbjct: 98  SASWDKTLRLWDLQSGKCIKRFVGHK 123

 Score = 48.1 bits (113), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 55/280 (19%), Positives = 102/280 (36%), Gaps = 77/280 (27%)

Query: 188 WGLPLLHMK-RARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQV 246
           +G+P+   K  +  V++ ++          S  K +R W +            + G C +
Sbjct: 70  YGVPVRSFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDL------------QSGKC-I 116

Query: 247 QEFKGHMDGVLTLQFNYRL--LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--- 301
           + F GH   V+++  + R   + + S D TV +W+   + ++  L GH D V  +     
Sbjct: 117 KRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLL-GHNDWVSNVRIAPS 175

Query: 302 ----DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTV 355
               D   +++  +DK ++VW+ ++    + + GH + V +V       I  S   D  +
Sbjct: 176 EKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQI 235

Query: 356 KIWHVESRTC-YTLRGHTEWVNCVKLHPKSF----------------------------- 385
            +W++  +T  YTL    E V  V   P  +                             
Sbjct: 236 ILWNLNEKTALYTLDAKDE-VFAVAFSPNRYWLTAATASGIKIFDLEERTIVDDLKPEFA 294

Query: 386 --------------------TCFSGSDDTTIRMWDIRTNS 405
                               T F+G  D  IR+W + T S
Sbjct: 295 GYNKAQDPHAVSLAWSADGQTLFAGYTDNIIRVWQVMTAS 334

>CAGL0J03476g 331933..333486 highly similar to sp|P25382
           Saccharomyces cerevisiae YCR072c, start by similarity
          Length = 517

 Score = 96.7 bits (239), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 145/336 (43%), Gaps = 37/336 (11%)

Query: 230 RERFKVESNWRKGNCQVQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSNKLI 286
           R  FKV+   R  +       GH   +L   F       + TG  D+T  IWD  +    
Sbjct: 126 RAVFKVKPITRSSSA----IAGHGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPK 181

Query: 287 RRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECIS-TYRGHTDSVMSV---- 339
             L+GH + V  + +  D   + TGS+D TIR+W+ ++G+ +    RGH+  + S+    
Sbjct: 182 VTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEP 241

Query: 340 -----DAFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDD 393
                   K  + S S D T++IW    R C  TL GHT  V+CVK   +    +SGS D
Sbjct: 242 IHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGI-LYSGSHD 300

Query: 394 TTIRMWDIRTNS-CLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXX 452
            T+R WD++ N  C+ + + H   V   + L+   A  +   + +G    + +       
Sbjct: 301 KTVRAWDMKQNGKCINILKSHAHWVNH-LSLSTDYALRVGAFDYTGVKPANAKEARDKAL 359

Query: 453 XXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTG-QCIRTQFGHVEGVW 511
                        E             +++ S D T+ LW+   G + I    GH + V 
Sbjct: 360 QNYEKVARKNGKHEEL-----------MVTASDDFTMFLWNPLKGTKPISRMTGHQKLVN 408

Query: 512 DIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
            +A   D   I+S S D SIK+WD + G  + TF G
Sbjct: 409 HVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRG 444

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 87/200 (43%), Gaps = 45/200 (22%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKTIRVWNYK-TG 323
           L + S D T+ IWD      +  L GHT+ V  + +  E  L +GS DKT+R W+ K  G
Sbjct: 253 LASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNG 312

Query: 324 ECISTYRGH----------TDSVMSVDAF------------------------------- 342
           +CI+  + H          TD  + V AF                               
Sbjct: 313 KCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKH 372

Query: 343 KKIIVSGSADKTVKIWHV--ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWD 400
           ++++V+ S D T+ +W+    ++    + GH + VN V   P      S S D +I++WD
Sbjct: 373 EELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWD 432

Query: 401 IRTNSCLKVFRGHVGQVQKV 420
            +  + L  FRGHV  V +V
Sbjct: 433 GKEGTFLSTFRGHVASVYQV 452

 Score = 71.2 bits (173), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 74/141 (52%), Gaps = 6/141 (4%)

Query: 265 LLFTGSYDSTVAIWD-LCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           L+ T S D T+ +W+ L   K I R++GH   V  + F  D   +V+ S D +I++W+ K
Sbjct: 375 LMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGK 434

Query: 322 TGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCV 378
            G  +ST+RGH  SV  V      +++VS S D T+K+W V++R     L GH + V  V
Sbjct: 435 EGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 494

Query: 379 KLHPKSFTCFSGSDDTTIRMW 399
                     SG  D  +R+W
Sbjct: 495 DWSVDGKRVCSGGKDKMMRLW 515

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 6/124 (4%)

Query: 241 KGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT 298
           KG   +    GH   V  + F  + + + + S+D+++ +WD      +    GH   V  
Sbjct: 392 KGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQ 451

Query: 299 LYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKT 354
           + +  D   LV+ S D T++VW+ KT +      GH D V +VD     K + SG  DK 
Sbjct: 452 VAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKM 511

Query: 355 VKIW 358
           +++W
Sbjct: 512 MRLW 515

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 46/79 (58%), Gaps = 4/79 (5%)

Query: 246 VQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +  F+GH+  V  + ++   RLL + S D+T+ +WD+ + KL   L GH D V T+ +  
Sbjct: 439 LSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSV 498

Query: 302 DEAKLVTGSLDKTIRVWNY 320
           D  ++ +G  DK +R+W +
Sbjct: 499 DGKRVCSGGKDKMMRLWTH 517

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIW 532
           L+SCS D T+K+WDV+T +      GH + V+  D + D  R+ SG  D  +++W
Sbjct: 461 LVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515

>AEL246C [2260] [Homologous to ScYBR198C (TAF90) - SH]
           (172849..175296) [2448 bp, 815 aa]
          Length = 815

 Score = 97.4 bits (241), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 125/295 (42%), Gaps = 76/295 (25%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLS-------------GHTDGVKTLYF--DEAKLVT 308
           RL+  G  DS + +W L    L  +L              GH+  V ++ F  D   LV+
Sbjct: 500 RLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVS 559

Query: 309 GSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESRTCY 366
            S DKT+R+W+  T  C+ +Y+GH   V  V          +GS D+T ++W  +    Y
Sbjct: 560 ASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLWSCDH--IY 617

Query: 367 TLR---GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPL 423
            LR   GH   V+CV  HP      +GS D T RMWDI+T   +++F   +G    V+  
Sbjct: 618 PLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF---LGHTASVV-- 672

Query: 424 TIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSC 483
                      +++ S +G                                     L + 
Sbjct: 673 -----------SVAVSPDG-----------------------------------RWLTTG 686

Query: 484 SLDNTIKLWDVQTGQCIRTQFGHVE-GVWDIA--ADNFRIISGSHDGSIKIWDLQ 535
           S D  I +WD+ TG+ I+   GH +  V+ ++   +   ++SG  D S+++WDL+
Sbjct: 687 SEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 70/265 (26%), Positives = 107/265 (40%), Gaps = 70/265 (26%)

Query: 300 YFDEAKLVT-GSLDKTIRVWNY-------------KTGECISTYRGHTDSVMSVD--AFK 343
           + D+++LV  G  D  I++W+              K      T  GH+  V SV      
Sbjct: 495 FSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDN 554

Query: 344 KIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
           + +VS S DKTV++W +++ TC  + +GH   V  VK  P      +GS D T R+W   
Sbjct: 555 RYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLW--- 611

Query: 403 TNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXX 462
             SC  ++           PL I       VD ++    G                    
Sbjct: 612 --SCDHIY-----------PLRIFAGHLNDVDCVTFHPNG-------------------- 638

Query: 463 NDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRI 520
                          T++L+ S D T ++WD+QTG  +R   GH   V  +A   D   +
Sbjct: 639 ---------------TYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWL 683

Query: 521 ISGSHDGSIKIWDLQSGKCMHTFHG 545
            +GS DG I +WD+ +GK +    G
Sbjct: 684 TTGSEDGVIIVWDIGTGKRIKQMRG 708

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 66/123 (53%), Gaps = 7/123 (5%)

Query: 249 FKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
           F GH++ V  +T   N   + TGS D T  +WD+ +   +R   GHT  V ++    D  
Sbjct: 622 FAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGR 681

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWHVE 361
            L TGS D  I VW+  TG+ I   RGH  S +   +F K   I+VSG AD++V++W ++
Sbjct: 682 WLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

Query: 362 SRT 364
             T
Sbjct: 742 KFT 744

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 81/170 (47%), Gaps = 7/170 (4%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--L 306
           GH   V ++ F  + R L + S D TV +W L +   +    GH   V  + F       
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRT 364
            TGS D+T R+W+      +  + GH + V  ++       +++GS+DKT ++W +++  
Sbjct: 600 ATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGD 659

Query: 365 CYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
              L  GHT  V  V + P      +GS+D  I +WDI T   +K  RGH
Sbjct: 660 SVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGH 709

>KLLA0E23529g 2088516..2090996 similar to sp|P38129 Saccharomyces
           cerevisiae YBR198c TAF90 TFIID and SAGA subunit, start
           by similarity
          Length = 826

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 121/297 (40%), Gaps = 80/297 (26%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKL-------------IRRLSGHTDGVKTLYF--DEAKLVT 308
           RL   G  DST+ +W L  + L                L GH+  V ++ F  D   L++
Sbjct: 511 RLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLS 570

Query: 309 GSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESRTCY 366
            S DKT+R+W+  T  C+  Y+GH   V  V         ++ S D+T ++W  +    Y
Sbjct: 571 ASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDH--IY 628

Query: 367 TLR---GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPL 423
            LR   GH   V+C   HP     F+GS D T RMWDI+T   +++F GH        P+
Sbjct: 629 PLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTS------PV 682

Query: 424 TIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSC 483
           T ++                                               P    L + 
Sbjct: 683 TALEVS---------------------------------------------PDGRWLTTG 697

Query: 484 SLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDLQ 535
           S D TI +WD+ TG+ I+   GH  G   I +  F      +++G  D S+++WD++
Sbjct: 698 SEDGTIIVWDIGTGKRIKQMKGH--GKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 110/272 (40%), Gaps = 74/272 (27%)

Query: 300 YFDEAKL-VTGSLDKTIRVWNYKTGECI--------------STYRGHTDSVMSVDAFK- 343
           + D+A+L   G  D TI+VW Y  G  +              +T  GH+  V SV AF  
Sbjct: 506 FSDDARLTAAGFQDSTIKVW-YLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSV-AFSP 563

Query: 344 --KIIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWD 400
             + ++S S DKTV++W +++ TC    +GH   V  VK  P      + S D T R+W 
Sbjct: 564 DNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLW- 622

Query: 401 IRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXX 460
               SC  ++           PL I                                   
Sbjct: 623 ----SCDHIY-----------PLRIFSGH------------------------------- 636

Query: 461 XXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNF 518
             ND +  T     P   ++ + S D T ++WD+QTG  +R   GH   V   +++ D  
Sbjct: 637 -LNDVDCSTFH---PNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGR 692

Query: 519 RIISGSHDGSIKIWDLQSGKCMHTFHGKRLQP 550
            + +GS DG+I +WD+ +GK +    G    P
Sbjct: 693 WLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNP 724

 Score = 68.9 bits (167), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 82/162 (50%), Gaps = 8/162 (4%)

Query: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV--KTLYFDEA 304
           +KGH   V  ++F+       T S+D T  +W       +R  SGH + V   T + +  
Sbjct: 591 YKGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGC 650

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES 362
            + TGS DKT R+W+ +TG+ +  + GHT  V  + V    + + +GS D T+ +W + +
Sbjct: 651 YVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 363 -RTCYTLRGHTE-WVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
            +    ++GH +  +  +  + +     +G  D ++R+WDI+
Sbjct: 711 GKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 68.6 bits (166), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (46%), Gaps = 30/182 (16%)

Query: 249 FKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
           F GH++ V   T   N   +FTGS D T  +WD+ +   +R   GHT  V  L    D  
Sbjct: 633 FSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGR 692

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWHVE 361
            L TGS D TI VW+  TG+ I   +GH  + +    F K    +V+G AD++V++W ++
Sbjct: 693 WLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

Query: 362 SRTCYTLRGHTEWVNCVKLHP-KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                       + N   + P + F  +SG         ++  N+ +K F    G+ + V
Sbjct: 753 -----------RFTNEPGMEPEQQFNTYSGD-------MELSVNNDIKEF----GRRRAV 790

Query: 421 IP 422
           IP
Sbjct: 791 IP 792

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 81/171 (47%), Gaps = 9/171 (5%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--L 306
           GH   V ++ F  + R L + S D TV +W L +   +    GH   V  + F       
Sbjct: 551 GHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYF 610

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWHVESR 363
           +T S D+T R+W+      +  + GH + V     F      + +GS+DKT ++W +++ 
Sbjct: 611 ITASHDQTARLWSCDHIYPLRIFSGHLNDV-DCSTFHPNGCYVFTGSSDKTCRMWDIQTG 669

Query: 364 TCYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
               L  GHT  V  +++ P      +GS+D TI +WDI T   +K  +GH
Sbjct: 670 DSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGH 720

>YJL112W (MDV1) [2803] chr10 (205222..207366) Protein involved in
           mitochondrial division and mitochondrial fission,
           contains WD (WD-40) repeats [2145 bp, 714 aa]
          Length = 714

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/299 (25%), Positives = 129/299 (43%), Gaps = 57/299 (19%)

Query: 252 HMDGVLTLQFN--YRLLFTGSY-DSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKL 306
           H D +  L F+  +  L T  Y D TV IWDL     I  L+GH   +  +    D   L
Sbjct: 397 HDDFLTCLDFDAPFGTLCTAGYLDHTVKIWDLSKQNKIGELAGHLATINCMQINRDYGTL 456

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCY 366
           VTG  D  +++WN                        + +   + + T    H++S   +
Sbjct: 457 VTGGRDAALKLWNLN--------------------LAQQLYQETQNLTSPTNHIDSPCVH 496

Query: 367 TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTII 426
           T   HT+ V  + L P SF   SGS D TIR WD+R+  CL+        V       + 
Sbjct: 497 TFEAHTDEVTALSLDP-SF-LVSGSQDRTIRQWDLRSGKCLQTIDLSFANV-------LT 547

Query: 427 DAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLD 486
            + N+ +   +   + ++ P                     Q+ D ++   T       D
Sbjct: 548 TSTNVDLSKSTLLTQRNERPSIGAL----------------QSFDAALATGTK------D 585

Query: 487 NTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
             ++LWD+++G+ IRT  GH + +  +  D+  +++GS+D +++IWDL++G  ++ FH 
Sbjct: 586 GVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-LLNKFHA 643

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/219 (26%), Positives = 98/219 (44%), Gaps = 49/219 (22%)

Query: 245 QVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDL-CSNKL---------------- 285
           ++ E  GH+  +  +Q N  Y  L TG  D+ + +W+L  + +L                
Sbjct: 433 KIGELAGHLATINCMQINRDYGTLVTGGRDAALKLWNLNLAQQLYQETQNLTSPTNHIDS 492

Query: 286 --IRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTY-------------- 329
             +     HTD V  L  D + LV+GS D+TIR W+ ++G+C+ T               
Sbjct: 493 PCVHTFEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNV 552

Query: 330 ----------RGHTDSVMSVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCV 378
                     R    S+ ++ +F   + +G+ D  V++W + S +   TL+GHT+ +  +
Sbjct: 553 DLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSL 612

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
           K    S    +GS D T+R+WD+RT   L  F  +   V
Sbjct: 613 KFD--SACLVTGSYDRTVRIWDLRT-GLLNKFHAYSAPV 648

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 81/139 (58%), Gaps = 6/139 (4%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L TG+ D  V +WDL S K+IR L GHTD + +L FD A LVTGS D+T+R+W+ +TG  
Sbjct: 579 LATGTKDGVVRLWDLRSGKVIRTLKGHTDAITSLKFDSACLVTGSYDRTVRIWDLRTG-L 637

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADK-TVKIWHVESRTCYT--LRGHTEWVNCVKLHP 382
           ++ +  ++  V+S+D F++      AD+ +V+I+  E    ++   +G+   V+ VK   
Sbjct: 638 LNKFHAYSAPVLSLDLFQENAAVVVADEPSVQIYDSEKDESWSCVEQGNETSVSTVKY-- 695

Query: 383 KSFTCFSGSDDTTIRMWDI 401
           K      G ++  + +W +
Sbjct: 696 KENYMVEGRENGDVNIWAV 714

>Kwal_26.8776
          Length = 433

 Score = 94.0 bits (232), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/214 (28%), Positives = 99/214 (46%), Gaps = 12/214 (5%)

Query: 215 KDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTL---QFNYRLLFTGSY 271
           KDS G LM      ++++ +++  W      ++   GH   V  +     +     TGS 
Sbjct: 87  KDSFGSLMER----HKQQLELQPEWHAPWKLMRVINGHNGWVRCVCPDPVDNAWFATGSN 142

Query: 272 DSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTY 329
           D+T+ +WD+ S KL   L+GH   V+++   +    + + S DK ++ W+ +    I  Y
Sbjct: 143 DTTIKVWDMASGKLKLTLTGHVMTVRSVAVSQRHPLMFSASEDKMVKCWDLERNAAIRDY 202

Query: 330 RGHTDSVMSVDAFKKI--IVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKLHPKSFT 386
            GH   V +VD    +  I S   D  V++W + +R    TL GH   +N VK  P    
Sbjct: 203 HGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVKCFPVDPQ 262

Query: 387 CFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
             S S D T+R+WDIR     K+   H   V+ +
Sbjct: 263 IMSCSSDATVRLWDIRAGKATKILTHHSKSVRAI 296

 Score = 87.8 bits (216), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 107/270 (39%), Gaps = 58/270 (21%)

Query: 284 KLIRRLSGHTDGVKTL---YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD 340
           KL+R ++GH   V+ +     D A   TGS D TI+VW+  +G+   T  GH  +V SV 
Sbjct: 112 KLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTIKVWDMASGKLKLTLTGHVMTVRSVA 171

Query: 341 AFKK--IIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIR 397
             ++  ++ S S DK VK W +E         GH   VN V +HP      S   D  +R
Sbjct: 172 VSQRHPLMFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVR 231

Query: 398 MWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXX 457
           +WDIRT   +    GH   + +V                                     
Sbjct: 232 LWDIRTRLPVMTLAGHKSPINQV------------------------------------- 254

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADN 517
                         K  P    ++SCS D T++LWD++ G+  +    H + V  IAA  
Sbjct: 255 --------------KCFPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHP 300

Query: 518 FR-IISGSHDGSIKIWDLQSGKCMHTFHGK 546
               ++ +    ++ W    G+ +  +H +
Sbjct: 301 AESSVATASTSDVRSWRHSDGQLLTNYHSE 330

 Score = 49.3 bits (116), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/170 (21%), Positives = 80/170 (47%), Gaps = 10/170 (5%)

Query: 243 NCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL- 299
           N  ++++ GH  GV T+  +    L+ +   D+ V +WD+ +   +  L+GH   +  + 
Sbjct: 196 NAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDIRTRLPVMTLAGHKSPINQVK 255

Query: 300 -YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF-KKIIVSGSADKTVKI 357
            +  + ++++ S D T+R+W+ + G+       H+ SV ++ A   +  V+ ++   V+ 
Sbjct: 256 CFPVDPQIMSCSSDATVRLWDIRAGKATKILTHHSKSVRAIAAHPAESSVATASTSDVRS 315

Query: 358 WHVESRTCYTLRGHTEW---VNCVKLHPKSFTCFSGSDDTTIRMWDIRTN 404
           W        T   H+E    +N + ++      F G DD  +  +D ++ 
Sbjct: 316 WRHSDGQLLT-NYHSEGIGIINSLSVNADG-VLFGGGDDGNLSFFDYKSG 363

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 69/193 (35%), Gaps = 54/193 (27%)

Query: 358 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCFS-GSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
           WH   +    + GH  WV CV   P     F+ GS+DTTI           KV+    G+
Sbjct: 107 WHAPWKLMRVINGHNGWVRCVCPDPVDNAWFATGSNDTTI-----------KVWDMASGK 155

Query: 417 VQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPY 476
           ++  +   ++   ++ V                                       S  +
Sbjct: 156 LKLTLTGHVMTVRSVAV---------------------------------------SQRH 176

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDL 534
           P  + S S D  +K WD++    IR   GH  GV   D+      I S   D  +++WD+
Sbjct: 177 PL-MFSASEDKMVKCWDLERNAAIRDYHGHFSGVNTVDVHPTLDLIASAGRDAVVRLWDI 235

Query: 535 QSGKCMHTFHGKR 547
           ++   + T  G +
Sbjct: 236 RTRLPVMTLAGHK 248

>CAGL0G04345g 408842..410977 similar to sp|P47025 Saccharomyces
           cerevisiae YJL112w MDV1, hypothetical start
          Length = 711

 Score = 94.7 bits (234), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 113/237 (47%), Gaps = 53/237 (22%)

Query: 245 QVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRR------------LS 290
           Q+   +GH+  +  +Q   NY ++ TGS D+TV +W+  +N +I R            L 
Sbjct: 439 QIGAMEGHVATISCMQVDKNYNMVATGSKDATVKLWN--ANDVIGRYEEGNNSEALHTLD 496

Query: 291 GHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTY---------------RGHTDS 335
            H D V +LY D A L+T S DKTIR W+  +G+CI  +               + + DS
Sbjct: 497 AHLDEVSSLYIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDS 556

Query: 336 VM----------SVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKS 384
           ++          S+ +F   + +G+ D  +++W + +      L GH + +  +K    +
Sbjct: 557 MILKTVNTPIIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFD--A 614

Query: 385 FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNE 441
            T  SGS D TIR+WD+R+N+   +        +K I     DA+++VV     SNE
Sbjct: 615 TTIISGSLDGTIRLWDLRSNNLTDII-----SYEKPISSLDFDAKHIVV----ASNE 662

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 107/248 (43%), Gaps = 35/248 (14%)

Query: 320 YKTGECISTY-RGHTDSVMSVD---AFKKIIVSGSADKTVKIW-HVESRTCYTLRGHTEW 374
           Y +G+ +ST  + H D++  +D    F  +  +G  D  VK+W + + R    + GH   
Sbjct: 390 YNSGKKLSTIPKAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVAT 449

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIR----------TNSCLKVFRGHVGQVQKVIPLT 424
           ++C+++        +GS D T+++W+             +  L     H+ +V  +    
Sbjct: 450 ISCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLY--- 506

Query: 425 IIDAENLVVDNISGSNEGDD-------EPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYP 477
            ID  NL+  +   +    D       +                    E+  + K++  P
Sbjct: 507 -IDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTP 565

Query: 478 ---------THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGS 528
                      L + + D  I+LWD++TG+ +R   GH++ +  +  D   IISGS DG+
Sbjct: 566 IIGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDGT 625

Query: 529 IKIWDLQS 536
           I++WDL+S
Sbjct: 626 IRLWDLRS 633

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 100/235 (42%), Gaps = 46/235 (19%)

Query: 202 KNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQ--VQEFKGHMDGVLTL 259
           KN ++ AT    +KD+  KL     VI R        + +GN    +     H+D V +L
Sbjct: 457 KNYNMVATG---SKDATVKLWNANDVIGR--------YEEGNNSEALHTLDAHLDEVSSL 505

Query: 260 QFNYRLLFTGSYDSTVAIWDLCSNKLIR-------RLSGHTDG----------VKTL--- 299
             +   L T S D T+  WDL S K I+        LS +             +KT+   
Sbjct: 506 YIDGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTP 565

Query: 300 ------YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADK 353
                  FD A L TG+ D  IR+W+ +TGE +    GH D++ S+      I+SGS D 
Sbjct: 566 IIGSIQSFD-AALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDG 624

Query: 354 TVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTI------RMWDIR 402
           T+++W + S     +  + + ++ +    K     S   +T I        WD++
Sbjct: 625 TIRLWDLRSNNLTDIISYEKPISSLDFDAKHIVVASNEHNTHIYDRNDGNKWDLQ 679

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 65/134 (48%), Gaps = 1/134 (0%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L TG+ D  + +WD+ + +++R L GH D + +L FD   +++GSLD TIR+W+ ++   
Sbjct: 577 LATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDGTIRLWDLRSNN- 635

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSF 385
           ++    +   + S+D   K IV  S +    I+       + L+   +    + +  K  
Sbjct: 636 LTDIISYEKPISSLDFDAKHIVVASNEHNTHIYDRNDGNKWDLQDEEQDTTSLFVKYKER 695

Query: 386 TCFSGSDDTTIRMW 399
               G  +  I +W
Sbjct: 696 YTMEGRSNGDIGIW 709

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 10/74 (13%)

Query: 480 LLSCSLDNTIKLWDVQ----------TGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 529
           + + S D T+KLW+              + + T   H++ V  +  D   +++ S D +I
Sbjct: 462 VATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYIDGANLMTASQDKTI 521

Query: 530 KIWDLQSGKCMHTF 543
           + WDL SGKC+  F
Sbjct: 522 RRWDLYSGKCIQVF 535

>YBR198C (TAF5) [381] chr2 complement(616084..618480) Component of
           the TAF(II) complex (TBP-associated protein complex) and
           SAGA complex (Spt-Ada-Gcn5-acetyltransferase), required
           for activated transcription by RNA polymerase II, member
           of WD (WD-40) repeat family [2397 bp, 798 aa]
          Length = 798

 Score = 93.2 bits (230), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 118/299 (39%), Gaps = 80/299 (26%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLI-----------------RRLSGHTDGVKTLYF--DEA 304
           R+   G  DS + IW L  + L                  + L GH+  V +  F  D  
Sbjct: 479 RIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNK 538

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES 362
            L++GS DKT+R+W+  T   + +Y+GH   V  +S         + S D+T ++W  + 
Sbjct: 539 YLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH 598

Query: 363 RTCYTLR---GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 419
              Y LR   GH   V+CV  HP     F+GS D T RMWD+ T   +++F   +G    
Sbjct: 599 --IYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLF---LGHTAP 653

Query: 420 VIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTH 479
           VI + +                                                 P    
Sbjct: 654 VISIAVC------------------------------------------------PDGRW 665

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV---WDIAADNFRIISGSHDGSIKIWDLQ 535
           L + S D  I +WD+ TG+ ++   GH +        + +   +ISG  D ++++WDL+
Sbjct: 666 LSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 79/170 (46%), Gaps = 7/170 (4%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--L 306
           GH   V +  F  + + L +GS D TV +W + ++  +    GH   V  + F       
Sbjct: 523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYF 582

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRT 364
            T S D+T R+W+      +  + GH + V  +S       + +GS+DKT ++W V +  
Sbjct: 583 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGD 642

Query: 365 CYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
              L  GHT  V  + + P      +GS+D  I +WDI T   LK  RGH
Sbjct: 643 SVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 692

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 66/124 (53%), Gaps = 7/124 (5%)

Query: 249 FKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
           F GH++ V  + F  N   +FTGS D T  +WD+ +   +R   GHT  V ++    D  
Sbjct: 605 FAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGR 664

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWHVE 361
            L TGS D  I VW+  TG+ +   RGH  + +   ++ K   +++SG AD TV++W ++
Sbjct: 665 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

Query: 362 SRTC 365
             T 
Sbjct: 725 KATT 728

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 88/187 (47%), Gaps = 14/187 (7%)

Query: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
           +KGH   V  + F+       T S+D T  +W       +R  +GH + V  + F  +  
Sbjct: 563 YKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGC 622

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVES 362
            + TGS DKT R+W+  TG+ +  + GHT  V+S+      + + +GS D  + +W + +
Sbjct: 623 YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGT 682

Query: 363 -RTCYTLRGHTE-WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCL------KVFRGHV 414
            +    +RGH +  +  +    +     SG  D T+R+WD++  +        + F G++
Sbjct: 683 GKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEPSAEPDEPFIGYL 742

Query: 415 GQVQKVI 421
           G V   I
Sbjct: 743 GDVTASI 749

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 87/223 (39%), Gaps = 56/223 (25%)

Query: 328 TYRGHTDSVMSVD--AFKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKS 384
           T  GH+ +V S       K ++SGS DKTV++W +++ T   + +GH   V  V   P  
Sbjct: 520 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLG 579

Query: 385 FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDD 444
               + S D T R+W     SC  ++           PL I       VD +S    G  
Sbjct: 580 HYFATASHDQTARLW-----SCDHIY-----------PLRIFAGHLNDVDCVSFHPNG-- 621

Query: 445 EPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQF 504
                                             ++ + S D T ++WDV TG  +R   
Sbjct: 622 ---------------------------------CYVFTGSSDKTCRMWDVSTGDSVRLFL 648

Query: 505 GHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           GH   V  IA   D   + +GS DG I +WD+ +GK +    G
Sbjct: 649 GHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRG 691

>Sklu_2420.2 YPL151C, Contig c2420 3924-5249
          Length = 441

 Score = 90.9 bits (224), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 109/272 (40%), Gaps = 60/272 (22%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK---LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD 340
           KL+R ++GH   V+T+  D        TGS D TI++W+  TG+   T  GH  +V  + 
Sbjct: 120 KLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDIC 179

Query: 341 AFKK--IIVSGSADKTVKIWHVE-SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIR 397
             K+   + S S DK VK W +E +R      GH   V+ V +HP      +   D+ +R
Sbjct: 180 ISKRHPYMFSASEDKLVKCWDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVR 239

Query: 398 MWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXX 457
           +WDIRT   +    GH   + +V                                     
Sbjct: 240 LWDIRTKLPVMTMAGHKSPINRV------------------------------------- 262

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--A 515
                         K +P    ++SCS D T++LWD+  G+ ++    H   V DI    
Sbjct: 263 --------------KCLPVDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDIGIHP 308

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMHTFHGKR 547
             F I S   D  I+ W L  G+ +  F  ++
Sbjct: 309 GEFSISSACTD-DIRSWKLPEGQLLTNFQSEK 339

 Score = 87.0 bits (214), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 63/226 (27%), Positives = 101/226 (44%), Gaps = 12/226 (5%)

Query: 203 NASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQ-- 260
           NA +    N+   D    +M   + +  ++ K  + W+     ++   GH   V T+   
Sbjct: 83  NALVTKVFNSSEDDVFHSIMHRHEQMISQKPKWHAPWK----LMRVINGHNGWVRTVAVD 138

Query: 261 -FNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKLVTGSLDKTIRV 317
             +     TGS D+T+ IWDL + KL   LSGH   VK +   +    + + S DK ++ 
Sbjct: 139 PIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKDICISKRHPYMFSASEDKLVKC 198

Query: 318 WNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVESR-TCYTLRGHTEW 374
           W+ +    I  Y GH   V +VD      +I +   D  V++W + ++    T+ GH   
Sbjct: 199 WDLEKNRVIRDYHGHLSGVHTVDIHPTLNLIATAGRDSVVRLWDIRTKLPVMTMAGHKSP 258

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           +N VK  P      S S D T+R+WDI     LKV   H   V+ +
Sbjct: 259 INRVKCLPVDPQVVSCSADATVRLWDITAGKTLKVLTHHKRSVRDI 304

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 498 QCIRTQFGHVEGVWDIAAD---NFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQD 552
           + +R   GH   V  +A D   N    +GS+D +IKIWDL +GK   T  G  +  +D
Sbjct: 120 KLMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLKLTLSGHIMTVKD 177

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 12/95 (12%)

Query: 249 FKGHMDGVL-TLQFNYR-LLFTGSYDSTVAIWDLCSNKLIRRLS-----GHTD---GVKT 298
           F+    G++ TL  N   +LF GS +  ++ +D  +    ++L      G  +   G+ T
Sbjct: 335 FQSEKTGIINTLSINQDDVLFAGSDNGVLSFYDYKTGHKYQQLDTTEIPGSLESERGILT 394

Query: 299 LYFDEA--KLVTGSLDKTIRVWNYKTGECISTYRG 331
             FD+   +L+TG  DK+I++W         TY G
Sbjct: 395 STFDQTGLRLITGESDKSIKIWKQDQDATPETYTG 429

>Scas_721.32
          Length = 822

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 89/192 (46%), Gaps = 31/192 (16%)

Query: 255 GVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIR--------------------RLSGH 292
           G+ +LQF  + RL+  G  DS + +W L  + L +                     L GH
Sbjct: 489 GMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGH 548

Query: 293 TDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVS 348
           +  V +  F  D   L++GS DKT+R+W+  T   + +Y+GH   V  V          +
Sbjct: 549 SGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFAT 608

Query: 349 GSADKTVKIWHVESRTCYTLR---GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
            S D+T ++W  +    Y LR   GH   V+CV  HP     F+GS D T RMWDI T  
Sbjct: 609 ASHDQTARLWSCDH--IYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGD 666

Query: 406 CLKVFRGHVGQV 417
            +++F GH   V
Sbjct: 667 SVRLFLGHTAPV 678

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 76/170 (44%), Gaps = 7/170 (4%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--L 306
           GH   V +  F  + R L +GS D TV +W   +   +    GH   V  + F       
Sbjct: 547 GHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYF 606

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESRT 364
            T S D+T R+W+      +  + GH   V  V        + +GS+DKT ++W + +  
Sbjct: 607 ATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGD 666

Query: 365 CYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
              L  GHT  V C  + P      +GS+D  I +WDI T   LKV RGH
Sbjct: 667 SVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGH 716

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (50%), Gaps = 7/124 (5%)

Query: 249 FKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV--KTLYFDEA 304
           F GH+  V  + F  N   +FTGS D T  +WD+ +   +R   GHT  V    +  D  
Sbjct: 629 FAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGR 688

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWHVE 361
            L TGS D  I +W+  T + +   RGH  + +   ++ K   ++VSG AD +V++W ++
Sbjct: 689 WLATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

Query: 362 SRTC 365
             T 
Sbjct: 749 KSTA 752

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQS 536
           +LLS S D T++LW   T   + +  GH   VWD+  +       + SHD + ++W    
Sbjct: 563 YLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCDH 622

Query: 537 GKCMHTFHG 545
              +  F G
Sbjct: 623 IYPLRIFAG 631

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV---WDIAADNFRIISGSHDGSIKIWDLQ 535
           L + S D  I LWD+ T + ++   GH +          +   ++SG  D S+++WDL+
Sbjct: 690 LATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

>KLLA0F11231g complement(1034708..1036012) similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46, start by
           similarity
          Length = 434

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 118/298 (39%), Gaps = 25/298 (8%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYKTGEC 325
           TGS D+T+ IWDL + KL   L GH   V+ +   +    + + S DK ++ W+ +    
Sbjct: 140 TGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASEDKLVKCWDLERNTA 199

Query: 326 ISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKLHP 382
           I  + GH   V +VD      II +   D  V++W + SR+    L GH   +N VK  P
Sbjct: 200 IRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLP 259

Query: 383 KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEG 442
                 S S D T+R+WDI      KV   H   ++    LT+  AE       +     
Sbjct: 260 VDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRD---LTLHPAEFSFASVSTNDVRS 316

Query: 443 DDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRT 502
              P                N         SI +   LL+   D T+  +D +TG   ++
Sbjct: 317 WKLPEGQLLTNFQSQNTGILN-------TVSINHDNVLLAGGDDGTLCFYDYKTGHKYQS 369

Query: 503 QF-----GHVEGVWDIAADNF-----RIISGSHDGSIKIWDLQSGKCMHTFHGKRLQP 550
                  G +E    I    F     R+I+G  D SIKIW         TF G    P
Sbjct: 370 MMTTEVAGSLESERSILCSTFDVTGTRLITGEGDKSIKIWKQVPDATEDTFPGLPWNP 427

 Score = 83.6 bits (205), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 105/271 (38%), Gaps = 60/271 (22%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK---LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD 340
           KL + ++GHT  V+ +  D        TGS D TI++W+   G+   T  GH  SV  + 
Sbjct: 113 KLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIA 172

Query: 341 AFKK--IIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIR 397
             K+   + S S DK VK W +E  T      GH   V+ V +HP      +   D  +R
Sbjct: 173 ISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVR 232

Query: 398 MWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXX 457
           +WDIR+ S + V  GH   + KV                                     
Sbjct: 233 LWDIRSRSEIMVLPGHKSPINKV------------------------------------- 255

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--A 515
                         K +P    ++SCS D T++LWD+  G+  +    H   + D+    
Sbjct: 256 --------------KCLPVDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTLHP 301

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMHTFHGK 546
             F   S S +  ++ W L  G+ +  F  +
Sbjct: 302 AEFSFASVSTN-DVRSWKLPEGQLLTNFQSQ 331

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 70/193 (36%), Gaps = 54/193 (27%)

Query: 358 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCFS-GSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
           WH   +    + GHT WV CV + P     F+ GS+DTTI++WD+          GHV  
Sbjct: 108 WHAPWKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMS 167

Query: 417 VQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPY 476
           V+ +                                                 + K  PY
Sbjct: 168 VRDI------------------------------------------------AISKRHPY 179

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDL 534
              + S S D  +K WD++    IR   GH+ GV   D+      I +   D  +++WD+
Sbjct: 180 ---MFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDI 236

Query: 535 QSGKCMHTFHGKR 547
           +S   +    G +
Sbjct: 237 RSRSEIMVLPGHK 249

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 515 ADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQD 552
            DN    +GS+D +IKIWDL +GK   T  G  +  +D
Sbjct: 133 VDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRD 170

>KLLA0E12287g join(1086778..1087329,1087730..1088158) similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1 40S
           small subunit ribosomal protein, start by similarity
          Length = 326

 Score = 88.2 bits (217), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 93/198 (46%), Gaps = 24/198 (12%)

Query: 249 FKGHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKL-----IRRLSGHTDGVKTLY 300
            +GH   V +L  +     LL +GS D T+  W L  N+      +R   GH+  V+ + 
Sbjct: 14  LEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVV 73

Query: 301 F--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVK 356
              D    V+ S DKT+R+WN  TG   + + GHT  V+SV  DA    I+S S DKT++
Sbjct: 74  VSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIR 133

Query: 357 IWHVESRTCYTLRGHTEWVNCVKLHPKSF----------TCFSGSDDTTIRMWDIRTNS- 405
           +W+      Y L GHT+WV  V++ PK+           T  S   D  +R W +  +S 
Sbjct: 134 VWNTVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSY 193

Query: 406 -CLKVFRGHVGQVQKVIP 422
                F GH   +  V P
Sbjct: 194 RIEADFIGHNNYINVVQP 211

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 95/225 (42%), Gaps = 32/225 (14%)

Query: 207 CATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGH----MDGVLTLQFN 262
            A  N     S  K +  W++   E+        +    V+ +KGH     D V++   N
Sbjct: 28  AAQPNLLVSGSRDKTLISWRLTENEQ--------QFGVPVRSYKGHSHIVQDVVVSADGN 79

Query: 263 YRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKLVTGSLDKTIRVWNY 320
           Y +  + S+D T+ +W+L +     R  GHT  V ++  D   +K+++ S DKTIRVWN 
Sbjct: 80  YAV--SASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWN- 136

Query: 321 KTGECISTYRGHTDSVM------------SVDAFKKIIVSGSADKTVKIWHVES---RTC 365
             G+C     GHTD V              VD  +   VS   DK V+ W +     R  
Sbjct: 137 TVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVRSWSLNEDSYRIE 196

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
               GH  ++N V+  P      S   D  I +W+++  S    F
Sbjct: 197 ADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNF 241

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 10/85 (11%)

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQS 536
           + +S S D T++LW++ TG       GH   V  +A  A++ +IIS S D +I++W+   
Sbjct: 80  YAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWN-TV 138

Query: 537 GKCMHTFHGK-------RLQPQDEE 554
           G C +   G        R+ P++ E
Sbjct: 139 GDCAYVLLGHTDWVTKVRVAPKNLE 163

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 469 TLDKSIPYPTHLLSCSLDNTIKLWDV-----QTGQCIRTQFGHVEGVWDI--AADNFRII 521
           +L  S   P  L+S S D T+  W +     Q G  +R+  GH   V D+  +AD    +
Sbjct: 23  SLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAV 82

Query: 522 SGSHDGSIKIWDLQSGKCMHTFHG 545
           S S D ++++W+L +G     F G
Sbjct: 83  SASWDKTLRLWNLATGNSEARFVG 106

>YGL137W (SEC27) [1850] chr7 (249872..249889,250090..252741)
           Coatomer (COPI) complex beta' chain (beta'-COP) of
           secretory pathway vesicles, required for retrograde
           transport from Golgi to endoplasmic reticulum, member of
           the WD (WD-40) repeat family [2670 bp, 889 aa]
          Length = 889

 Score = 90.9 bits (224), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 81/291 (27%), Positives = 124/291 (42%), Gaps = 63/291 (21%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTG 323
           + T  Y   V +W+  +   +R +      V+   F   K  ++ GS D  IRV+NY TG
Sbjct: 28  VLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTG 87

Query: 324 ECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTCY--TLRGHTEWVNCVK 379
           E +  +  H D +  ++V   K  ++SGS D TVK+W+ E+      T  GH  +V CV 
Sbjct: 88  EKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVA 147

Query: 380 LHPKSFTCF-SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            +PK  + F SG  D T+++W +             GQ      LT             G
Sbjct: 148 FNPKDPSTFASGCLDRTVKVWSL-------------GQSTPNFTLT--------TGQERG 186

Query: 439 SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQ 498
            N  D  P                           +P   ++++ S D TIK+WD QT  
Sbjct: 187 VNYVDYYP---------------------------LPDKPYMITASDDLTIKIWDYQTKS 219

Query: 499 CIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDLQSGKCMHTFH 544
           C+ T  GH+    +++   F      IISGS DG++KIW+  + K   T +
Sbjct: 220 CVATLEGHMS---NVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLN 267

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 112/238 (47%), Gaps = 19/238 (7%)

Query: 184 PNCGWGLPLLHMKRAR---FVKNASICATNNTCTKDSNGKLM--RPWKVIYRERFKVES- 237
           P   W L  L+  R     +     + +   T T    GK +  + W ++  + F++   
Sbjct: 23  PTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVF 82

Query: 238 NWRKGNCQVQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSN-KLIRRLSGHTD 294
           N+  G  +V +F+ H D + ++  +     + +GS D TV +W+  +N  L +   GH  
Sbjct: 83  NYNTGE-KVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEH 141

Query: 295 GVKTLYF---DEAKLVTGSLDKTIRVWNY-KTGECISTYRGHTDSVMSVDAF----KKII 346
            V  + F   D +   +G LD+T++VW+  ++    +   G    V  VD +    K  +
Sbjct: 142 FVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYM 201

Query: 347 VSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           ++ S D T+KIW  ++++C  TL GH   V+    HP      SGS+D T+++W+  T
Sbjct: 202 ITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSST 259

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 86/186 (46%), Gaps = 26/186 (13%)

Query: 238 NWRKGNCQVQEFKGHMDGVLTLQFNYR---LLFTGSYDSTVAIWDLC-SNKLIRRLSGHT 293
           NW       Q F+GH   V+ + FN +      +G  D TV +W L  S       +G  
Sbjct: 125 NWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQE 184

Query: 294 DGVKTLYF----DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK---KII 346
            GV  + +    D+  ++T S D TI++W+Y+T  C++T  GH  +V S   F     II
Sbjct: 185 RGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNV-SFAVFHPTLPII 243

Query: 347 VSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHP------------KSFTCFS-GSD 392
           +SGS D T+KIW+  + +   TL    E   C+  HP              FT  S G+D
Sbjct: 244 ISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLGND 303

Query: 393 DTTIRM 398
           + T+ +
Sbjct: 304 EPTLSL 309

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 477 PTHLLSCSLDNTIKLWDV-QTGQCIRTQFGHVEGV----WDIAADNFRIISGSHDGSIKI 531
           P+   S  LD T+K+W + Q+        G   GV    +    D   +I+ S D +IKI
Sbjct: 153 PSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKI 212

Query: 532 WDLQSGKCMHTFHG 545
           WD Q+  C+ T  G
Sbjct: 213 WDYQTKSCVATLEG 226

>AEL314W [2191] [Homologous to ScYJL112W (MDV1) - SH; ScYKR036C
           (CAF4) - SH] complement(52978..55125) [2148 bp, 715 aa]
          Length = 715

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/272 (25%), Positives = 112/272 (41%), Gaps = 54/272 (19%)

Query: 290 SGHTDGVKTLYFD---EAKLVTGSLDKTIRVWNYKTGECISTYRGH--TDSVMSVDAFKK 344
           S H D V  L F+         G LD TI+VWN    + +++  GH  T S M +D +  
Sbjct: 408 SAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNT 467

Query: 345 IIVSGSADKTVKIWHVES----------RTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDD 393
           +I +G  D  +K+W ++             C YT   H + +  +     +    SGS D
Sbjct: 468 LI-TGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANNLV--SGSQD 524

Query: 394 TTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS--NEGDDEPXXXXX 451
            TIR WD+    C++            + +      NL    I     N  +D P     
Sbjct: 525 RTIRQWDLNNGKCVQT-----------LDINFATGGNLSRSMIGSGFLNTNNDHPIIGAI 573

Query: 452 XXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW 511
                                   Y   L + + D  ++LWD+++G+ +RT  GH + V 
Sbjct: 574 QC----------------------YDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVT 611

Query: 512 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTF 543
            +  D+  +++GS D SI+IWDL++G    TF
Sbjct: 612 SLQFDSLNLVTGSLDNSIRIWDLRTGTLADTF 643

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/323 (22%), Positives = 130/323 (40%), Gaps = 89/323 (27%)

Query: 251 GHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK-L 306
            H D V  L FN     L   G  D T+ +W+L  NK +  ++GH   V  +  D+   L
Sbjct: 409 AHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQMDQYNTL 468

Query: 307 VTGSLDKTIRVWNYKTG----------ECISTYRGHTDSVMSVDAFKKIIVSGSADKTVK 356
           +TG  D  +++W+ +             CI T+  H D + ++      +VSGS D+T++
Sbjct: 469 ITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDSHIDEITALSFEANNLVSGSQDRTIR 528

Query: 357 IWHVESRTC-------YTLRGH-------TEWVNCVKLHP--KSFTCF-----SGSDDTT 395
            W + +  C       +   G+       + ++N    HP   +  C+     +G+ D  
Sbjct: 529 QWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGI 588

Query: 396 IRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXX 455
           +R+WD+R+   ++   GH   V  +      D+ NLV                       
Sbjct: 589 VRLWDLRSGRVVRTLEGHSDAVTSL----QFDSLNLV----------------------- 621

Query: 456 XXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA 515
                                     + SLDN+I++WD++TG    T F +   V  +  
Sbjct: 622 --------------------------TGSLDNSIRIWDLRTGTLADT-FSYEHPVTCLQF 654

Query: 516 DNFRIISGSHDGSIKIWDLQSGK 538
           D  +I+  + +G++K+++ Q  K
Sbjct: 655 DLNKIVVANQEGTVKVYNRQEKK 677

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 91/202 (45%), Gaps = 36/202 (17%)

Query: 243 NCQVQEFKGHMDGVLTLQFN-YRLLFTGSYDSTVAIWDL---------CSNKL-IRRLSG 291
           N  V    GH+  V  +Q + Y  L TG  D+ + +WD+          S+++ I     
Sbjct: 444 NKHVASITGHLATVSCMQMDQYNTLITGGRDALLKMWDIQKAIDNDSIPSDEVCIYTFDS 503

Query: 292 HTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYR------GHTDSVM-------- 337
           H D +  L F+   LV+GS D+TIR W+   G+C+ T        G+    M        
Sbjct: 504 HIDEITALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNT 563

Query: 338 --------SVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCF 388
                   ++  +   + +G+ D  V++W + S R   TL GH++ V  ++    S    
Sbjct: 564 NNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQF--DSLNLV 621

Query: 389 SGSDDTTIRMWDIRTNSCLKVF 410
           +GS D +IR+WD+RT +    F
Sbjct: 622 TGSLDNSIRIWDLRTGTLADTF 643

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 72/138 (52%), Gaps = 4/138 (2%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L TG+ D  V +WDL S +++R L GH+D V +L FD   LVTGSLD +IR+W+ +TG  
Sbjct: 580 LATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTGTL 639

Query: 326 ISTYR-GHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVK-LHPK 383
             T+   H  + +  D  K  IV  + + TVK+++ + +  +   G     N V+ +  K
Sbjct: 640 ADTFSYEHPVTCLQFDLNK--IVVANQEGTVKVYNRQEKKHWFCGGDEHSENAVEYVRYK 697

Query: 384 SFTCFSGSDDTTIRMWDI 401
                 G  +  I  W I
Sbjct: 698 DGYLVEGRANGDINAWAI 715

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 71/154 (46%), Gaps = 22/154 (14%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRL----------------SGH 292
           F  H+D +  L F    L +GS D T+  WDL + K ++ L                SG 
Sbjct: 501 FDSHIDEITALSFEANNLVSGSQDRTIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGF 560

Query: 293 TDG------VKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKII 346
            +       +  +   +A L TG+ D  +R+W+ ++G  + T  GH+D+V S+      +
Sbjct: 561 LNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSGRVVRTLEGHSDAVTSLQFDSLNL 620

Query: 347 VSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKL 380
           V+GS D +++IW + + T      +   V C++ 
Sbjct: 621 VTGSLDNSIRIWDLRTGTLADTFSYEHPVTCLQF 654

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK 305
           V+  +GH D V +LQF+   L TGS D+++ IWDL +  L    S +   V  L FD  K
Sbjct: 600 VRTLEGHSDAVTSLQFDSLNLVTGSLDNSIRIWDLRTGTLADTFS-YEHPVTCLQFDLNK 658

Query: 306 LVTGSLDKTIRVWN 319
           +V  + + T++V+N
Sbjct: 659 IVVANQEGTVKVYN 672

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/260 (20%), Positives = 101/260 (38%), Gaps = 85/260 (32%)

Query: 320 YKTGECISTY-RGHTDSVMSVD---AFKKIIVSGSADKTVKIWHV-ESRTCYTLRGHTEW 374
           Y+ G  I ++   H D+V  +D    F  +  +G  D T+K+W++ +++   ++ GH   
Sbjct: 397 YEPGANILSFDSAHEDNVTCLDFNLPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLAT 456

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVD 434
           V+C+++   + T  +G  D  ++MWD                +QK I    I ++ + + 
Sbjct: 457 VSCMQMDQYN-TLITGGRDALLKMWD----------------IQKAIDNDSIPSDEVCI- 498

Query: 435 NISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT-------HLLSCSLDN 487
                                             T D  I   T       +L+S S D 
Sbjct: 499 ---------------------------------YTFDSHIDEITALSFEANNLVSGSQDR 525

Query: 488 TIKLWDVQTGQCIRT-QFGHVEG---------------------VWDIAADNFRIISGSH 525
           TI+ WD+  G+C++T       G                     +  I   +  + +G+ 
Sbjct: 526 TIRQWDLNNGKCVQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTK 585

Query: 526 DGSIKIWDLQSGKCMHTFHG 545
           DG +++WDL+SG+ + T  G
Sbjct: 586 DGIVRLWDLRSGRVVRTLEG 605

>CAGL0H08932g join(871668..871685,872089..874779) highly similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
          Length = 902

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/288 (27%), Positives = 127/288 (44%), Gaps = 57/288 (19%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTG 323
           + T  Y   V IW+  + + +R +      V+   F   K  +V GS D  +RV+NY TG
Sbjct: 28  VLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTG 87

Query: 324 ECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTCY--TLRGHTEWVNCVK 379
           E ++ +  H D +  ++V   K  I++GS D TVK+W+ E+      T +GH  +V CV 
Sbjct: 88  EKVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVA 147

Query: 380 LHPKSFTCF-SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            +PK    F SG  D  +++W +  ++    F  H GQ +                   G
Sbjct: 148 FNPKDPNVFASGCLDHKVKVWSLGQST--PNFTLHTGQEK-------------------G 186

Query: 439 SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQ 498
            N  D  P                           +P   ++++ S D T+K++D QT  
Sbjct: 187 VNYVDYYP---------------------------LPDKPYMITSSDDTTVKIFDYQTKS 219

Query: 499 CIRTQFGHVEGV-WDIAADNFR-IISGSHDGSIKIWDLQSGKCMHTFH 544
           C+ T  GH+  V + +       IISGS DG++K+W+  + K   T +
Sbjct: 220 CVATLEGHMSNVSFAVFHPTLPIIISGSEDGTVKLWNSSTYKLEKTLN 267

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 109/238 (45%), Gaps = 19/238 (7%)

Query: 184 PNCGWGLPLLHMKRAR---FVKNASICATNNTCTKDSNGKLM--RPWKVIYRERFKVES- 237
           P+  W L  L+  R     +     + +   T T    GK +  + W V+  +  KV   
Sbjct: 23  PSEPWVLTTLYSGRVEIWNYETQQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVF 82

Query: 238 NWRKGNCQVQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSN-KLIRRLSGHTD 294
           N+  G  +V +F  H D +  + +  +   + TGS D TV +W+  ++  L +   GH  
Sbjct: 83  NYNTGE-KVADFVAHPDYIRSIAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEH 141

Query: 295 GVKTLYF---DEAKLVTGSLDKTIRVWNY-KTGECISTYRGHTDSVMSVDAF----KKII 346
            V  + F   D     +G LD  ++VW+  ++    + + G    V  VD +    K  +
Sbjct: 142 FVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYM 201

Query: 347 VSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           ++ S D TVKI+  ++++C  TL GH   V+    HP      SGS+D T+++W+  T
Sbjct: 202 ITSSDDTTVKIFDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTVKLWNSST 259

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 77/157 (49%), Gaps = 13/157 (8%)

Query: 238 NWRKGNCQVQEFKGHMDGVLTLQFNYR---LLFTGSYDSTVAIWDLCSNKLIRRL-SGHT 293
           NW       Q FKGH   V+ + FN +   +  +G  D  V +W L  +     L +G  
Sbjct: 125 NWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGCLDHKVKVWSLGQSTPNFTLHTGQE 184

Query: 294 DGVKTLYF----DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK---KII 346
            GV  + +    D+  ++T S D T+++++Y+T  C++T  GH  +V S   F     II
Sbjct: 185 KGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTKSCVATLEGHMSNV-SFAVFHPTLPII 243

Query: 347 VSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHP 382
           +SGS D TVK+W+  + +   TL    E   C+  HP
Sbjct: 244 ISGSEDGTVKLWNSSTYKLEKTLNLGLERSWCIATHP 280

>Scas_630.6
          Length = 621

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 107/252 (42%), Gaps = 54/252 (21%)

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVESR 363
           L TG+ DK IR+WN K  + +   +GH   + S+D F   + +VSGS D++++IW +++ 
Sbjct: 356 LATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLKTG 415

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCFS-GSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP 422
            C       + V  V + P      + GS D ++R+WD  T   +               
Sbjct: 416 QCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLV--------------- 460

Query: 423 LTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLS 482
                 E L  DN SG+   D                    D +            H++S
Sbjct: 461 ------ERLDSDNESGNGHQD-----------SVYSVAFTKDGQ------------HVVS 491

Query: 483 CSLDNTIKLWDVQ-----TGQCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQ 535
            SLD T+KLW++      TG+C  T  GH + V  +A   D+  I SGS D  + IWD  
Sbjct: 492 GSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKD 551

Query: 536 SGKCMHTFHGKR 547
           SG  +    G R
Sbjct: 552 SGNPILMLQGHR 563

 Score = 84.7 bits (208), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 106/215 (49%), Gaps = 36/215 (16%)

Query: 220 KLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAI 277
           KL+R W +  R+   V              KGH   + +L +  + + L +GS D ++ I
Sbjct: 363 KLIRIWNIKERKIVMV-------------LKGHEQDIYSLDYFPDGQKLVSGSGDRSIRI 409

Query: 278 WDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVT-GSLDKTIRVWNYKTGECIS------- 327
           WDL + +    LS   DGV T+    +E KL+  GSLD+++R+W+  TG  +        
Sbjct: 410 WDLKTGQCSLTLSIE-DGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNE 468

Query: 328 TYRGHTDSVMSVDAFKKI---IVSGSADKTVKIWHVESRTCYTLR------GHTEWVNCV 378
           +  GH DSV SV AF K    +VSGS D+TVK+W++      T +      GH ++V  V
Sbjct: 469 SGNGHQDSVYSV-AFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSV 527

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
                    FSGS D  + +WD  + + + + +GH
Sbjct: 528 ATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGH 562

 Score = 80.9 bits (198), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 87/170 (51%), Gaps = 23/170 (13%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YF-DEAKLVTGSLDKTIRVWNYK 321
             L TG+ D  + IW++   K++  L GH   + +L YF D  KLV+GS D++IR+W+ K
Sbjct: 354 EFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLK 413

Query: 322 TGEC---ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR--------- 369
           TG+C   +S   G T   +S +   K+I +GS D++V+IW  +S T + +          
Sbjct: 414 TGQCSLTLSIEDGVTTVAVSPNE-GKLIAAGSLDRSVRIW--DSSTGFLVERLDSDNESG 470

Query: 370 -GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI-----RTNSCLKVFRGH 413
            GH + V  V          SGS D T+++W++      T  C   + GH
Sbjct: 471 NGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGH 520

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 90/219 (41%), Gaps = 66/219 (30%)

Query: 344 KIIVSGSADKTVKIWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
           + + +G+ DK ++IW++ E +    L+GH + +  +   P      SGS D +IR+WD++
Sbjct: 354 EFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIRIWDLK 413

Query: 403 TNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXX 462
           T  C              + L+I D    V       NEG                    
Sbjct: 414 TGQC-------------SLTLSIEDGVTTVA---VSPNEG-------------------- 437

Query: 463 NDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIR-------TQFGHVEGVWDIA- 514
                            + + SLD ++++WD  TG  +        +  GH + V+ +A 
Sbjct: 438 ---------------KLIAAGSLDRSVRIWDSSTGFLVERLDSDNESGNGHQDSVYSVAF 482

Query: 515 -ADNFRIISGSHDGSIKIWDL-----QSGKCMHTFHGKR 547
             D   ++SGS D ++K+W+L      +GKC  T+ G +
Sbjct: 483 TKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHK 521

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 60/126 (47%), Gaps = 18/126 (14%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLC-----SNKLIRRLSGHTDGVKTLYF-- 301
           GH D V ++ F  + + + +GS D TV +W+L      + K      GH D V ++    
Sbjct: 472 GHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGTGKCEVTYIGHKDFVLSVATSN 531

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK---------KIIVSGSAD 352
           D+  + +GS D+ + +W+  +G  I   +GH  SV+SV             K+  +GS D
Sbjct: 532 DDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRKSVISVATVNSNVDDGKNYKLFATGSGD 591

Query: 353 KTVKIW 358
              +IW
Sbjct: 592 CKARIW 597

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 9/87 (10%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA---DNFRIISGSHDGSIKI 531
           P    L+S S D +I++WD++TGQC  T     +GV  +A    +   I +GS D S++I
Sbjct: 393 PDGQKLVSGSGDRSIRIWDLKTGQCSLT-LSIEDGVTTVAVSPNEGKLIAAGSLDRSVRI 451

Query: 532 WDLQSGKCMHTFHGKRLQPQDEEGSTH 558
           WD  +G     F  +RL   +E G+ H
Sbjct: 452 WDSSTG-----FLVERLDSDNESGNGH 473

>CAGL0M05335g complement(569132..571552) similar to sp|P38129
           Saccharomyces cerevisiae YBR198c Transcription
           initiation factor TFIID 90, hypothetical start
          Length = 806

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 80/179 (44%), Gaps = 27/179 (15%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIR------------------RLSGHTDGVKTLYF--DE 303
           RL   G  DS + IW L  + LI                    L GH+  V +  F  D 
Sbjct: 486 RLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDN 545

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVE 361
             LV+GS DKT+++W+  T   +  Y+GH   V  V          S S D+T ++W  +
Sbjct: 546 MYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACD 605

Query: 362 SRTCYTLR---GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
               Y LR   GHT  V+ V  HP     F+GS D T RMWD+ T   +++F GH   V
Sbjct: 606 H--IYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPV 662

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 94/193 (48%), Gaps = 14/193 (7%)

Query: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
           +KGH   V  ++F+       + S+D T  +W       +R  +GHT+ V T+ F  +  
Sbjct: 571 YKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGC 630

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS--VDAFKKIIVSGSADKTVKIWHVES 362
            + TGS DKT R+W+  TG+ +  + GHT  V+S  V    + + +GS D  + +W + +
Sbjct: 631 YVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGT 690

Query: 363 -RTCYTLRGHTE-WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSC------LKVFRGHV 414
            +    +RGH +  V+ +  + +     SG  D ++R+WD++  +        + F  HV
Sbjct: 691 GKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHV 750

Query: 415 GQVQKVIPLTIID 427
           G +   I   I D
Sbjct: 751 GDITASINQDIKD 763

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIW 532
           P   +L+S S D T+KLW + T   +    GH   VWD+  +       S SHD + ++W
Sbjct: 543 PDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLW 602

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 532
           P   +  S S D T +LW       +R   GH   V  ++   +   + +GS D + ++W
Sbjct: 585 PLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMW 644

Query: 533 DLQSGKCMHTFHG 545
           D+ +G  +  F G
Sbjct: 645 DVSTGDSVRLFLG 657

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 33/80 (41%), Gaps = 20/80 (25%)

Query: 486 DNTIKLWDVQTGQCIRTQF------------------GHVEGVWD--IAADNFRIISGSH 525
           D+ IK+W +     I  ++                  GH   V+    + DN  ++SGS 
Sbjct: 494 DSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSE 553

Query: 526 DGSIKIWDLQSGKCMHTFHG 545
           D ++K+W + +   +  + G
Sbjct: 554 DKTVKLWSMDTHTALVNYKG 573

>Scas_711.11
          Length = 695

 Score = 87.8 bits (216), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 75/338 (22%), Positives = 135/338 (39%), Gaps = 67/338 (19%)

Query: 214 TKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEF-----------KGHMDGVLTLQFN 262
           + DSNG +       Y  + +   N RK    +Q++           K H D +  L F+
Sbjct: 325 SADSNGDIADKLGQFYHNQNR---NSRKITPTLQQYFEKGSMINTIQKAHDDNITCLDFD 381

Query: 263 Y---RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWN 319
                L   G  D  + IWDL  +K I R++GH   V  +      LV+G  D  +++WN
Sbjct: 382 LPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVATVNCMQITNNMLVSGGKDALLKLWN 441

Query: 320 YKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVK 379
              G               V +F+ ++ + +++  ++     +   +T   H + +  V 
Sbjct: 442 LNVG---------------VQSFRNVLPTNNSN--LEPISSSASCIHTFDSHVDEITSVT 484

Query: 380 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS 439
           +  ++    SGS D TIR WDI +  CL+        +    P+ + D+  L     +  
Sbjct: 485 VAGENL--ISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASP-PIQVTDSPFLTTTKATA- 540

Query: 440 NEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQC 499
                                         +     +   L + + D  ++LWD++ G+ 
Sbjct: 541 -----------------------------IIGALQCFDAALATGTRDGIVRLWDLRAGKV 571

Query: 500 IRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSG 537
           +R   GH   +  +  DN  I++GS D +++IWDL+SG
Sbjct: 572 VRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSG 609

 Score = 70.1 bits (170), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L TG+ D  V +WDL + K++R L GH+  +  L FD   +VTGS+DKT+R+W+ ++G  
Sbjct: 552 LATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSG-I 610

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIW 358
           +S        V+SVD  K  I   + D+  K++
Sbjct: 611 LSDMLTFEKPVLSVDFDKNKIAIATHDEACKVY 643

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 77/186 (41%), Gaps = 33/186 (17%)

Query: 209 TNNTCTKDSNGKLMRPWK----------VIYRERFKVESNWRKGNCQVQEFKGHMDGVLT 258
           TNN         L++ W           V+      +E      +C +  F  H+D + +
Sbjct: 424 TNNMLVSGGKDALLKLWNLNVGVQSFRNVLPTNNSNLEPISSSASC-IHTFDSHVDEITS 482

Query: 259 LQFNYRLLFTGSYDSTVAIWDLCSNKLIRRL----------------------SGHTDGV 296
           +      L +GS D T+  WD+ S K ++ +                      +  T  +
Sbjct: 483 VTVAGENLISGSQDRTIRQWDIPSGKCLQTIDLSFVAIASPPIQVTDSPFLTTTKATAII 542

Query: 297 KTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVK 356
             L   +A L TG+ D  +R+W+ + G+ +    GH+ S+  +    K IV+GS DKTV+
Sbjct: 543 GALQCFDAALATGTRDGIVRLWDLRAGKVVRALEGHSGSITCLKFDNKNIVTGSIDKTVR 602

Query: 357 IWHVES 362
           IW + S
Sbjct: 603 IWDLRS 608

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/253 (20%), Positives = 100/253 (39%), Gaps = 60/253 (23%)

Query: 320 YKTGECISTY-RGHTDSVMSVD---AFKKIIVSGSADKTVKIWHVE-SRTCYTLRGHTEW 374
           ++ G  I+T  + H D++  +D    F  +  +G  D  +KIW +  S+    + GH   
Sbjct: 358 FEKGSMINTIQKAHDDNITCLDFDLPFGTLCTAGHLDHVIKIWDLSRSKQIGRMTGHVAT 417

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVD 434
           VNC+++   +    SG  D  +++W++  N  ++ FR                       
Sbjct: 418 VNCMQI--TNNMLVSGGKDALLKLWNL--NVGVQSFR----------------------- 450

Query: 435 NISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV 494
           N+  +N  + EP                 D     +        +L+S S D TI+ WD+
Sbjct: 451 NVLPTNNSNLEPISSSASCIHTF------DSHVDEITSVTVAGENLISGSQDRTIRQWDI 504

Query: 495 QTGQCIRT---QFGHVEG-------------------VWDIAADNFRIISGSHDGSIKIW 532
            +G+C++T    F  +                     +  +   +  + +G+ DG +++W
Sbjct: 505 PSGKCLQTIDLSFVAIASPPIQVTDSPFLTTTKATAIIGALQCFDAALATGTRDGIVRLW 564

Query: 533 DLQSGKCMHTFHG 545
           DL++GK +    G
Sbjct: 565 DLRAGKVVRALEG 577

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 77/180 (42%), Gaps = 25/180 (13%)

Query: 191 PLLHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFK 250
           P L   +A  +  A  C      T   +G ++R W            + R G   V+  +
Sbjct: 531 PFLTTTKATAIIGALQCFDAALATGTRDG-IVRLW------------DLRAGKV-VRALE 576

Query: 251 GHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGS 310
           GH   +  L+F+ + + TGS D TV IWDL S  L   L+     V ++ FD+ K+   +
Sbjct: 577 GHSGSITCLKFDNKNIVTGSIDKTVRIWDLRSGILSDMLT-FEKPVLSVDFDKNKIAIAT 635

Query: 311 LDKTIRVWNYKTGE---CISTYRGHT-DSVMSVDAFKKI------IVSGSADKTVKIWHV 360
            D+  +V++ +      C ST    T D  + V   + +      +V G +D T+  W V
Sbjct: 636 HDEACKVYDRQLNNLQTCTSTDEASTSDPTIPVSTVETMSYQNGYLVEGRSDGTINSWAV 695

>CAGL0H03729g 342948..343859 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8, start by
           similarity
          Length = 303

 Score = 85.1 bits (209), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 74/294 (25%), Positives = 129/294 (43%), Gaps = 20/294 (6%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTG 323
           LL +  YD T+  W+  +   +R +      V  L   ++ KL+  +  + IR+++ KT 
Sbjct: 4   LLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDKKLLAAAGHQNIRLYDIKTS 63

Query: 324 EC--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378
               ++++ GH  +V SV +F+   K +V+ S D T+K+W + S +      H   VN V
Sbjct: 64  NSNPVASFEGHRGNVTSV-SFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYKHNAPVNEV 122

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTII----DAENLVVD 434
            +HP      S   D  IR+WD+  N C      H    +  +PL  +    D   LV  
Sbjct: 123 VIHPNQGELISCDRDGNIRIWDLGENQCT-----HQLTPEDDVPLQSLSVASDGSMLVAA 177

Query: 435 NISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV 494
           N  G+    + P                +      +  S     H+ +CS D+T ++W V
Sbjct: 178 NNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDV-KHMATCSADHTARIWSV 236

Query: 495 QTGQCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           +    + +   GH   VWD A  AD+  +++ S D  +++WDL +   +  + G
Sbjct: 237 EDNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGG 290

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/225 (23%), Positives = 85/225 (37%), Gaps = 58/225 (25%)

Query: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK--TLYF 301
           V  F+GH   V ++ F  + + + T S D T+ +WD+ S  + R    H   V    ++ 
Sbjct: 68  VASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVWDIRSPSVPRNYK-HNAPVNEVVIHP 126

Query: 302 DEAKLVTGSLDKTIRVWNYKTGEC-----------ISTYRGHTDSVMSVDA--------- 341
           ++ +L++   D  IR+W+    +C           + +    +D  M V A         
Sbjct: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDVPLQSLSVASDGSMLVAANNKGNCYVW 186

Query: 342 ----------------FK---------------KIIVSGSADKTVKIWHVESRTCY--TL 368
                           FK               K + + SAD T +IW VE       TL
Sbjct: 187 EMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDNFNLESTL 246

Query: 369 RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGH 291

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 45/112 (40%), Gaps = 20/112 (17%)

Query: 241 KGNCQVQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTVAIWDLCSN 283
           KGNC V E   H D                   + L  + + + T S D T  IW +  N
Sbjct: 180 KGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSDVKHMATCSADHTARIWSVEDN 239

Query: 284 -KLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGH 332
             L   L GH   V    F  D A LVT S D  +R+W+  T + I  Y GH
Sbjct: 240 FNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTRDIIRQYGGH 291

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 8/76 (10%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 537
           +++ S D TIK+WD+++    R  + H   V ++    +   +IS   DG+I+IWDL   
Sbjct: 90  MVTSSEDGTIKVWDIRSPSVPR-NYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN 148

Query: 538 KCMHTFHGKRLQPQDE 553
           +C H     +L P+D+
Sbjct: 149 QCTH-----QLTPEDD 159

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 40/76 (52%), Gaps = 13/76 (17%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRT------QFGHVEGVWDIAADNFRIISGSHDGSIKIWD 533
           L+S   D+TI+ W+  TG C+RT      Q   +E       ++ ++++ +   +I+++D
Sbjct: 5   LVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLE-----ITNDKKLLAAAGHQNIRLYD 59

Query: 534 LQSGKC--MHTFHGKR 547
           +++     + +F G R
Sbjct: 60  IKTSNSNPVASFEGHR 75

 Score = 29.6 bits (65), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV 510
            +L++ S D+ ++LWD+ T   IR   GH +G 
Sbjct: 263 AYLVTASSDHYVRLWDLSTRDIIRQYGGHHKGA 295

>KLLA0F04884g complement(478044..481682) similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 coatomer complex
           alpha chain of secretory pathway vesicles, start by
           similarity
          Length = 1212

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 103/239 (43%), Gaps = 41/239 (17%)

Query: 223 RPWKVIYRERFKVES-NWRKGNCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWD 279
           RPW ++      ++  ++R G   +  F+ H   V  + F+    L  +   D T+ +W 
Sbjct: 23  RPWVLVALFSSTIQLWDYRMG-VLLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWS 81

Query: 280 LCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVM 337
           L SNK +  L GH D V+T++F      +++ S D+TIR+WN++  + I+   GH   VM
Sbjct: 82  LESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVM 141

Query: 338 --SVDAFKKIIVSGSADKTVKIWHVESR-------------------------------T 364
                  + ++VS S D+TV++W +                                   
Sbjct: 142 CAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVV 201

Query: 365 CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF--RGHVGQVQKVI 421
            + L GHT  VN    HP      SGSDD  +++W +      +V   RGH   V  VI
Sbjct: 202 KFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

 Score = 82.8 bits (203), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 94/200 (47%), Gaps = 39/200 (19%)

Query: 251 GHMDGVLTLQFNYRL--LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKL 306
           GH+D V T+ F++ L  + + S D T+ IW+  + K I  L+GH   V    F   E  +
Sbjct: 93  GHLDYVRTVFFHHELPWIISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLV 152

Query: 307 VTGSLDKTIRVWNYKT----------------------------GECISTY--RGHTDSV 336
           V+ SLD+T+RVW+                               G+C+  +   GHT  V
Sbjct: 153 VSASLDETVRVWDISGLRKRHSAPGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGV 212

Query: 337 --MSVDAFKKIIVSGSADKTVKIWHVESRTCY---TLRGHTEWVNCVKLHPKSFTCFSGS 391
              S      +IVSGS D+ VK+W + +   +   T RGHT  V+ V  HP+     S  
Sbjct: 213 NWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQNLIISVG 272

Query: 392 DDTTIRMWDIRTNSCLKVFR 411
           +D T+R+WD+   + +K F+
Sbjct: 273 EDKTVRVWDLDKRTPIKQFK 292

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 67/290 (23%), Positives = 115/290 (39%), Gaps = 30/290 (10%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD- 340
           K++ +    +   K + F  ++  ++      TI++W+Y+ G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGIDF 61

Query: 341 -AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
              + + VS   D T+K+W +ES  C +TL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYTIKVWSLESNKCLFTLDGHLDYVRTVFFHHELPWIISSSDDQTIRI 121

Query: 399 WDIRTNSCLKVFRGH-----VGQVQKVIPLTIIDA--ENLVVDNISGSNEGDDEPXXXXX 451
           W+ +    +    GH       Q   V  L +  +  E + V +ISG  +    P     
Sbjct: 122 WNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVRVWDISGLRKRHSAPGTQSF 181

Query: 452 XXXXXXXXXXXNDEENQTLDKSI--------------PYPTHLLSCSLDNTIKLWDVQTG 497
                      +      + K I              P    ++S S D  +KLW +   
Sbjct: 182 EEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSAT 241

Query: 498 QC--IRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTF 543
           +   + T  GH   V  +        IIS   D ++++WDL     +  F
Sbjct: 242 KAWEVDTCRGHTNNVDSVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQF 291

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 62/128 (48%), Gaps = 8/128 (6%)

Query: 242 GNCQVQE-FKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKL--IRRLSGHTDGV 296
           G+C V+   +GH  GV    F+    L+ +GS D  V +W + + K   +    GHT+ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNV 256

Query: 297 KTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSA-DK 353
            ++ F   +  +++   DKT+RVW+      I  ++   D    V A   + + G+A D 
Sbjct: 257 DSVIFHPQQNLIISVGEDKTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLFGAAHDS 316

Query: 354 TVKIWHVE 361
            + I+ ++
Sbjct: 317 GIMIFKLD 324

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 68/197 (34%), Gaps = 54/197 (27%)

Query: 354 TVKIW-HVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
           T+++W +      +    H   V  +  HP      S  DD TI++W + +N CL    G
Sbjct: 34  TIQLWDYRMGVLLHRFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLESNKCLFTLDG 93

Query: 413 HVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDK 472
           H+  V+ V                                                    
Sbjct: 94  HLDYVRTVF------------------------------------------------FHH 105

Query: 473 SIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIK 530
            +P+   ++S S D TI++W+ Q  + I    GH   V           ++S S D +++
Sbjct: 106 ELPW---IISSSDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPVEDLVVSASLDETVR 162

Query: 531 IWDLQSGKCMHTFHGKR 547
           +WD+   +  H+  G +
Sbjct: 163 VWDISGLRKRHSAPGTQ 179

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 536
           +L     +TI+LWD + G  +       G V G+ D        +S   D +IK+W L+S
Sbjct: 26  VLVALFSSTIQLWDYRMGVLLHRFEDHEGPVRGI-DFHPTQPLFVSAGDDYTIKVWSLES 84

Query: 537 GKCMHTFHG 545
            KC+ T  G
Sbjct: 85  NKCLFTLDG 93

>Kwal_27.12667
          Length = 721

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 128/328 (39%), Gaps = 75/328 (22%)

Query: 230 RERFKVESNWRKGNCQVQEF-KGHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKL 285
           R+ +     + +   Q+  F K H D +  L F+     +   G  D +V IW+L     
Sbjct: 380 RKTYPTLQQFYEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQ 439

Query: 286 IRRLSGHTDGVKTLYFDEA-KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK 344
           I  L GH   V  +  +++  L+TG  D  +++W+ +  E +     + D     +    
Sbjct: 440 IGALPGHLASVSCMQMEDSHSLITGGRDALLKLWDIEKAEEL-----YNDGATEGE---- 490

Query: 345 IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN 404
                           E    +T   H + +    LH +  +  SGS D TIR WD+ T 
Sbjct: 491 ----------------EELCVHTFDAHVDEITA--LHFEGNSLVSGSQDRTIRQWDLTTG 532

Query: 405 SCLKVF------RGHVGQVQKVI---PLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXX 455
            CL+        RG  G   K+    P + I    L+  N        D P         
Sbjct: 533 KCLQTIDINFANRGTSGGFSKISSNNPRSSI----LLTHN--------DPPVIGALQC-- 578

Query: 456 XXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA 515
                               Y   + + + D  ++LWD+++GQ IRT  GH + V  +  
Sbjct: 579 --------------------YDAAMATGTKDGLVRLWDLRSGQVIRTLEGHTDAVTGLQF 618

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMHTF 543
           D+  +++GS D SI+IWDL++G     F
Sbjct: 619 DSVNLVTGSLDRSIRIWDLRTGLLADAF 646

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/266 (24%), Positives = 108/266 (40%), Gaps = 87/266 (32%)

Query: 320 YKTGECISTY-RGHTDSVMSVD---AFKKIIVSGSADKTVKIWHVESRT-CYTLRGHTEW 374
           Y+ G  IS++ + H DS+  +D    F  +  +G  D +VKIW++  +T    L GH   
Sbjct: 390 YEPGTQISSFPKAHDDSITCLDFDLPFGTMCTAGKLDHSVKIWNLSKKTQIGALPGHLAS 449

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVD 434
           V+C+++   S +  +G  D  +++WDI                          AE L  D
Sbjct: 450 VSCMQME-DSHSLITGGRDALLKLWDIEK------------------------AEELYND 484

Query: 435 NISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT-------HLLSCSLDN 487
              G+ EG++E                       T D  +   T        L+S S D 
Sbjct: 485 ---GATEGEEELCV-------------------HTFDAHVDEITALHFEGNSLVSGSQDR 522

Query: 488 TIKLWDVQTGQCIRT------QFGHVEGVWDIAADNFR---------------------- 519
           TI+ WD+ TG+C++T        G   G   I+++N R                      
Sbjct: 523 TIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSILLTHNDPPVIGALQCYDAA 582

Query: 520 IISGSHDGSIKIWDLQSGKCMHTFHG 545
           + +G+ DG +++WDL+SG+ + T  G
Sbjct: 583 MATGTKDGLVRLWDLRSGQVIRTLEG 608

>Sklu_2431.12 YBR198C, Contig c2431 17817-20066 reverse complement
          Length = 749

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/173 (31%), Positives = 79/173 (45%), Gaps = 22/173 (12%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLS-------------GHTDGVKTLYF--DEAKLVTG 309
           L   G  DS + +W L    L  +L              GH+  V +  F  D   L++ 
Sbjct: 435 LAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSA 494

Query: 310 SLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTCYT 367
           S DKT+R+W+  T   + +Y+GH   V  +S         + S D+T ++W  +    Y 
Sbjct: 495 SEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDH--IYP 552

Query: 368 LR---GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
           LR   GH   V+CV  HP     F+GS D T RMWDI T   +++F GH   V
Sbjct: 553 LRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPV 605

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 81/166 (48%), Gaps = 8/166 (4%)

Query: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
           +KGH   V  + F+       T S+D T  +W       +R  +GH + V  + F  +  
Sbjct: 514 YKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGT 573

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS--VDAFKKIIVSGSADKTVKIWHVES 362
            + TGS DKT R+W+  TG+ +  + GHT  V+S  V    + + +GS D  + +W + +
Sbjct: 574 YVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGT 633

Query: 363 -RTCYTLRGHTE-WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSC 406
            +    +RGH +  V  +    +     SG  D ++R+WD++ ++ 
Sbjct: 634 GKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLKRSTA 679

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 75/170 (44%), Gaps = 7/170 (4%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--L 306
           GH   V +  F  + + L + S D TV +W + +   +    GH   V  + F       
Sbjct: 474 GHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYF 533

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRT 364
            T S D+T R+W+      +  + GH + V  +S       + +GS DKT ++W + +  
Sbjct: 534 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGD 593

Query: 365 CYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
              L  GHT  V    + P      +GS+D  I +WDI T   LK  RGH
Sbjct: 594 SVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGH 643

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 103/265 (38%), Gaps = 70/265 (26%)

Query: 300 YFDEAKLVT-GSLDKTIRVWNY-----------KTGECI--STYRGHTDSVMSVD--AFK 343
           + D+A L   G  D  I++W+            K  E I  +T  GH+ +V S       
Sbjct: 429 FSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYSTSFSPDN 488

Query: 344 KIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
           K ++S S DKTV++W +++  +  + +GH   V  V   P      + S D T R+W   
Sbjct: 489 KYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW--- 545

Query: 403 TNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXX 462
             SC  ++           PL I       VD +S    G                    
Sbjct: 546 --SCDHIY-----------PLRIFAGHLNDVDCVSFHPNG-------------------- 572

Query: 463 NDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD--IAADNFRI 520
                          T++ + S D T ++WD+ TG  +R   GH   V    ++ D   +
Sbjct: 573 ---------------TYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWL 617

Query: 521 ISGSHDGSIKIWDLQSGKCMHTFHG 545
            +GS DG I +WD+ +GK +    G
Sbjct: 618 STGSEDGIINVWDIGTGKRLKQMRG 642

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVE-GVWDI--AADNFRIISGSHDGSIKIWDLQ 535
           L + S D  I +WD+ TG+ ++   GH +  V+ +  + +   ++SG  D S+++WDL+
Sbjct: 617 LSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

>CAGL0I03718g complement(317565..321170) highly similar to sp|P53622
           Saccharomyces cerevisiae YDL145c RET1 Coatomer alpha
           subunit, start by similarity
          Length = 1201

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/239 (23%), Positives = 108/239 (45%), Gaps = 41/239 (17%)

Query: 223 RPWKVIYRERFKVES-NWRKGNCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWD 279
           RPW ++      ++  ++R G   +  F+GH   V  + F+    +  +   D+++ +W 
Sbjct: 23  RPWALVALFSSTIQLWDYRMGTL-LHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWS 81

Query: 280 LCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVM 337
           L +N+ +  L+GH D V+T++F      +++ S D+T+R+WN++  + ++   GH   VM
Sbjct: 82  LETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVM 141

Query: 338 --SVDAFKKIIVSGSADKTVKIWHVES-------------------------------RT 364
                  + ++VS S D+TV++W +                                 + 
Sbjct: 142 CAQFHQTEDLVVSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKV 201

Query: 365 CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF--RGHVGQVQKVI 421
            + L GHT  VN    HP      +G DD  +++W + +N   +V   RGH   V  V+
Sbjct: 202 KFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVV 260

 Score = 80.9 bits (198), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 93/200 (46%), Gaps = 39/200 (19%)

Query: 251 GHMDGVLTLQFNYRL--LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--L 306
           GH+D V T+ F+  L  + + S D TV IW+  + K +  L+GH   V    F + +  +
Sbjct: 93  GHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLV 152

Query: 307 VTGSLDKTIRVWNYKT----------------------------GECISTY--RGHTDSV 336
           V+ SLD+T+RVW+                               G+C   +   GHT  V
Sbjct: 153 VSASLDETVRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGV 212

Query: 337 --MSVDAFKKIIVSGSADKTVKIWHVESRTCY---TLRGHTEWVNCVKLHPKSFTCFSGS 391
              S      +IV+G  D+ VK+W + S   +   T RGHT  V+CV  HP      S +
Sbjct: 213 NWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVA 272

Query: 392 DDTTIRMWDIRTNSCLKVFR 411
           +D T+R+WD+   + +K F+
Sbjct: 273 EDKTLRIWDLDKRTPVKQFK 292

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 67/135 (49%), Gaps = 5/135 (3%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD- 340
           KL+ +    +   K + F  ++   +      TI++W+Y+ G  +  + GH   V +VD 
Sbjct: 2   KLLTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEGPVRAVDF 61

Query: 341 -AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
              + I VS   D ++K+W +E+  C YTL GH ++V  V  H +     S SDD T+R+
Sbjct: 62  HPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRI 121

Query: 399 WDIRTNSCLKVFRGH 413
           W+ +    L    GH
Sbjct: 122 WNWQNRKELACLTGH 136

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/195 (20%), Positives = 68/195 (34%), Gaps = 54/195 (27%)

Query: 354 TVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
           T+++W     T  +   GH   V  V  HP      S  DD +I++W + TN CL    G
Sbjct: 34  TIQLWDYRMGTLLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYTLTG 93

Query: 413 HVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDK 472
           H+  V+ V                                                    
Sbjct: 94  HLDYVRTVF------------------------------------------------FHS 105

Query: 473 SIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIK 530
            +P+   ++S S D T+++W+ Q  + +    GH   V           ++S S D +++
Sbjct: 106 ELPW---VISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDETVR 162

Query: 531 IWDLQSGKCMHTFHG 545
           +WD+   +  H+  G
Sbjct: 163 VWDISGLRKKHSAPG 177

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 64/128 (50%), Gaps = 8/128 (6%)

Query: 242 GNCQVQE-FKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKL--IRRLSGHTDGV 296
           G+C+V+   +GH  GV    F+    L+ TG  D  V +W + SNK   +    GHT+ V
Sbjct: 197 GDCKVKFILEGHTRGVNWASFHPTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNV 256

Query: 297 KTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSA-DK 353
             + F  D+  +++ + DKT+R+W+      +  ++   D    + +   + + G+A D 
Sbjct: 257 DCVVFHPDQNLILSVAEDKTLRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDS 316

Query: 354 TVKIWHVE 361
            + I+ ++
Sbjct: 317 GIMIFKLD 324

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 36/70 (51%), Gaps = 8/70 (11%)

Query: 481 LSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDLQ 535
           L     +TI+LWD + G  +    GH EG   + A +F       +S   D SIK+W L+
Sbjct: 27  LVALFSSTIQLWDYRMGTLLHRFEGH-EG--PVRAVDFHPTQPIFVSAGDDASIKVWSLE 83

Query: 536 SGKCMHTFHG 545
           + +C++T  G
Sbjct: 84  TNRCLYTLTG 93

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/172 (20%), Positives = 63/172 (36%), Gaps = 57/172 (33%)

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNIS 437
           +  HP           +TI++WD R  + L  F GH G      P+  +D          
Sbjct: 17  IAFHPSRPWALVALFSSTIQLWDYRMGTLLHRFEGHEG------PVRAVDF--------- 61

Query: 438 GSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTH--LLSCSLDNTIKLWDVQ 495
                                                 +PT    +S   D +IK+W ++
Sbjct: 62  --------------------------------------HPTQPIFVSAGDDASIKVWSLE 83

Query: 496 TGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           T +C+ T  GH++ V  +   ++   +IS S D +++IW+ Q+ K +    G
Sbjct: 84  TNRCLYTLTGHLDYVRTVFFHSELPWVISASDDQTVRIWNWQNRKELACLTG 135

>YDL145C (COP1) [723] chr4 complement(194572..198177) Coatomer
           (COPI) complex alpha chain (alpha-COP) of secretory
           pathway vesicles required for retrograde Golgi to
           endoplasmic reticulum transport, member of WD (WD-40)
           repeat family [3606 bp, 1201 aa]
          Length = 1201

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 103/239 (43%), Gaps = 41/239 (17%)

Query: 223 RPWKVIYRERFKVES-NWRKGNCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWD 279
           RPW ++      ++  ++R G   +  F+ H   V  L F+    +  +   D T+ +W 
Sbjct: 23  RPWVLVALFSSTIQLWDYRMGTL-LHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWS 81

Query: 280 LCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVM 337
           L +NK +  L+GH D V+T++F      +++ S D+TIR+WN++  + I+   GH   VM
Sbjct: 82  LDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVM 141

Query: 338 --SVDAFKKIIVSGSADKTVKIWHVESR-------------------------------T 364
                    +IVS S D+T++IW +                                   
Sbjct: 142 CAQFHPTDDLIVSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVV 201

Query: 365 CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF--RGHVGQVQKVI 421
            + L GHT  VN    HP      SGSDD  +++W +      +V   RGH   V  VI
Sbjct: 202 KFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVI 260

 Score = 79.7 bits (195), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 91/200 (45%), Gaps = 39/200 (19%)

Query: 251 GHMDGVLTLQFNYRL--LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--L 306
           GH+D V T+ F+  L  + + S D T+ IW+  + K I  L+GH   V    F      +
Sbjct: 93  GHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLI 152

Query: 307 VTGSLDKTIRVWNYK----------------------------TGECISTY--RGHTDSV 336
           V+ SLD+TIR+W+                               G+C+  +   GHT  V
Sbjct: 153 VSASLDETIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGV 212

Query: 337 --MSVDAFKKIIVSGSADKTVKIWHVESRTCY---TLRGHTEWVNCVKLHPKSFTCFSGS 391
              S      +IVSGS D+ VK+W + +   +   T RGHT  V+ V  HP      S  
Sbjct: 213 NWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLIISVG 272

Query: 392 DDTTIRMWDIRTNSCLKVFR 411
           +D T+R+WD+   + +K F+
Sbjct: 273 EDKTLRVWDLDKRTPVKQFK 292

 Score = 68.9 bits (167), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 66/135 (48%), Gaps = 5/135 (3%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD- 340
           K++ +    +   K + F  ++  ++      TI++W+Y+ G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDF 61

Query: 341 -AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
              + I VS   D T+K+W +++  C YTL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWIISASDDQTIRI 121

Query: 399 WDIRTNSCLKVFRGH 413
           W+ +    +    GH
Sbjct: 122 WNWQNRKEIACLTGH 136

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 69/195 (35%), Gaps = 54/195 (27%)

Query: 354 TVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
           T+++W     T  +    H   V  +  HP      S  DD TI++W + TN CL    G
Sbjct: 34  TIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTG 93

Query: 413 HVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDK 472
           H+  V+ V                                                   +
Sbjct: 94  HLDYVRTVF------------------------------------------------FHR 105

Query: 473 SIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIK 530
            +P+   ++S S D TI++W+ Q  + I    GH   V        +  I+S S D +I+
Sbjct: 106 ELPW---IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIR 162

Query: 531 IWDLQSGKCMHTFHG 545
           IWD+   +  H+  G
Sbjct: 163 IWDISGLRKRHSAPG 177

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 64/133 (48%), Gaps = 9/133 (6%)

Query: 242 GNCQVQE-FKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKL--IRRLSGHTDGV 296
           G+C V+   +GH  GV    F+    L+ +GS D  V +W + + K   +    GHT+ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNV 256

Query: 297 KTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSA-DK 353
            ++ F   +  +++   DKT+RVW+      +  ++   D    + A   I + G+A D 
Sbjct: 257 DSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDS 316

Query: 354 TVKIWHVE-SRTC 365
            + ++ ++  R C
Sbjct: 317 GIMVFKLDRERPC 329

 Score = 37.7 bits (86), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 536
           +L     +TI+LWD + G  +       G V G+ D        +S   D +IK+W L +
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGL-DFHPTQPIFVSAGDDYTIKVWSLDT 84

Query: 537 GKCMHTFHG 545
            KC++T  G
Sbjct: 85  NKCLYTLTG 93

>CAGL0D02090g join(214357..214893,215564..215860) highly similar to
           sp|P38011 Saccharomyces cerevisiae YMR116c ASC1
          Length = 277

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/179 (33%), Positives = 92/179 (51%), Gaps = 22/179 (12%)

Query: 249 FKGHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKL-----IRRLSGHTDGVK--T 298
            +GH   V +L  +     LL + S D T+  W L  +       ++   GH+  V+  T
Sbjct: 13  LEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDCT 72

Query: 299 LYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVK 356
           L  + A  ++GS DKT+R+W+  TGE   T+ GH   VMSV   KK  +I+SGS DK++K
Sbjct: 73  LTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIK 132

Query: 357 IWHVESRTCYTLRGHTEWVNCVKLHPKS-----FTCFSGSDDTTIR-MWDIRTNSCLKV 409
           +W ++     TL GH +WV+ V++   S      T  S  +D  ++ +W    NS  KV
Sbjct: 133 VWSIKGDCLATLIGHNDWVSQVRIANSSDDDDKVTVISAGNDKMVKVLW----NSAAKV 187

 Score = 69.7 bits (169), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/166 (30%), Positives = 85/166 (51%), Gaps = 15/166 (9%)

Query: 233 FKVESNWRKGNCQVQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLS 290
           +K+  + +K    V+ FKGH   V   TL  N     +GS+D T+ +WD+ + +  +   
Sbjct: 45  WKLTGDDQKFGVPVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQTFV 104

Query: 291 GHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV-------DA 341
           GH   V ++  D+  + +++GS DK+I+VW+ K G+C++T  GH D V  V       D 
Sbjct: 105 GHKGDVMSVAIDKKASMIISGSRDKSIKVWSIK-GDCLATLIGHNDWVSQVRIANSSDDD 163

Query: 342 FKKIIVSGSADKTVKI-WHVESRT-CYTLRGHTEWVNCVKLHPKSF 385
            K  ++S   DK VK+ W+  ++   YTL    E V  +   P  +
Sbjct: 164 DKVTVISAGNDKMVKVLWNSAAKVPMYTLSAGDE-VYALSFSPNRY 208

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 41/70 (58%), Gaps = 3/70 (4%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDLQ 535
            + LS S D T++LWDV TG+  +T  GH   V  +A D     IISGS D SIK+W ++
Sbjct: 78  AYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSIK 137

Query: 536 SGKCMHTFHG 545
            G C+ T  G
Sbjct: 138 -GDCLATLIG 146

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 83/233 (35%), Gaps = 69/233 (29%)

Query: 328 TYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESR------TCYTLRGHTEWVNCV 378
           T  GH   V S+        +++S S DKT+  W +            + +GH+  V   
Sbjct: 12  TLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDC 71

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            L        SGS D T+R+WD+ T    + F GH G V  V                  
Sbjct: 72  TLTENGAYALSGSWDKTLRLWDVATGETFQTFVGHKGDVMSV------------------ 113

Query: 439 SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQ 498
                                          +DK     + ++S S D +IK+W ++ G 
Sbjct: 114 ------------------------------AIDKK---ASMIISGSRDKSIKVWSIK-GD 139

Query: 499 CIRTQFGHVEGVWDIAA-------DNFRIISGSHDGSIKI-WDLQSGKCMHTF 543
           C+ T  GH + V  +         D   +IS  +D  +K+ W+  +   M+T 
Sbjct: 140 CLATLIGHNDWVSQVRIANSSDDDDKVTVISAGNDKMVKVLWNSAAKVPMYTL 192

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 469 TLDKSIPYPTHLLSCSLDNTIKLW-----DVQTGQCIRTQFGHVEGVWD--IAADNFRII 521
           +L  S   P  LLS S D T+  W     D + G  +++  GH   V D  +  +    +
Sbjct: 22  SLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVKSFKGHSHIVQDCTLTENGAYAL 81

Query: 522 SGSHDGSIKIWDLQSGKCMHTFHGKR 547
           SGS D ++++WD+ +G+   TF G +
Sbjct: 82  SGSWDKTLRLWDVATGETFQTFVGHK 107

>Scas_603.5
          Length = 589

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/275 (23%), Positives = 125/275 (45%), Gaps = 22/275 (8%)

Query: 288 RLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRG-HTDSVMSVD---AFK 343
           +L  +  G+  +  D A+++    +      + K+G  + T    +TD+V  +D   + K
Sbjct: 248 KLDPNIRGINNVMNDPAQVMFFHKNDKENNEDLKSGSHLGTLDSVYTDTVTCLDFDLSTK 307

Query: 344 KIIVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI- 401
            +  +G  + ++K+W +E+      L  H   V C++LHP S T  +GS D T+++WD+ 
Sbjct: 308 MLYTAGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDLG 367

Query: 402 -----------RTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS-NEGDDEPXXX 449
                        +SC+  F  H  ++  V      D E L+  +   S  + D      
Sbjct: 368 LAPQTSLDSTSNIDSCINTFEAHTAEITSV----SYDNEYLLSASRDKSIRQWDLTTGNC 423

Query: 450 XXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEG 509
                         + ++ T++        L + S D  I+LWD+++G+ +RT   H   
Sbjct: 424 VQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGP 483

Query: 510 VWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 544
           +  +  D+ +II+GS D +I + DL++G  + T+H
Sbjct: 484 ITSLQFDSTKIITGSTDANISVSDLRTGNILETYH 518

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/231 (25%), Positives = 103/231 (44%), Gaps = 34/231 (14%)

Query: 218 NGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLT-----LQFNY--RLLFT-G 269
           N  +  P +V++  +   E+N    + +     G +D V T     L F+   ++L+T G
Sbjct: 257 NNVMNDPAQVMFFHKNDKENN---EDLKSGSHLGTLDSVYTDTVTCLDFDLSTKMLYTAG 313

Query: 270 SYDSTVAIWDLCSNKLIRRLSGHTDGVK--TLYFDEAKLVTGSLDKTIRVWNYKTG---- 323
            Y++++ +WDL +N  +  L  H   V    L+ D   L+TGS D T+++W+        
Sbjct: 314 KYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDLGLAPQTS 373

Query: 324 --------ECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCY-TLRG---H 371
                    CI+T+  HT  + SV    + ++S S DK+++ W + +  C  TL     H
Sbjct: 374 LDSTSNIDSCINTFEAHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSH 433

Query: 372 TEWVN-----CVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
               N        L        +GS D  IR+WD+R+   ++    H G +
Sbjct: 434 NSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPI 484

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 95/218 (43%), Gaps = 36/218 (16%)

Query: 243 NCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDL----------CSN--KLIRR 288
           N QV +   H+  V  +Q   + + L TGS D+T+ +WDL           SN    I  
Sbjct: 327 NDQVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINT 386

Query: 289 LSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRG----------HTDSVMS 338
              HT  + ++ +D   L++ S DK+IR W+  TG C+ T                +V +
Sbjct: 387 FEAHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEA 446

Query: 339 VDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIR 397
           + +    + +GS D  +++W + S +   TL  H   +  ++    S    +GS D  I 
Sbjct: 447 LQSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQF--DSTKIITGSTDANIS 504

Query: 398 MWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAEN--LVV 433
           + D+RT + L+ +           P+   D EN  LVV
Sbjct: 505 VSDLRTGNILETYHCDA-------PINTFDFENDKLVV 535

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 90/212 (42%), Gaps = 27/212 (12%)

Query: 162 QILADDDRVWYHMCEQ-HIDRKCPNCGWGLPLLHMKRARFVKNASICATNN--TCTKDSN 218
           Q++  DD +    C Q H D K    G     L +         S+ +T+N  +C     
Sbjct: 329 QVMDLDDHIASVTCMQLHPDSKTLITGSKDATLKLWDLGLAPQTSLDSTSNIDSCINTFE 388

Query: 219 GKLMRPWKVIYRERFKVESNWRK---------GNCQVQEFKG---HMDG-------VLTL 259
                   V Y   + + ++  K         GNC VQ  +    H  G       V  L
Sbjct: 389 AHTAEITSVSYDNEYLLSASRDKSIRQWDLTTGNC-VQTLEATLSHNSGTNIKDSTVEAL 447

Query: 260 QFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWN 319
           Q     L TGS D  + +WDL S K++R L  H   + +L FD  K++TGS D  I V +
Sbjct: 448 QSVGAALATGSKDGIIRLWDLRSGKVVRTLLKHQGPITSLQFDSTKIITGSTDANISVSD 507

Query: 320 YKTGECISTYRGHTDSVMSVDAFK--KIIVSG 349
            +TG  + TY  H D+ ++   F+  K++V+ 
Sbjct: 508 LRTGNILETY--HCDAPINTFDFENDKLVVAA 537

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 71/156 (45%), Gaps = 14/156 (8%)

Query: 212 TCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSY 271
           T +KD+  KL   W +    +  ++S     +C +  F+ H   + ++ ++   L + S 
Sbjct: 354 TGSKDATLKL---WDLGLAPQTSLDSTSNIDSC-INTFEAHTAEITSVSYDNEYLLSASR 409

Query: 272 DSTVAIWDLCSNKLIRRLSG---HTDG-------VKTLYFDEAKLVTGSLDKTIRVWNYK 321
           D ++  WDL +   ++ L     H  G       V+ L    A L TGS D  IR+W+ +
Sbjct: 410 DKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGAALATGSKDGIIRLWDLR 469

Query: 322 TGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKI 357
           +G+ + T   H   + S+      I++GS D  + +
Sbjct: 470 SGKVVRTLLKHQGPITSLQFDSTKIITGSTDANISV 505

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 59/119 (49%), Gaps = 7/119 (5%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDG-VKTLYFDEA 304
           V+    H   + +LQF+   + TGS D+ +++ DL +  ++   + H D  + T  F+  
Sbjct: 474 VRTLLKHQGPITSLQFDSTKIITGSTDANISVSDLRTGNILE--TYHCDAPINTFDFEND 531

Query: 305 KLVTGSLDKTIRVWNYKTGE---CISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV 360
           KLV  +  K +RV N   G    C       + +V SV   KK+++ G ++  + +WH+
Sbjct: 532 KLVVAADTKDVRVINRNNGSHWNCDIKVPDESTTV-SVKLKKKLMIEGRSNGVINLWHI 589

>KLLA0F10263g 949926..951974 gi|2494900|sp|P56094|TUP1_KLULA
           Kluyveromyces lactis Transcriptional repressor TUP1,
           start by similarity
          Length = 682

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 97/210 (46%), Gaps = 30/210 (14%)

Query: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE 303
           V   KGH   + +L +  +   L +GS D TV IWDL +      LS   DGV T+    
Sbjct: 441 VMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTGTCSLTLSIE-DGVTTVAVSP 499

Query: 304 AK---LVTGSLDKTIRVWNYKTGECISTY-------RGHTDSVMSVDAFK--KIIVSGSA 351
            +   +  GSLD+T+RVW+  TG  +           GH DSV SV   +  K +VSGS 
Sbjct: 500 GEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSL 559

Query: 352 DKTVKIW----------HVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
           D++VK+W          H E    YT  GH ++V  V          SGS D  +  WD 
Sbjct: 560 DRSVKLWNLNGLSGQKSHAECEVTYT--GHKDFVLSVATTQNDEYILSGSKDRGVLFWDT 617

Query: 402 RTNSCLKVFRGHVGQVQKVIPLTIIDAENL 431
           ++ + L + +GH      VI +T+ +   L
Sbjct: 618 KSGNPLLMLQGH---RNSVISVTVANGHPL 644

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 110/261 (42%), Gaps = 70/261 (26%)

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESR 363
           L TG+ DK IR+W+ +T + + T +GH   + S+D F     +VSGS D+TV+IW + + 
Sbjct: 421 LATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLTTG 480

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCF-SGSDDTTIRMWDI-------RTNSCLKVFRGHVG 415
           TC       + V  V + P       +GS D T+R+WD        R +S  ++  GH  
Sbjct: 481 TCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRD 540

Query: 416 QVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIP 475
            V  V+     D + +V    SGS                              LD+S  
Sbjct: 541 SVYSVV--FTRDGKGVV----SGS------------------------------LDRS-- 562

Query: 476 YPTHLLSCSLDNTIKLWDVQ--TGQ-----CIRTQFGHVEGVWDIAA--DNFRIISGSHD 526
                        +KLW++   +GQ     C  T  GH + V  +A   ++  I+SGS D
Sbjct: 563 -------------VKLWNLNGLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKD 609

Query: 527 GSIKIWDLQSGKCMHTFHGKR 547
             +  WD +SG  +    G R
Sbjct: 610 RGVLFWDTKSGNPLLMLQGHR 630

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 344 KIIVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
           K + +G+ DK ++IW +E++    TL+GH + +  +   P      SGS D T+R+WD+ 
Sbjct: 419 KFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVRIWDLT 478

Query: 403 TNSC 406
           T +C
Sbjct: 479 TGTC 482

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 56/253 (22%), Positives = 98/253 (38%), Gaps = 26/253 (10%)

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRT- 364
           L TG  +KT +V+   TGE ++     + S        + + + ++         E  T 
Sbjct: 336 LATG-CNKTTQVYKVSTGELVARLSDDSASQPQPQPQNQTVTAETSTSNSNGSSAEDGTG 394

Query: 365 ----CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                 +      ++  V   P      +G++D  IR+WD+ T   +   +GH    Q +
Sbjct: 395 NQNSAASTASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGH---EQDI 451

Query: 421 IPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHL 480
             L    + N +V   SGS    D                   ++   T+  S      +
Sbjct: 452 YSLDYFPSGNKLV---SGSG---DRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFI 505

Query: 481 LSCSLDNTIKLWDVQTGQCI-------RTQFGHVEGVWDIA--ADNFRIISGSHDGSIKI 531
            + SLD T+++WD  TG  +           GH + V+ +    D   ++SGS D S+K+
Sbjct: 506 AAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKL 565

Query: 532 WDLQ--SGKCMHT 542
           W+L   SG+  H 
Sbjct: 566 WNLNGLSGQKSHA 578

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 62/130 (47%), Gaps = 25/130 (19%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLS---------GHTD---GV 296
           GH D V ++ F  + + + +GS D +V +W+L  N L  + S         GH D    V
Sbjct: 537 GHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNL--NGLSGQKSHAECEVTYTGHKDFVLSV 594

Query: 297 KTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--------KIIVS 348
            T   DE  +++GS D+ +  W+ K+G  +   +GH +SV+SV             +  +
Sbjct: 595 ATTQNDE-YILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVTVANGHPLGPEYGVFAT 653

Query: 349 GSADKTVKIW 358
           GS D   +IW
Sbjct: 654 GSGDCKARIW 663

>Kwal_27.12053
          Length = 755

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 88/185 (47%), Gaps = 26/185 (14%)

Query: 256 VLTLQF--NYRLLFTGSYDSTVAIWDL----CSNKLIRR---------LSGHTDGVKTLY 300
           + +L+F  + RL   G  DS + IW L      NKL  +         L GH+  V +  
Sbjct: 430 MTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTS 489

Query: 301 F--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI---IVSGSADKTV 355
           F  D   L++ S DKT+R+W+  T   +  Y+GH   +  V AF  +     + S D+T 
Sbjct: 490 FSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDV-AFSPLGHYFATASHDQTA 548

Query: 356 KIWHVESRTCYTLR---GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
           ++W  +    Y LR   GH   V+ V  HP     F+GS D T RMWDI +   +++F G
Sbjct: 549 RLWSCDH--IYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLG 606

Query: 413 HVGQV 417
           H   V
Sbjct: 607 HTAPV 611

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 66/124 (53%), Gaps = 7/124 (5%)

Query: 249 FKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
           F GH++ V T+ F  N   +FTGS D T  +WD+ S   +R   GHT  V +     D  
Sbjct: 562 FAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGR 621

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWHVE 361
            L TGS D  I VW+  TG+ +   RGH  + +   ++ K   +++SG AD +V++W V+
Sbjct: 622 WLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

Query: 362 SRTC 365
             T 
Sbjct: 682 KSTA 685

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 88/187 (47%), Gaps = 14/187 (7%)

Query: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
           +KGH   +  + F+       T S+D T  +W       +R  +GH + V T+ F  +  
Sbjct: 520 YKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGT 579

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS--VDAFKKIIVSGSADKTVKIWHVES 362
            + TGS DKT R+W+  +G+ +  + GHT  V S  V    + + +GS D  + +W + +
Sbjct: 580 YVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGT 639

Query: 363 -RTCYTLRGHTE-WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSC------LKVFRGHV 414
            +    +RGH +  V  +    +     SG  D ++R+WD++ ++        + F G+ 
Sbjct: 640 GKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVKKSTAEPGSEPEQPFTGYS 699

Query: 415 GQVQKVI 421
           G V   +
Sbjct: 700 GDVTSSV 706

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 75/170 (44%), Gaps = 7/170 (4%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--L 306
           GH   V +  F  + R L + S D TV +W   +   +    GH   +  + F       
Sbjct: 480 GHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYF 539

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRT 364
            T S D+T R+W+      +  + GH + V  +S       + +GS+DKT ++W + S  
Sbjct: 540 ATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGD 599

Query: 365 CYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
              L  GHT  V    + P      +GS+D  I +WDI T   LK  RGH
Sbjct: 600 SVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGH 649

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 101/265 (38%), Gaps = 70/265 (26%)

Query: 300 YFDEAKLVT-GSLDKTIRVWNY-----------KTGECIS--TYRGHTDSVMSVD--AFK 343
           + D+ +L   G  D  I++W+            K GE  +  T  GH+ +V S       
Sbjct: 435 FSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDN 494

Query: 344 KIIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
           + ++S S DKTV++W  ++ T     +GH   +  V   P      + S D T R+W   
Sbjct: 495 RYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCD 554

Query: 403 TNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXX 462
               L++F GH+                  VD +S    G                    
Sbjct: 555 HIYPLRIFAGHLND----------------VDTVSFHPNG-------------------- 578

Query: 463 NDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD--IAADNFRI 520
                          T++ + S D T ++WD+ +G  +R   GH   V    ++ D   +
Sbjct: 579 ---------------TYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWL 623

Query: 521 ISGSHDGSIKIWDLQSGKCMHTFHG 545
            +GS DG I +WD+ +GK +    G
Sbjct: 624 STGSEDGVINVWDIGTGKRLKQMRG 648

>Scas_624.11
          Length = 1205

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 106/239 (44%), Gaps = 41/239 (17%)

Query: 223 RPWKVIYRERFKVES-NWRKGNCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWD 279
           RPW ++      ++  ++R G   +  F+ H   V ++ F+    +  +G  D T+ +W 
Sbjct: 23  RPWVLVALFSSTIQLWDYRMGTL-LHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWS 81

Query: 280 LCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVM 337
           L +NK +  L+GH D ++T++F +    +++ S D+TIR+WN++  + I+   GH   VM
Sbjct: 82  LETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVM 141

Query: 338 --SVDAFKKIIVSGSADKTVKIWHVESR-------------------------------T 364
                    ++VS S D+T+++W +                                   
Sbjct: 142 CAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVV 201

Query: 365 CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKV--FRGHVGQVQKVI 421
            + L GHT  VN    HP      SGSDD  +++W   +    +V   RGH   V  VI
Sbjct: 202 KFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVI 260

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 90/202 (44%), Gaps = 39/202 (19%)

Query: 249 FKGHMDGVLTLQFNYRL--LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK- 305
             GH+D + T+ F+  L  + + S D T+ IW+  + K I  L+GH   V    F     
Sbjct: 91  LNGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDD 150

Query: 306 -LVTGSLDKTIRVWNYKT----------------------------GECISTY--RGHTD 334
            +V+ SLD+TIRVW+                               G+C+  +   GHT 
Sbjct: 151 LVVSASLDETIRVWDISGLRKKHSAPGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTR 210

Query: 335 SV--MSVDAFKKIIVSGSADKTVKIWHVESRTCY---TLRGHTEWVNCVKLHPKSFTCFS 389
            V   S      +IVSGS D+ VK+W   S   +   T RGHT  V+CV  HP      S
Sbjct: 211 GVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNVDCVIFHPTQKFILS 270

Query: 390 GSDDTTIRMWDIRTNSCLKVFR 411
             +D T+R+WD+     +K F+
Sbjct: 271 VGEDKTLRIWDLDKRIPVKQFK 292

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 110/273 (40%), Gaps = 48/273 (17%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD- 340
           K++ +    +   K + F  ++  ++      TI++W+Y+ G  +  +  H   V SVD 
Sbjct: 2   KMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSVDF 61

Query: 341 -AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
              + I VSG  D T+K+W +E+  C YTL GH +++  V  H +     S SDD TIR+
Sbjct: 62  HPTQPIFVSGGDDYTIKVWSLETNKCLYTLNGHLDYIRTVFFHKELPWIISASDDQTIRI 121

Query: 399 WDIRTNSCLKVFRGH-----VGQVQKVIPLTIIDA--ENLVVDNISGSNEGDDEPXXXXX 451
           W+ +    +    GH       Q      L +  +  E + V +ISG  +    P     
Sbjct: 122 WNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIRVWDISGLRKKHSAPG---- 177

Query: 452 XXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQF---GHVE 508
                            T D  +    +LL           D   G C+  +F   GH  
Sbjct: 178 ---------------TSTFDDQMAAQQNLL-----------DGGFGDCV-VKFILEGHTR 210

Query: 509 GV-WDIAADNF-RIISGSHDGSIKIWDLQSGKC 539
           GV W         I+SGS D  +K+W   S K 
Sbjct: 211 GVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKA 243

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 70/195 (35%), Gaps = 54/195 (27%)

Query: 354 TVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
           T+++W     T  +    H   V  V  HP      SG DD TI++W + TN CL    G
Sbjct: 34  TIQLWDYRMGTLLHRFEDHEGPVRSVDFHPTQPIFVSGGDDYTIKVWSLETNKCLYTLNG 93

Query: 413 HVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDK 472
           H+  ++ V                                                   K
Sbjct: 94  HLDYIRTVF------------------------------------------------FHK 105

Query: 473 SIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIK 530
            +P+   ++S S D TI++W+ Q  + I    GH   V        +  ++S S D +I+
Sbjct: 106 ELPW---IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLVVSASLDETIR 162

Query: 531 IWDLQSGKCMHTFHG 545
           +WD+   +  H+  G
Sbjct: 163 VWDISGLRKKHSAPG 177

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 4/69 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 536
           +L     +TI+LWD + G  +       G V  V D        +SG  D +IK+W L++
Sbjct: 26  VLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRSV-DFHPTQPIFVSGGDDYTIKVWSLET 84

Query: 537 GKCMHTFHG 545
            KC++T +G
Sbjct: 85  NKCLYTLNG 93

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 62/133 (46%), Gaps = 9/133 (6%)

Query: 242 GNCQVQE-FKGHMDGVLTLQFNYRL--LFTGSYDSTVAIWDLCSNKL--IRRLSGHTDGV 296
           G+C V+   +GH  GV    F+  L  + +GS D  V +W   S K   +    GHT+ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQVKLWKYNSTKAWEVDTCRGHTNNV 256

Query: 297 KTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSA-DK 353
             + F   +  +++   DKT+R+W+      +  ++   D    + +   I + G+A D 
Sbjct: 257 DCVIFHPTQKFILSVGEDKTLRIWDLDKRIPVKQFKRENDRFWLIASHPNINLFGAAHDA 316

Query: 354 TVKIWHVE-SRTC 365
            + ++ ++  R C
Sbjct: 317 GIMVFKLDRERPC 329

>Kwal_56.24526
          Length = 1210

 Score = 85.5 bits (210), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 108/239 (45%), Gaps = 41/239 (17%)

Query: 223 RPWKVIYRERFKVES-NWRKGNCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWD 279
           RPW ++      ++  ++R G   + +F+ H   V  + F+    L  +   D T+ +W 
Sbjct: 23  RPWVLVALFSSSIQLWDYRMGTL-LHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWS 81

Query: 280 LCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVM 337
           L + K +  L+GH D V+T++F      +++ S D+TIR+WN++  + I+   GH   VM
Sbjct: 82  LDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVM 141

Query: 338 SVD--AFKKIIVSGSADKTVKIWHV-------ESRTCYT--------------------- 367
             D    + ++VS S D+TV++W +        + + YT                     
Sbjct: 142 CADFHPTEDLVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVV 201

Query: 368 ---LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKV--FRGHVGQVQKVI 421
              L GH+  VN    HP      SG DD  +++W + +    +V   RGH   V  VI
Sbjct: 202 KFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVI 260

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 91/202 (45%), Gaps = 39/202 (19%)

Query: 249 FKGHMDGVLTLQFNYRL--LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
             GH+D V T+ F+  L  + + S D T+ IW+  + K I  L+GH   V    F   E 
Sbjct: 91  LNGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTED 150

Query: 305 KLVTGSLDKTIRVWNYKT----------------------------GECISTY--RGHTD 334
            +V+ SLD+T+RVW+                               G+C+  +   GH+ 
Sbjct: 151 LVVSASLDETVRVWDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSR 210

Query: 335 SV--MSVDAFKKIIVSGSADKTVKIWHVESRTCY---TLRGHTEWVNCVKLHPKSFTCFS 389
            V   S      +IVSG  D+ VK+W + S   +   T RGHT  V+ V  HP      S
Sbjct: 211 GVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIIS 270

Query: 390 GSDDTTIRMWDIRTNSCLKVFR 411
             +D T+R+WD+   + +K F+
Sbjct: 271 VGEDKTVRVWDLDKRTPVKQFK 292

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 67/135 (49%), Gaps = 5/135 (3%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD- 340
           K++ +    +   K L F  ++  ++      +I++W+Y+ G  +  +  H   V  +D 
Sbjct: 2   KMLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGIDF 61

Query: 341 -AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
              + + VS   D T+K+W ++++ C +TL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPWIISASDDQTIRI 121

Query: 399 WDIRTNSCLKVFRGH 413
           W+ +    +    GH
Sbjct: 122 WNWQNRKEIACLTGH 136

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/192 (19%), Positives = 67/192 (34%), Gaps = 54/192 (28%)

Query: 354 TVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
           ++++W     T  +    H   V  +  HP      S  DD TI++W + T  CL    G
Sbjct: 34  SIQLWDYRMGTLLHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNG 93

Query: 413 HVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDK 472
           H+  V+ V                                                   +
Sbjct: 94  HLDYVRTVF------------------------------------------------FHR 105

Query: 473 SIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIK 530
            +P+   ++S S D TI++W+ Q  + I    GH   V   D       ++S S D +++
Sbjct: 106 ELPW---IISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVR 162

Query: 531 IWDLQSGKCMHT 542
           +WD+   +  H+
Sbjct: 163 VWDISGLRKRHS 174

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 242 GNCQVQE-FKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKL--IRRLSGHTDGV 296
           G+C V+   +GH  GV    F+    L+ +G  D  V +W + S K   +    GHT+ V
Sbjct: 197 GDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNV 256

Query: 297 KTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSA-DK 353
            ++ F   +  +++   DKT+RVW+      +  ++   D    V A   I + G+A D 
Sbjct: 257 DSVIFHPHQNLIISVGEDKTVRVWDLDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDS 316

Query: 354 TVKIWHVE-SRTC 365
            + ++ ++  R C
Sbjct: 317 GIMVFKLDRERPC 329

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 38/82 (46%), Gaps = 20/82 (24%)

Query: 476 YPTHLLSCSL--DNTIKLWDVQTGQC----------IRTQFGHVEGVWDIAADNFRIISG 523
           +PT  L  S   D TIK+W + T +C          +RT F H E  W        IIS 
Sbjct: 62  HPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFHRELPW--------IISA 113

Query: 524 SHDGSIKIWDLQSGKCMHTFHG 545
           S D +I+IW+ Q+ K +    G
Sbjct: 114 SDDQTIRIWNWQNRKEIACLTG 135

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 33/69 (47%), Gaps = 4/69 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCI---RTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 536
           +L     ++I+LWD + G  +       G V G+ D        +S   D +IK+W L +
Sbjct: 26  VLVALFSSSIQLWDYRMGTLLHKFEDHEGPVRGI-DFHPTQPLFVSAGDDYTIKVWSLDT 84

Query: 537 GKCMHTFHG 545
            KC+ T +G
Sbjct: 85  KKCLFTLNG 93

>YPL151C (PRP46) [5296] chr16 complement(266179..267534) Putative
           spliceosomal protein with similarity to S. pombe prp5p,
           has four WD (WD-40) repeats [1356 bp, 451 aa]
          Length = 451

 Score = 84.3 bits (207), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/290 (25%), Positives = 122/290 (42%), Gaps = 41/290 (14%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYKTG 323
             TGS D+T+ +WDL + KL   L+GH   V+ +   +    L + S DKT++ W+ +  
Sbjct: 155 FITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVSDRHPYLFSVSEDKTVKCWDLEKN 214

Query: 324 ECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKL 380
           + I  Y GH   V  +S+     +I +   D  +K+W + +R    TL GH   +N V+ 
Sbjct: 215 QIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQC 274

Query: 381 HPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVV-----DN 435
            P      S S D T+R+WD+     +KV   H    ++ +  T +  +   V     D+
Sbjct: 275 TPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHH----KRSVRATALHPKEFSVASACTDD 330

Query: 436 IS--GSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDK-SIPYPTHLLSCSLDNTIKLW 492
           I   G  EG                      E+   ++  SI     L +   +  +  +
Sbjct: 331 IRSWGLAEG--------------SLLTNFESEKTGIINTLSINQDDVLFAGGDNGVLSFY 376

Query: 493 DVQTGQ-----CIRTQFGHVEGVWDIAADNF-----RIISGSHDGSIKIW 532
           D ++G        R   G +EG   +    F     R+I+G  D SIKIW
Sbjct: 377 DYKSGHKYQSLATREMVGSLEGERSVLCSTFDKTGLRLITGEADKSIKIW 426

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 67/272 (24%), Positives = 106/272 (38%), Gaps = 60/272 (22%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK---LVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MS 338
           KL R ++GH   V+ +  D       +TGS D T++VW+  TG+  +T  GH  +V  ++
Sbjct: 130 KLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVA 189

Query: 339 VDAFKKIIVSGSADKTVKIWHVE-SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIR 397
           V      + S S DKTVK W +E ++      GH   V  V +HP      +   D+ I+
Sbjct: 190 VSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIK 249

Query: 398 MWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXX 457
           +WD+RT   +    GH G + +V                                     
Sbjct: 250 LWDMRTRIPVITLVGHKGPINQV------------------------------------- 272

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--A 515
                         +  P    ++S S D T++LWDV  G+ ++    H   V   A   
Sbjct: 273 --------------QCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHP 318

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMHTFHGKR 547
             F + S   D  I+ W L  G  +  F  ++
Sbjct: 319 KEFSVASACTD-DIRSWGLAEGSLLTNFESEK 349

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 73/193 (37%), Gaps = 54/193 (27%)

Query: 358 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCF-SGSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
           WH   +    + GH  WV CV + P     F +GS+DTT+++WD+ T        GHV  
Sbjct: 125 WHAPWKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMT 184

Query: 417 VQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPY 476
           V+ V                                                 +    PY
Sbjct: 185 VRDV------------------------------------------------AVSDRHPY 196

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDL 534
              L S S D T+K WD++  Q IR  +GH+ GV  ++       I +   D  IK+WD+
Sbjct: 197 ---LFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDM 253

Query: 535 QSGKCMHTFHGKR 547
           ++   + T  G +
Sbjct: 254 RTRIPVITLVGHK 266

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 44/172 (25%)

Query: 243 NCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY 300
           N  ++++ GH+ GV T+  +    L+ T   DS + +WD+ +   +  L GH   +  + 
Sbjct: 214 NQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQ 273

Query: 301 FD--EAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIW 358
               + ++V+ S D T+R+W+                          +V+G   KT+K+ 
Sbjct: 274 CTPVDPQVVSSSTDATVRLWD--------------------------VVAG---KTMKV- 303

Query: 359 HVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
                    L  H   V    LHPK F+  S   D  IR W +   S L  F
Sbjct: 304 ---------LTHHKRSVRATALHPKEFSVASACTD-DIRSWGLAEGSLLTNF 345

 Score = 34.7 bits (78), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 498 QCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQD 552
           + I    G V  V     DN   I+GS+D ++K+WDL +GK   T  G  +  +D
Sbjct: 133 RVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRD 187

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 12/82 (14%)

Query: 249 FKGHMDGVL-TLQFNYR-LLFTGSYDSTVAIWDLCSNK-----LIRRLSGHTDGVKTLY- 300
           F+    G++ TL  N   +LF G  +  ++ +D  S         R + G  +G +++  
Sbjct: 345 FESEKTGIINTLSINQDDVLFAGGDNGVLSFYDYKSGHKYQSLATREMVGSLEGERSVLC 404

Query: 301 --FDEA--KLVTGSLDKTIRVW 318
             FD+   +L+TG  DK+I++W
Sbjct: 405 STFDKTGLRLITGEADKSIKIW 426

>YKR036C (CAF4) [3289] chr11 complement(508344..510323) Protein that
           associates with Ccr4p, contains WD (WD-40) repeats [1980
           bp, 659 aa]
          Length = 659

 Score = 84.3 bits (207), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 116/271 (42%), Gaps = 64/271 (23%)

Query: 224 PWKVI----YRERFKVESNWRKGNCQVQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVA 276
           PW  +    Y++R     +   G  QV E  GH+  V  +Q    NY +L TGS D+T+ 
Sbjct: 346 PWGTLCSSSYQDRIVKVWDLNHG-IQVGELPGHLATVNCMQIDKKNYNMLITGSKDATLK 404

Query: 277 IWDLCSNK-------------------LIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRV 317
           +WDL  ++                    I     H D +  L FD   LV+GS DK I  
Sbjct: 405 LWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEALVSGSRDKKIFH 464

Query: 318 WNYKTGECISTYR-----GHTDSVM--------------------SVDAFKKIIVSGSAD 352
           W+  TG+CI          H+D  M                    ++  +   + +G+ D
Sbjct: 465 WDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTKD 524

Query: 353 KTVKIWHVE-SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFR 411
             V++W +   +    L GHT+ +  +K   +     +GS D ++R+WD+RT+S L V  
Sbjct: 525 GIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLV--TGSMDNSVRIWDLRTSSILDV-- 580

Query: 412 GHVGQVQKVIPLTIIDAENLVVDNISGSNEG 442
                +   +P++ +D +  ++    G+NEG
Sbjct: 581 -----IAYDLPVSSLDFDGKLI--TVGANEG 604

 Score = 74.7 bits (182), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 58/96 (60%), Gaps = 1/96 (1%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L TG+ D  V +WDL   K +R L GHTDG+ +L FD  KLVTGS+D ++R+W+ +T   
Sbjct: 518 LATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSI 577

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVE 361
           +     +   V S+D   K+I  G+ +  V ++++E
Sbjct: 578 LDVI-AYDLPVSSLDFDGKLITVGANEGGVNVFNME 612

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 96/237 (40%), Gaps = 53/237 (22%)

Query: 252 HMDGVLTLQFN--YRLLFTGSY-DSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--- 305
           H + +  L F+  +  L + SY D  V +WDL     +  L GH   V  +  D+     
Sbjct: 334 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNM 393

Query: 306 LVTGSLDKTIRVWNY---------------KTGE----CISTYRGHTDSVMSVDAFKKII 346
           L+TGS D T+++W+                KT E    CI  +  H D + ++    + +
Sbjct: 394 LITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEAL 453

Query: 347 VSGSADKTVKIWHVESRTCYTLRG--HTEWVNCVKLHPKSFT-----------------C 387
           VSGS DK +  W + +  C        T   + +K+  +S                   C
Sbjct: 454 VSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQC 513

Query: 388 F-----SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS 439
           +     +G+ D  +R+WD+R    +++  GH   +  +      D+E LV  ++  S
Sbjct: 514 YNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSL----KFDSEKLVTGSMDNS 566

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 42/65 (64%)

Query: 476 YPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQ 535
           Y + L + + D  ++LWD++ G+ +R   GH +G+  +  D+ ++++GS D S++IWDL+
Sbjct: 514 YNSALATGTKDGIVRLWDLRVGKPVRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLR 573

Query: 536 SGKCM 540
           +   +
Sbjct: 574 TSSIL 578

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 47/79 (59%), Gaps = 1/79 (1%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK 305
           V+  +GH DG+ +L+F+   L TGS D++V IWDL ++ ++  ++ +   V +L FD   
Sbjct: 538 VRLLEGHTDGITSLKFDSEKLVTGSMDNSVRIWDLRTSSILDVIA-YDLPVSSLDFDGKL 596

Query: 306 LVTGSLDKTIRVWNYKTGE 324
           +  G+ +  + V+N +  E
Sbjct: 597 ITVGANEGGVNVFNMERDE 615

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 469 TLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFR-IISGSH 525
            LD   P+ T   S   D  +K+WD+  G  +    GH+  V    I   N+  +I+GS 
Sbjct: 340 ALDFDTPWGTLCSSSYQDRIVKVWDLNHGIQVGELPGHLATVNCMQIDKKNYNMLITGSK 399

Query: 526 DGSIKIWDLQSGKCMHTFHGKRLQPQDEE 554
           D ++K+WDL   + ++  H   L+ + EE
Sbjct: 400 DATLKLWDLNLSREIYLDHSP-LKEKTEE 427

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 19/81 (23%)

Query: 480 LLSCSLDNTIKLWDVQTGQ-------------------CIRTQFGHVEGVWDIAADNFRI 520
           L++ S D T+KLWD+   +                   CI     H + +  ++ D+  +
Sbjct: 394 LITGSKDATLKLWDLNLSREIYLDHSPLKEKTEEIVTPCIHNFELHKDEITALSFDSEAL 453

Query: 521 ISGSHDGSIKIWDLQSGKCMH 541
           +SGS D  I  WDL +GKC+ 
Sbjct: 454 VSGSRDKKIFHWDLTTGKCIQ 474

>Kwal_23.6429
          Length = 750

 Score = 84.3 bits (207), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 84/155 (54%), Gaps = 18/155 (11%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEA-KLVTGSLDKTIRVWNYK 321
           + L TG+ D  + IWDL + +++  L GH   + +L YF    KLV+GS D+T+R+W+ +
Sbjct: 483 KFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 542

Query: 322 TGEC---ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR--------- 369
           TG+C   +S   G T   +S     K+I +GS D+TV+IW  +S T + +          
Sbjct: 543 TGQCSLTLSIEDGVTTVAVS-PGDGKLIAAGSLDRTVRIW--DSETGFLVERLDSENELG 599

Query: 370 -GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
            GH + V  V          SGS D ++++W++R+
Sbjct: 600 TGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRS 634

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 93/203 (45%), Gaps = 30/203 (14%)

Query: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           V   +GH   + +L +  +   L +GS D TV IWDL + +    LS   DGV T+    
Sbjct: 505 VMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLS-IEDGVTTVAVSP 563

Query: 302 -DEAKLVTGSLDKTIRVWNYKTGECISTY-------RGHTDSVMSVDAFKK---IIVSGS 350
            D   +  GSLD+T+R+W+ +TG  +           GH DSV SV  F +    +VSGS
Sbjct: 564 GDGKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSV-VFTRDGHGVVSGS 622

Query: 351 ADKTVKIWHVESRTCYTLRG-------------HTEWVNCVKLHPKSFTCFSGSDDTTIR 397
            D++VK+W++ S    T  G             H ++V  V          SGS D  + 
Sbjct: 623 LDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVL 682

Query: 398 MWDIRTNSCLKVFRGHVGQVQKV 420
            WD  + + L + +GH   V  V
Sbjct: 683 FWDTPSGNPLLMLQGHRNSVISV 705

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 107/276 (38%), Gaps = 74/276 (26%)

Query: 274 TVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHT 333
           T  ++ + + +LI RLS           ++A       D +    N K    ++T     
Sbjct: 422 TTQVYKVSTGELIARLS-----------EDASSAPSGADASATSENAKASPAVATSASSD 470

Query: 334 DSVMSV--DAFKKIIVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCFSG 390
             + SV      K + +G+ DK ++IW + +R    TL+GH + +  +   P      SG
Sbjct: 471 LYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSG 530

Query: 391 SDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXX 450
           S D T+R+WD+RT  C              + L+I D    V       + GD +     
Sbjct: 531 SGDRTVRIWDLRTGQC-------------SLTLSIEDGVTTVA-----VSPGDGKLIAAG 572

Query: 451 XXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCI-------RTQ 503
                             +LD+++               ++WD +TG  +          
Sbjct: 573 ------------------SLDRTV---------------RIWDSETGFLVERLDSENELG 599

Query: 504 FGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSG 537
            GH + V+ +    D   ++SGS D S+K+W+L+S 
Sbjct: 600 TGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSA 635

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 99/257 (38%), Gaps = 73/257 (28%)

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTC 365
           L TG  +KT +V+   TGE I+       S  S            AD +    + ++   
Sbjct: 415 LATG-CNKTTQVYKVSTGELIARLSEDASSAPS-----------GADASATSENAKASPA 462

Query: 366 YTLRGHTE-WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLT 424
                 ++ ++  V   P      +G++D  IR+WD+ T   +   +GH           
Sbjct: 463 VATSASSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGH----------- 511

Query: 425 IIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCS 484
                                                  +++  +LD   P    L+S S
Sbjct: 512 ---------------------------------------EQDIYSLDY-FPSGDKLVSGS 531

Query: 485 LDNTIKLWDVQTGQCIRTQFGHVEGVWDIA---ADNFRIISGSHDGSIKIWDLQSGKCMH 541
            D T+++WD++TGQC  T     +GV  +A    D   I +GS D +++IWD ++G    
Sbjct: 532 GDRTVRIWDLRTGQCSLT-LSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETG---- 586

Query: 542 TFHGKRLQPQDEEGSTH 558
            F  +RL  ++E G+ H
Sbjct: 587 -FLVERLDSENELGTGH 602

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 480 LLSCSLDNTIKLWDVQ------------TGQCIRTQFGHVEGVWDIAA---DNFRIISGS 524
           ++S SLD ++KLW+++            T     T  GH + V  +A    D F I+SGS
Sbjct: 618 VVSGSLDRSVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEF-ILSGS 676

Query: 525 HDGSIKIWDLQSGKCMHTFHGKR 547
            D  +  WD  SG  +    G R
Sbjct: 677 KDRGVLFWDTPSGNPLLMLQGHR 699

>AFL118W [3077] [Homologous to ScYGL137W (SEC27) - SH]
           complement(216252..216269,216423..218903) [2499 bp, 832
           aa]
          Length = 832

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/283 (27%), Positives = 117/283 (41%), Gaps = 57/283 (20%)

Query: 271 YDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECIST 328
           Y     IW+  +   +R +S     V+   F   K  ++ GS D  IRV+NY TGE +  
Sbjct: 33  YSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTGEKVVD 92

Query: 329 YRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTCY--TLRGHTEWVNCVKLHPKS 384
           +  H D +  ++V   +  ++S S D TVK+W+ E       T  GH  +V  V  +PK 
Sbjct: 93  FEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKD 152

Query: 385 FTCFSGS-DDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGD 443
              F+ +  D T+++W +   +     R H+ +                     G N  D
Sbjct: 153 PNTFATACLDHTVKIWSLGQETSNFTLRAHLEK---------------------GVNFVD 191

Query: 444 DEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQ 503
             P                        DK  PY   L++ S D T+K+WD QT  C+ T 
Sbjct: 192 YYPFQ----------------------DK--PY---LITSSDDRTVKVWDYQTKSCVATL 224

Query: 504 FGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSGKCMHTFH 544
            GH+  V           IISGS DG++KIW+  + K   T +
Sbjct: 225 EGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLN 267

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 111/243 (45%), Gaps = 29/243 (11%)

Query: 184 PNCGWGLPLLHMKRARF--------VKNASICATNNTCTKDSNGKLM--RPWKVIYRERF 233
           P+  W L  L+  RA          V++ S+C           GK +  + W ++  + F
Sbjct: 23  PSEPWVLITLYSGRAEIWNYETQTEVRSISVCEAPVRA-----GKFIPRKSWIIVGSDDF 77

Query: 234 KVES-NWRKGNCQVQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSN-KLIRRL 289
           K+   N+  G  +V +F+ H D +  L +      + + S D TV +W+   N  L +  
Sbjct: 78  KIRVFNYNTGE-KVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTF 136

Query: 290 SGHTDGVKTLYF---DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTD-SVMSVDAF--- 342
            GH   V ++ F   D     T  LD T+++W+        T R H +  V  VD +   
Sbjct: 137 EGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQ 196

Query: 343 -KKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWD 400
            K  +++ S D+TVK+W  ++++C  TL GH   V+    HP      SGS+D T+++W+
Sbjct: 197 DKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWN 256

Query: 401 IRT 403
             T
Sbjct: 257 SNT 259

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 109/252 (43%), Gaps = 42/252 (16%)

Query: 148 CQSLCNATKVC--RKWQILADDD---RVW-YHMCEQHIDRKCPNCGWGLPLLHMKRARFV 201
           C++   A K    + W I+  DD   RV+ Y+  E+ +D +                 ++
Sbjct: 54  CEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTGEKVVDFEA-------------HPDYI 100

Query: 202 KNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQF 261
           +  ++  T +     S+   ++ W            NW K     Q F+GH   V+++ F
Sbjct: 101 RALAVHPTRSYVLSASDDLTVKLW------------NWEKNWALEQTFEGHEHFVMSVTF 148

Query: 262 NYR---LLFTGSYDSTVAIWDLCSNKLIRRLSGHTD-GVKTLYF----DEAKLVTGSLDK 313
           N +      T   D TV IW L        L  H + GV  + +    D+  L+T S D+
Sbjct: 149 NPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDR 208

Query: 314 TIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVES-RTCYTLRG 370
           T++VW+Y+T  C++T  GH  +V          II+SGS D TVKIW+  + +   TL  
Sbjct: 209 TVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNL 268

Query: 371 HTEWVNCVKLHP 382
             E   CV  HP
Sbjct: 269 GLERSWCVAAHP 280

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 90/184 (48%), Gaps = 17/184 (9%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTG 323
           +  GS D  + +++  + + +     H D ++ L     +  +++ S D T+++WN++  
Sbjct: 70  IIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKN 129

Query: 324 ECIS-TYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWHVESRTC-YTLRGHTE-WVNC 377
             +  T+ GH   VMSV    K      +   D TVKIW +   T  +TLR H E  VN 
Sbjct: 130 WALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNF 189

Query: 378 VKLHP---KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV-----QKVIPLTIIDAE 429
           V  +P   K +   + SDD T+++WD +T SC+    GH+  V       ++P+ I  +E
Sbjct: 190 VDYYPFQDKPY-LITSSDDRTVKVWDYQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSE 248

Query: 430 NLVV 433
           +  V
Sbjct: 249 DGTV 252

 Score = 37.0 bits (84), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVE-GVWDIAADNFR----IISGSHDGSIKI 531
           P    +  LD+T+K+W +       T   H+E GV  +    F+    +I+ S D ++K+
Sbjct: 153 PNTFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKV 212

Query: 532 WDLQSGKCMHTFHG 545
           WD Q+  C+ T  G
Sbjct: 213 WDYQTKSCVATLEG 226

>AGL234W [4078] [Homologous to ScYCR084C (TUP1) - SH]
           complement(257969..259858) [1890 bp, 629 aa]
          Length = 629

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 55/172 (31%), Positives = 87/172 (50%), Gaps = 25/172 (14%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEA-KLVTGSLDKTIRVWNYK 321
           + L TG+ D  + IWDL + K++  L GH   + +L YF    KLV+GS D+T+R+W+ +
Sbjct: 365 KYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLR 424

Query: 322 TGEC---ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR--------- 369
           TG+C   +S   G T   +S     K I +GS D+TV++W  +S T + +          
Sbjct: 425 TGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRTVRVW--DSETGFLVERLDSENELS 481

Query: 370 -GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT-------NSCLKVFRGH 413
            GH + V  V          SGS D ++++WD+R         +C   + GH
Sbjct: 482 TGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGH 533

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 89/187 (47%), Gaps = 23/187 (12%)

Query: 249 FKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF---DE 303
            +GH   + +L +      L +GS D TV IWDL + +    LS   DGV T+     D 
Sbjct: 390 LQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIE-DGVTTVAVSPGDG 448

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTY-------RGHTDSVMSVDAFK--KIIVSGSADKT 354
             +  GSLD+T+RVW+ +TG  +           GH DSV SV   +  + ++SGS D++
Sbjct: 449 KYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRS 508

Query: 355 VKIWHVES-------RTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSC 406
           VK+W +          TC  T  GH ++V  V          SGS D  +  WD  + + 
Sbjct: 509 VKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNP 568

Query: 407 LKVFRGH 413
           L + +GH
Sbjct: 569 LLMLQGH 575

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 108/265 (40%), Gaps = 70/265 (26%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWH 359
           D   L TG+ DK IR+W+  T + + T +GH   + S+D F     +VSGS D+TV+IW 
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWD 422

Query: 360 VESRTCYTLRGHTEWVNCVKLHPKSFTCF-SGSDDTTIRMWDIRT-------NSCLKVFR 411
           + +  C       + V  V + P       +GS D T+R+WD  T       +S  ++  
Sbjct: 423 LRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENELST 482

Query: 412 GHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLD 471
           GH   V  V+     D + +    ISGS                              LD
Sbjct: 483 GHKDSVYSVV--FTRDGQGV----ISGS------------------------------LD 506

Query: 472 KSIPYPTHLLSCSLDNTIKLWDVQ--TGQ-----CIRTQFGHVEGVWDIAA--DNFRIIS 522
           +S               +KLWD++   GQ     C  T  GH + V  +A   D+  I+S
Sbjct: 507 RS---------------VKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILS 551

Query: 523 GSHDGSIKIWDLQSGKCMHTFHGKR 547
           GS D  +  WD  SG  +    G R
Sbjct: 552 GSKDRGVLFWDTASGNPLLMLQGHR 576

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 104/262 (39%), Gaps = 69/262 (26%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWH 359
           D   L TG  +KT +V+   TGE ++  R   DSV  V  +A      +G+AD   +   
Sbjct: 287 DGEYLATG-CNKTTQVYKVSTGELLA--RLSDDSVAGVNNEASTGPANNGTADNGGE--- 340

Query: 360 VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 419
             S T         ++  V   P      +G++D  IR+WD+ T   L   +GH      
Sbjct: 341 -NSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGH------ 393

Query: 420 VIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTH 479
                                                       +++  +LD   P    
Sbjct: 394 --------------------------------------------EQDIYSLDY-FPAGDK 408

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA---ADNFRIISGSHDGSIKIWDLQS 536
           L+S S D T+++WD++TGQC  T     +GV  +A    D   I +GS D ++++WD ++
Sbjct: 409 LVSGSGDRTVRIWDLRTGQCSLT-LSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSET 467

Query: 537 GKCMHTFHGKRLQPQDEEGSTH 558
           G     F  +RL  ++E  + H
Sbjct: 468 G-----FLVERLDSENELSTGH 484

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 19/139 (13%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRR-------LSGHTDGVKTLYF 301
           GH D V ++ F  + + + +GS D +V +WDL      +         +GH D V ++  
Sbjct: 483 GHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT 542

Query: 302 --DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--------KIIVSGSA 351
             D+  +++GS D+ +  W+  +G  +   +GH +SV+SV             +  +GS 
Sbjct: 543 TQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSG 602

Query: 352 DKTVKIWHVESRTCYTLRG 370
           D   +IW    ++  T  G
Sbjct: 603 DCKARIWKYTKKSNPTATG 621

>Kwal_26.7570
          Length = 218

 Score = 79.3 bits (194), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 76/149 (51%), Gaps = 15/149 (10%)

Query: 265 LLFTGSYDSTVAIWDLCSNKL-----IRRLSGHTDGVK--TLYFDEAKLVTGSLDKTIRV 317
           LL +GS D ++  W L  +       +R   GH+  V+  T+  D    ++ S DKT+R+
Sbjct: 32  LLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDKTVRL 91

Query: 318 WNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWV 375
           W   TG+CI  + GH   V+SV  D     IVS S DKTVK+W+       TL GH +WV
Sbjct: 92  WELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGECMVTLLGHNDWV 151

Query: 376 NCVKLHP------KSFTCFSGSDDTTIRM 398
           + V++ P      ++ T  S   D  +++
Sbjct: 152 SQVRVAPNESPEDETVTVISAGMDKVVKV 180

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIW 532
           P   + LS S D T++LW++ TG+CI+   GH   V  +  D    +I+S S D ++K+W
Sbjct: 75  PDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVW 134

Query: 533 DLQSGKCMHTFHG 545
           +   G+CM T  G
Sbjct: 135 NTL-GECMVTLLG 146

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 6/98 (6%)

Query: 329 YRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESR------TCYTLRGHTEWVNCVKLHP 382
           + G   S+ +  A   +++SGS DK++  W +            + RGH+  V    + P
Sbjct: 16  HNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTP 75

Query: 383 KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                 S S D T+R+W++ T  C++ F GH   V  V
Sbjct: 76  DGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSV 113

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 7/86 (8%)

Query: 469 TLDKSIPYPTHLLSCSLDNTIKLW-----DVQTGQCIRTQFGHVEGVWD--IAADNFRII 521
           +L  S   P  LLS S D ++  W     D Q G  +R+  GH   V D  +  D    +
Sbjct: 22  SLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYAL 81

Query: 522 SGSHDGSIKIWDLQSGKCMHTFHGKR 547
           S S D ++++W+L +GKC+  F G +
Sbjct: 82  SASWDKTVRLWELATGKCIQRFVGHK 107

>ADR077C [1818] [Homologous to ScYDL145C (COP1) - SH]
           (843171..846785) [3615 bp, 1204 aa]
          Length = 1204

 Score = 83.6 bits (205), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 105/239 (43%), Gaps = 41/239 (17%)

Query: 223 RPWKVIYRERFKVES-NWRKGNCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWD 279
           RPW ++      ++  ++R G   +  F+ H   V  + F+    L  +   D ++ +W 
Sbjct: 23  RPWVLVALFSSTIQLWDYRMG-VLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWS 81

Query: 280 LCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVM 337
           L ++K +  L+GH D V+T++F  +   +++ S D+TIR+WN++    I+   GH   VM
Sbjct: 82  LSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVM 141

Query: 338 --SVDAFKKIIVSGSADKTVKIWHVESR-------------------------------T 364
                  + ++VS S D+TV+IW +                                   
Sbjct: 142 CAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVV 201

Query: 365 CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF--RGHVGQVQKVI 421
            + L GHT  VN    HP      SGSDD  +++W + +    +V   RGH   V  VI
Sbjct: 202 KFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVI 260

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 93/202 (46%), Gaps = 39/202 (19%)

Query: 249 FKGHMDGVLTLQFNYRL--LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
             GH+D V T+ F+  L  + + S D T+ IW+  + + I  L+GH   V    F   E 
Sbjct: 91  LNGHLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTED 150

Query: 305 KLVTGSLDKTIRVWNYKT----------------------------GECISTY--RGHTD 334
            +V+ SLD+T+R+W+                               G+C+  +   GHT 
Sbjct: 151 LVVSASLDETVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTR 210

Query: 335 SV--MSVDAFKKIIVSGSADKTVKIWHVESRTCY---TLRGHTEWVNCVKLHPKSFTCFS 389
            V   S      +IVSGS D+ VK+W + S   +   T RGHT  V+ V  HP      S
Sbjct: 211 GVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPFQNLIIS 270

Query: 390 GSDDTTIRMWDIRTNSCLKVFR 411
             +D+TIR+WD+   + +K F+
Sbjct: 271 VGEDSTIRVWDLDKRTPVKQFK 292

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 116/290 (40%), Gaps = 30/290 (10%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD- 340
           K++ +    +   K + F  ++  ++      TI++W+Y+ G  +  +  H   V  VD 
Sbjct: 2   KMLTKFESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDF 61

Query: 341 -AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
              + + VS   D ++K+W + +  C +TL GH ++V  V  H +     S SDD TIR+
Sbjct: 62  HPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWIISASDDQTIRI 121

Query: 399 WDIRTNSCLKVFRGH-----VGQVQKVIPLTIIDA--ENLVVDNISGSNEGDDEPXXXXX 451
           W+ +    +    GH       Q      L +  +  E + + +ISG  +    P     
Sbjct: 122 WNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLRKRHSAPGSQSF 181

Query: 452 XXXXXXXXXXXNDEENQTLDKSI--------------PYPTHLLSCSLDNTIKLWDVQTG 497
                      +      + K I              P    ++S S D  +KLW + + 
Sbjct: 182 EEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSST 241

Query: 498 QC--IRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSGKCMHTF 543
           +   + T  GH   V  +    F+  IIS   D +I++WDL     +  F
Sbjct: 242 KAWEVDTCRGHTNNVDSVIFHPFQNLIISVGEDSTIRVWDLDKRTPVKQF 291

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 56/117 (47%), Gaps = 7/117 (5%)

Query: 242 GNCQVQE-FKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKL--IRRLSGHTDGV 296
           G+C V+   +GH  GV    F+    L+ +GS D  V +W + S K   +    GHT+ V
Sbjct: 197 GDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNV 256

Query: 297 KTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSA 351
            ++ F   +  +++   D TIRVW+      +  ++   D   S+ A   + + G+A
Sbjct: 257 DSVIFHPFQNLIISVGEDSTIRVWDLDKRTPVKQFKREQDRFWSIRAHPNVNLFGAA 313

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 465 EENQTLDKSIPY-PTH--LLSCSLDNTIKLWDVQTGQCI---RTQFGHVEGVWDIAADNF 518
           E   T  K+I + P+   +L     +TI+LWD + G  +       G V GV D      
Sbjct: 8   ESKSTRAKAIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGV-DFHPTQP 66

Query: 519 RIISGSHDGSIKIWDLQSGKCMHTFHG 545
             +S   D SIK+W L + KC+ T +G
Sbjct: 67  LFVSAGDDYSIKVWSLSTHKCLFTLNG 93

>CAGL0M02277g complement(271836..273119) highly similar to sp|Q12417
           Saccharomyces cerevisiae YPL151c PRP46 Pre-mRNA splicing
           factor PRP46, hypothetical start
          Length = 427

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/267 (24%), Positives = 106/267 (39%), Gaps = 60/267 (22%)

Query: 285 LIRRLSGHTDGVKTLYFDEAK---LVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSV 339
           L R + GH   V+ +  D+       TGS DKTI++WN  +G+   T + H  +V  +++
Sbjct: 107 LTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAI 166

Query: 340 DAFKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
                 + S S DKTVK W +E  T      GH   V+ V +HP      +   D+ +++
Sbjct: 167 SNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKV 226

Query: 399 WDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXX 458
           WDIRT   +    GH G + KV                                      
Sbjct: 227 WDIRTRLPVMTLPGHKGPITKV-------------------------------------- 248

Query: 459 XXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA--D 516
                        + +P    ++S S+D +I+LWD+  G+ ++    H   V DI+    
Sbjct: 249 -------------RCLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDISVHPS 295

Query: 517 NFRIISGSHDGSIKIWDLQSGKCMHTF 543
            F   S   +  I+ W L  G+ +  F
Sbjct: 296 EFSFASACTN-DIRSWLLPKGELLTNF 321

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 74/158 (46%), Gaps = 5/158 (3%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKLVTGSLDKTIRVWNYKTGEC 325
           TGS D T+ IW+L S KL   L  H   V+ L        + + S DKT++ W+ +    
Sbjct: 133 TGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYMFSVSEDKTVKCWDLEKNTA 192

Query: 326 ISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKLHP 382
           I  Y GH   V +VD      ++V+   D  VK+W + +R    TL GH   +  V+  P
Sbjct: 193 IRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLP 252

Query: 383 KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                 S S D +IR+WD+     +KV   H   V+ +
Sbjct: 253 VDPQVISSSVDASIRLWDLVAGKSMKVLTHHQRTVRDI 290

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 85/191 (44%), Gaps = 12/191 (6%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEA--KLVTGSLDKT 314
           L +   +  +F+ S D TV  WDL  N  IR   GH  GV T+        +VT   D  
Sbjct: 164 LAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSV 223

Query: 315 IRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWH-VESRTCYTLRGH 371
           ++VW+ +T   + T  GH   +  V        ++S S D ++++W  V  ++   L  H
Sbjct: 224 VKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAGKSMKVLTHH 283

Query: 372 TEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENL 431
              V  + +HP  F+ F+ +    IR W +     L  F   V Q   VI    I+ +++
Sbjct: 284 QRTVRDISVHPSEFS-FASACTNDIRSWLLPKGELLTNF---VSQDLDVINTVSINQDDV 339

Query: 432 VVDNISGSNEG 442
           +    +GS+ G
Sbjct: 340 L---FAGSDNG 347

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 72/193 (37%), Gaps = 54/193 (27%)

Query: 358 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCFS-GSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
           WH        + GH  WV C+ +       F+ GS+D TI++W++ +       + H   
Sbjct: 101 WHAPWHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAH--- 157

Query: 417 VQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPY 476
                        ++ V +++ SN                                  PY
Sbjct: 158 -------------DMTVRDLAISNRH--------------------------------PY 172

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDL 534
              + S S D T+K WD++    IR   GH+ GV   DI      +++   D  +K+WD+
Sbjct: 173 ---MFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDI 229

Query: 535 QSGKCMHTFHGKR 547
           ++   + T  G +
Sbjct: 230 RTRLPVMTLPGHK 242

>KLLA0B01958g join(170646..170663,170896..173550) similar to
           sp|P41811 Saccharomyces cerevisiae YGL137w SEC27
           coatomer complex beta chain (beta -cop) of secretory
           pathway vesicles, hypothetical start
          Length = 890

 Score = 82.4 bits (202), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 119/283 (42%), Gaps = 57/283 (20%)

Query: 271 YDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECIST 328
           Y   + IW+  +   +R +      V+   F   K  +V GS D  +RV+NY TGE ++ 
Sbjct: 33  YSGRIEIWNYETQTQVRSIPLCDAPVRAGRFIARKNWVVVGSDDFKLRVYNYNTGEKVTE 92

Query: 329 YRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESR-TC-YTLRGHTEWVNCVKLHPKS 384
           +  H D +  ++V   K  +++GS D T+K+W+ E    C  T  GH  +V  V  +PK 
Sbjct: 93  FEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKNWGCQQTFTGHEHFVMSVAFNPKD 152

Query: 385 FTCF-SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGD 443
              F SG  D TI++W I  +      + H                        G N  D
Sbjct: 153 PNQFASGCLDHTIKVWSIGQDVPNFTLKAH---------------------ETKGVNYVD 191

Query: 444 DEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQ 503
             P                        DK  PY   L++ S D TIK+WD QT   + T 
Sbjct: 192 YYPLQ----------------------DK--PY---LITTSDDGTIKVWDYQTKSNVATL 224

Query: 504 FGHVEGV-WDIAADNFR-IISGSHDGSIKIWDLQSGKCMHTFH 544
            GH+  V + +       IISGS DG++KIW+  + K   T +
Sbjct: 225 EGHMANVSYAVFHPTLPIIISGSEDGTLKIWNANTYKLEKTLN 267

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 94/191 (49%), Gaps = 24/191 (12%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNY-KT 322
           +  GS D  + +++  + + +     H D ++++     K  ++TGS D TI++WN+ K 
Sbjct: 70  VVVGSDDFKLRVYNYNTGEKVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWEKN 129

Query: 323 GECISTYRGHTDSVMSVDAFK----KIIVSGSADKTVKIWHV-ESRTCYTLRGH-TEWVN 376
             C  T+ GH   VMSV AF         SG  D T+K+W + +    +TL+ H T+ VN
Sbjct: 130 WGCQQTFTGHEHFVMSV-AFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVN 188

Query: 377 CVKLHPKSFTCF--SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI---PLTIIDAENL 431
            V  +P     +  + SDD TI++WD +T S +    GH+  V   +    L II     
Sbjct: 189 YVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPTLPII----- 243

Query: 432 VVDNISGSNEG 442
               ISGS +G
Sbjct: 244 ----ISGSEDG 250

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 94/192 (48%), Gaps = 14/192 (7%)

Query: 225 WKVIYRERFKVE-SNWRKGNCQVQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLC 281
           W V+  + FK+   N+  G  +V EF+ H D +  + +      + TGS D T+ +W+  
Sbjct: 69  WVVVGSDDFKLRVYNYNTGE-KVTEFEAHPDYIRSIAVHPTKPFVLTGSDDLTIKLWNWE 127

Query: 282 SN-KLIRRLSGHTDGVKTLYF---DEAKLVTGSLDKTIRVWNYKTGECISTYRGH-TDSV 336
            N    +  +GH   V ++ F   D  +  +G LD TI+VW+        T + H T  V
Sbjct: 128 KNWGCQQTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGV 187

Query: 337 MSVDAF----KKIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCFSGS 391
             VD +    K  +++ S D T+K+W  ++++   TL GH   V+    HP      SGS
Sbjct: 188 NYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANVSYAVFHPTLPIIISGS 247

Query: 392 DDTTIRMWDIRT 403
           +D T+++W+  T
Sbjct: 248 EDGTLKIWNANT 259

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 84/181 (46%), Gaps = 27/181 (14%)

Query: 238 NWRKG-NCQVQEFKGHMDGVLTLQFNYR---LLFTGSYDSTVAIWDLCSNKLIRRLSGH- 292
           NW K   CQ Q F GH   V+++ FN +      +G  D T+ +W +  +     L  H 
Sbjct: 125 NWEKNWGCQ-QTFTGHEHFVMSVAFNPKDPNQFASGCLDHTIKVWSIGQDVPNFTLKAHE 183

Query: 293 TDGVKTLYF----DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK---KI 345
           T GV  + +    D+  L+T S D TI+VW+Y+T   ++T  GH  +V S   F     I
Sbjct: 184 TKGVNYVDYYPLQDKPYLITTSDDGTIKVWDYQTKSNVATLEGHMANV-SYAVFHPTLPI 242

Query: 346 IVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPK------------SFTCFSGSD 392
           I+SGS D T+KIW+  + +   TL    E   C+  HP              FT  S  D
Sbjct: 243 IISGSEDGTLKIWNANTYKLEKTLNIGLERSWCIATHPSGKRNYIASGFDNGFTVLSLGD 302

Query: 393 D 393
           D
Sbjct: 303 D 303

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCIRTQFGH-VEGV----WDIAADNFRIISGSHDGSIKI 531
           P    S  LD+TIK+W +       T   H  +GV    +    D   +I+ S DG+IK+
Sbjct: 153 PNQFASGCLDHTIKVWSIGQDVPNFTLKAHETKGVNYVDYYPLQDKPYLITTSDDGTIKV 212

Query: 532 WDLQSGKCMHTFHG 545
           WD Q+   + T  G
Sbjct: 213 WDYQTKSNVATLEG 226

>Scas_695.15
          Length = 327

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 130/306 (42%), Gaps = 40/306 (13%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTG 323
           +L +  YD T+  W+  +    R +      V  L   ++ KL+  +  + +R+++ +T 
Sbjct: 24  ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGYQNVRLYDIRTT 83

Query: 324 E--CISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378
               ++T+ GH  +V SV +F+   K +V+ S D T+K+W V S +      H   VN V
Sbjct: 84  NPNAVATFEGHKGNVTSV-SFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYKHNAPVNEV 142

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            +HP      S   D TI++WD+  N C            ++IP    D +N  + ++S 
Sbjct: 143 VIHPNQGELISCDRDGTIKIWDLGENQC----------THQLIP----DDDNTSLQSLSV 188

Query: 439 SNEGDDEPXXXXXXXXXXXXXXXXNDEEN----QTLDKSIPYPT---------HLLSCSL 485
           +++G                     D  N            Y T         H+ +CS 
Sbjct: 189 ASDGSMLVAANNKGDCYVWEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSA 248

Query: 486 DNTIKLWDVQTGQ----CIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKC 539
           D T K+W V   +       T  GH   VWD A  AD+  +++ S D  +++WDL + + 
Sbjct: 249 DRTAKIWSVGETEDDFNLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREI 308

Query: 540 MHTFHG 545
           +  + G
Sbjct: 309 VRQYGG 314

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 88/229 (38%), Gaps = 62/229 (27%)

Query: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK--TLYF 301
           V  F+GH   V ++ F  + + + T S D T+ +WD+ S  + R    H   V    ++ 
Sbjct: 88  VATFEGHKGNVTSVSFQQDNKWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVIHP 146

Query: 302 DEAKLVTGSLDKTIRVWNYKTGEC------------------------------------ 325
           ++ +L++   D TI++W+    +C                                    
Sbjct: 147 NQGELISCDRDGTIKIWDLGENQCTHQLIPDDDNTSLQSLSVASDGSMLVAANNKGDCYV 206

Query: 326 --------------ISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHV-ESRTCY-- 366
                         I+ +  H D +  V   +  K + + SAD+T KIW V E+   +  
Sbjct: 207 WEMPNHTDASNLKPINKFSAHKDYITRVVLSSDVKHMATCSADRTAKIWSVGETEDDFNL 266

Query: 367 --TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
             TL GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 267 ETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 315

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 8/79 (10%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 537
           +++ S D TIK+WDV++    R  + H   V ++    +   +IS   DG+IKIWDL   
Sbjct: 110 MVTSSEDGTIKVWDVRSPSVPR-NYKHNAPVNEVVIHPNQGELISCDRDGTIKIWDLGEN 168

Query: 538 KCMHTFHGKRLQPQDEEGS 556
           +C H     +L P D+  S
Sbjct: 169 QCTH-----QLIPDDDNTS 182

>Scas_629.12
          Length = 671

 Score = 81.3 bits (199), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 121/467 (25%), Positives = 182/467 (38%), Gaps = 89/467 (19%)

Query: 9   DNEIERELIRSNKEQRITPTFSSALPQFNFTKFCYRHNPEILSSPTHTACYNQDLKRFKD 68
           +N ++  LI S   Q +  T SS   Q    +      P+I ++    +    +  + + 
Sbjct: 193 ENNVQPPLIPSVPTQPLPKTVSSPADQ-QKPQEQQPAEPKITTTEEEKSTTTTEQVKTEG 251

Query: 69  LNDNITKLPAQEQAEIHHIISKFNKSNDKLRKL---ILDGILASSCFPQLSYISSQVSNM 125
            N++    PA   A+I+H +  +N+    L+ +   +L+  L SS  P  S    Q S+ 
Sbjct: 252 TNESAATTPAA--ADINHYLVPYNQRASSLKPIPPFLLN--LESSDSP--SKYKKQ-SDD 304

Query: 126 IRIDFISILPQELSLKILSYLDCQSLCNATKVCRKWQILA-------------------- 165
             + F   LP EL +++   L+  S+    K     Q LA                    
Sbjct: 305 YYVVFNPALPLELDVELHHSLNHSSVVCCVKFSNDGQFLATGCNKTTQIYRVSDGELIAK 364

Query: 166 -DDDRVWYHMCEQHIDRKCPNCGWGLPLLHMKRARFVKNASICATNNTCTKDSNGKLMRP 224
             DD V             P+       L+++   F  +    AT       +  KL+R 
Sbjct: 365 LSDDSVTSPDTSSATSGSTPSTD-----LYIRSVCFSPDGEFLATG------AEDKLIRI 413

Query: 225 WKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCS 282
           W +  R+   V              KGH   V +L +  N   L +GS D TV IWDL +
Sbjct: 414 WDIQERKIVMV-------------LKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRT 460

Query: 283 NKLIRRLSGHTDGVKTLYF---DEAKLVTGSLDKTIRVWNYKTGECISTY-------RGH 332
            +    LS    GV T+     D   +  GSLD+ +RVW+  TG  +           GH
Sbjct: 461 GQCSLTLSIEY-GVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGH 519

Query: 333 TDSVMSVDAFKK---IIVSGSADKTVKIWHVE---------------SRTC-YTLRGHTE 373
            DSV SV  F +    +VSGS DKTVK+W++                S TC  T  GH +
Sbjct: 520 RDSVYSV-VFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHKD 578

Query: 374 WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           +V  V          SGS D  I  WD  + + L + +GH   V  V
Sbjct: 579 FVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISV 625

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 110/296 (37%), Gaps = 60/296 (20%)

Query: 300 YFDEAKLVTGSLDKTIRVWNYKTGECIS-----------TYRGHTDSVMSVDAF------ 342
           + ++ + +    +KT +++    GE I+           T    + S  S D +      
Sbjct: 336 FSNDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCF 395

Query: 343 ---KKIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
               + + +G+ DK ++IW ++ R     L+GH + V  +   P      SGS D T+R+
Sbjct: 396 SPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRI 455

Query: 399 WDIRTNSCLKVFRGHVGQVQ--------KVIPLTIIDAENLVVDNISG--SNEGDDEPXX 448
           WD+RT  C        G           K I    +D    V D+ +G      D E   
Sbjct: 456 WDLRTGQCSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENEL 515

Query: 449 XXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQ------------- 495
                          D               ++S SLD T+KLW+++             
Sbjct: 516 GTGHRDSVYSVVFTRDG------------NEVVSGSLDKTVKLWNMRHSGNSNNESNDKG 563

Query: 496 --TGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKR 547
             +  C  T  GH + V  +  + D+  I+SGS D  I  WD +SG  +    G R
Sbjct: 564 SASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHR 619

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 9/87 (10%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQC---IRTQFGHVEGVWDIAADNFRIISGSHDGSIKI 531
           P    L+S S D T+++WD++TGQC   +  ++G V  V     D   I +GS D ++++
Sbjct: 439 PNGEKLVSGSGDRTVRIWDLRTGQCSLTLSIEYG-VTTVAVSPNDGKFIAAGSLDRAVRV 497

Query: 532 WDLQSGKCMHTFHGKRLQPQDEEGSTH 558
           WD  +G     F  +RL  ++E G+ H
Sbjct: 498 WDSTTG-----FLVERLDSENELGTGH 519

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 27/135 (20%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDL-----CSNKLIRRLS----------GHT 293
           GH D V ++ F  +   + +GS D TV +W++      +N+   + S          GH 
Sbjct: 518 GHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGSASATCEVTYVGHK 577

Query: 294 DGV--KTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK-------- 343
           D V   T   D+  +++GS D+ I  W+ ++G  +   +GH +SV+SV            
Sbjct: 578 DFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLLMLQGHRNSVISVAVANGSALGPKY 637

Query: 344 KIIVSGSADKTVKIW 358
            +  +GS D   +IW
Sbjct: 638 NVFATGSGDCKARIW 652

>KLLA0D04840g 413362..414273 highly similar to sp|P41318
           Saccharomyces cerevisiae YNL006w LST8 required for
           transport of permeases from the golgi to the plasma
           membrane, start by similarity
          Length = 303

 Score = 77.0 bits (188), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 127/294 (43%), Gaps = 20/294 (6%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTG 323
           +L +  YD T+  W+  +    R +      V  L    + K +  +    +R+++ ++ 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHLHVRLYDIRSN 63

Query: 324 EC--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378
               +S++ GH  +V S+ AF+   + +VS S D T+K+W V S +      H   VN V
Sbjct: 64  NPNPVSSFEGHKGNVTSI-AFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYKHNAPVNEV 122

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            +HP      S   D  IR+WD+  N C           +   PL  +   +     ++G
Sbjct: 123 AIHPNQGELISCDQDGNIRIWDLGENQCTNQLTP-----EDNTPLQSLSVASDGSMLVAG 177

Query: 439 SNEGD----DEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV 494
           +N+G+      P                + +    +  S     HL +CS D+T ++W++
Sbjct: 178 NNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVK-HLATCSADHTARVWNI 236

Query: 495 QTGQCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           +    + T   GH   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 237 EDNFELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGG 290

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/225 (20%), Positives = 86/225 (38%), Gaps = 58/225 (25%)

Query: 246 VQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK--TLYF 301
           V  F+GH   V ++ F    R + + S D T+ +WD+ S   ++R   H   V    ++ 
Sbjct: 68  VSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPS-VQRNYKHNAPVNEVAIHP 126

Query: 302 DEAKLVTGSLDKTIRVWNYKTGEC------------------------------------ 325
           ++ +L++   D  IR+W+    +C                                    
Sbjct: 127 NQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTPLQSLSVASDGSMLVAGNNKGNCYVW 186

Query: 326 -------------ISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVES--RTCYTL 368
                        ++ ++ HT  +  V   A  K + + SAD T ++W++E       TL
Sbjct: 187 KMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDNFELETTL 246

Query: 369 RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
            GH  WV        S    +   D  +R+WD+ T+  ++ + GH
Sbjct: 247 DGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGH 291

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 48/119 (40%), Gaps = 20/119 (16%)

Query: 241 KGNCQVQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTVAIWDLCSN 283
           KGNC V +   H D                   + L  + + L T S D T  +W++  N
Sbjct: 180 KGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRVLLSADVKHLATCSADHTARVWNIEDN 239

Query: 284 -KLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV 339
            +L   L GH   V    F  D A LVT   D  +R+W+  T E +  Y GH    + V
Sbjct: 240 FELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTSEIVRQYGGHHKGAVCV 298

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 8/75 (10%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 537
           ++S S D TIK+WDV++   ++  + H   V ++A   +   +IS   DG+I+IWDL   
Sbjct: 90  MVSSSEDGTIKVWDVRS-PSVQRNYKHNAPVNEVAIHPNQGELISCDQDGNIRIWDLGEN 148

Query: 538 KCMHTFHGKRLQPQD 552
           +C       +L P+D
Sbjct: 149 QCT-----NQLTPED 158

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 50/260 (19%), Positives = 98/260 (37%), Gaps = 43/260 (16%)

Query: 275 VAIWDLCSNKL--IRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYR 330
           V ++D+ SN    +    GH   V ++ F +    +V+ S D TI+VW+ ++      Y+
Sbjct: 55  VRLYDIRSNNPNPVSSFEGHKGNVTSIAFQQENRWMVSSSEDGTIKVWDVRSPSVQRNYK 114

Query: 331 GHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTC---YTLRGHTEWVNCVKLHPKSF 385
            H   V  +++   +  ++S   D  ++IW +    C    T   +T  +  + +     
Sbjct: 115 -HNAPVNEVAIHPNQGELISCDQDGNIRIWDLGENQCTNQLTPEDNTP-LQSLSVASDGS 172

Query: 386 TCFSGSDDTTIRMW------DIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS 439
              +G++     +W      D  T   +  F+ H   + +V  L   D ++L        
Sbjct: 173 MLVAGNNKGNCYVWKMPHHTDASTLEPVTKFKSHTKYITRV--LLSADVKHLAT------ 224

Query: 440 NEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPY---------PTHLLSCSLDNTIK 490
                                  N E   TLD    +           +L++   D+ ++
Sbjct: 225 ---------CSADHTARVWNIEDNFELETTLDGHQRWVWDCAFSADSAYLVTACSDHYVR 275

Query: 491 LWDVQTGQCIRTQFGHVEGV 510
           LWD+ T + +R   GH +G 
Sbjct: 276 LWDLSTSEIVRQYGGHHKGA 295

>YCR084C (TUP1) [608] chr3 complement(260307..262448) General
           repressor of RNA polymerase II transcription that is
           brought to target promoters by regulated,
           sequence-specific DNA-binding proteins, exists in a
           complex with Ssn6p that is converted to a
           transcriptional activator in a Hog1p-dependent manner
           [2142 bp, 713 aa]
          Length = 713

 Score = 78.6 bits (192), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 96/199 (48%), Gaps = 28/199 (14%)

Query: 249 FKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF---DE 303
            +GH   + +L +  +   L +GS D TV IWDL + +    LS   DGV T+     D 
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIE-DGVTTVAVSPGDG 539

Query: 304 AKLVTGSLDKTIRVWNYKTGECIS-------TYRGHTDSVMSVDAFK--KIIVSGSADKT 354
             +  GSLD+ +RVW+ +TG  +        +  GH DSV SV   +  + +VSGS D++
Sbjct: 540 KYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRS 599

Query: 355 VKIWHVE------------SRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
           VK+W+++            S TC  T  GH ++V  V          SGS D  +  WD 
Sbjct: 600 VKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDK 659

Query: 402 RTNSCLKVFRGHVGQVQKV 420
           ++ + L + +GH   V  V
Sbjct: 660 KSGNPLLMLQGHRNSVISV 678

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 82/154 (53%), Gaps = 18/154 (11%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEA-KLVTGSLDKTIRVWNYK 321
           + L TG+ D  + IWD+ + K++  L GH   + +L YF    KLV+GS D+T+R+W+ +
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 322 TGEC---ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR--------- 369
           TG+C   +S   G T   +S     K I +GS D+ V++W  +S T + +          
Sbjct: 516 TGQCSLTLSIEDGVTTVAVS-PGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESG 572

Query: 370 -GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
            GH + V  V       +  SGS D ++++W+++
Sbjct: 573 TGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQ 606

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 95/226 (42%), Gaps = 31/226 (13%)

Query: 344 KIIVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
           K + +G+ D+ ++IW +E+R     L+GH + +  +   P      SGS D T+R+WD+R
Sbjct: 456 KFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLR 515

Query: 403 TNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXX 462
           T  C        G     + ++  D + +   ++       D                  
Sbjct: 516 TGQCSLTLSIEDGVT--TVAVSPGDGKYIAAGSL-------DRAVRVWDSETGFLVERLD 566

Query: 463 NDEENQTLDKSIPYPT-------HLLSCSLDNTIKLWDVQ------------TGQCIRTQ 503
           ++ E+ T  K   Y          ++S SLD ++KLW++Q            +G C  T 
Sbjct: 567 SENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTY 626

Query: 504 FGHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQSGKCMHTFHGKR 547
            GH + V  +A   ++  I+SGS D  +  WD +SG  +    G R
Sbjct: 627 IGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHR 672

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 49/88 (55%), Gaps = 9/88 (10%)

Query: 474 IPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA---ADNFRIISGSHDGSIK 530
            P    L+S S D T+++WD++TGQC  T     +GV  +A    D   I +GS D +++
Sbjct: 494 FPSGDKLVSGSGDRTVRIWDLRTGQCSLT-LSIEDGVTTVAVSPGDGKYIAAGSLDRAVR 552

Query: 531 IWDLQSGKCMHTFHGKRLQPQDEEGSTH 558
           +WD ++G     F  +RL  ++E G+ H
Sbjct: 553 VWDSETG-----FLVERLDSENESGTGH 575

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 26/133 (19%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDL--CSNKLIRRLS----------GHTD-- 294
           GH D V ++ F  + + + +GS D +V +W+L   +NK   +            GH D  
Sbjct: 574 GHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFV 633

Query: 295 -GVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--------KI 345
             V T   DE  +++GS D+ +  W+ K+G  +   +GH +SV+SV             +
Sbjct: 634 LSVATTQNDEY-ILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNV 692

Query: 346 IVSGSADKTVKIW 358
             +GS D   +IW
Sbjct: 693 FATGSGDCKARIW 705

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 39/90 (43%), Gaps = 11/90 (12%)

Query: 242 GNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL 299
           G C+V  + GH D VL++    N   + +GS D  V  WD  S   +  L GH + V ++
Sbjct: 620 GTCEVT-YIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISV 678

Query: 300 YFDEAK--------LVTGSLDKTIRVWNYK 321
                           TGS D   R+W YK
Sbjct: 679 AVANGSPLGPEYNVFATGSGDCKARIWKYK 708

>CAGL0E00561g 49750..52260 some similarities with sp|P16649
           Saccharomyces cerevisiae YCR084c TUP1, hypothetical
           start
          Length = 836

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 85/177 (48%), Gaps = 30/177 (16%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEA-KLVTGSLDKTIRVWNYK 321
           + L TG+ D  + IWD+   K++  L GH   + +L YF    KLV+GS D+T+R+W+ K
Sbjct: 568 KFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLK 627

Query: 322 TGECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLR--------- 369
           TG+C  T     D V +V       K I +GS D+ V++W  +S T + +          
Sbjct: 628 TGQCTLTLSIE-DGVTTVAVSPGDGKFIAAGSLDRAVRVW--DSDTGFLVERLDSENELG 684

Query: 370 -GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR------------TNSCLKVFRGH 413
            GH + V  V          SGS D ++++W++R            + +C   + GH
Sbjct: 685 TGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGH 741

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 72/229 (31%), Positives = 103/229 (44%), Gaps = 43/229 (18%)

Query: 220 KLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAI 277
           KL+R W +   E+ K+          V   KGH   + +L +  +   L +GS D TV I
Sbjct: 577 KLIRIWDI---EQKKI----------VMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRI 623

Query: 278 WDLCSNKLIRRLSGHTDGVKTLYF---DEAKLVTGSLDKTIRVWNYKTGECISTY----- 329
           WDL + +    LS   DGV T+     D   +  GSLD+ +RVW+  TG  +        
Sbjct: 624 WDLKTGQCTLTLSIE-DGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENE 682

Query: 330 --RGHTDSVMSVDAFKK---IIVSGSADKTVKIWHVE------------SRTC-YTLRGH 371
              GH DSV SV  F +    +VSGS D++VK+W++             S TC  T  GH
Sbjct: 683 LGTGHKDSVYSV-VFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGH 741

Query: 372 TEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
            ++V  V          SGS D  +  WD  + + L + +GH   V  V
Sbjct: 742 KDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNSVISV 790

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 87/226 (38%), Gaps = 73/226 (32%)

Query: 344 KIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
           K + +G+ DK ++IW +E +     L+GH + +  +   P      SGS D T+R+WD++
Sbjct: 568 KFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLK 627

Query: 403 TNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXX 462
           T  C              + L+I D    V       + GD +                 
Sbjct: 628 TGQC-------------TLTLSIEDGVTTV-----AVSPGDGK----------------- 652

Query: 463 NDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCI-------RTQFGHVEGVWDI-- 513
                            + + SLD  +++WD  TG  +           GH + V+ +  
Sbjct: 653 ----------------FIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVF 696

Query: 514 AADNFRIISGSHDGSIKIWDLQ------------SGKCMHTFHGKR 547
             D   ++SGS D S+K+W+L+            SG C  T+ G +
Sbjct: 697 TRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHK 742

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 48/87 (55%), Gaps = 9/87 (10%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA---ADNFRIISGSHDGSIKI 531
           P    L+S S D T+++WD++TGQC  T     +GV  +A    D   I +GS D ++++
Sbjct: 607 PSGDKLVSGSGDRTVRIWDLKTGQCTLT-LSIEDGVTTVAVSPGDGKFIAAGSLDRAVRV 665

Query: 532 WDLQSGKCMHTFHGKRLQPQDEEGSTH 558
           WD  +G     F  +RL  ++E G+ H
Sbjct: 666 WDSDTG-----FLVERLDSENELGTGH 687

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 65/179 (36%), Gaps = 74/179 (41%)

Query: 254 DGVLTLQF---NYRLLFTGSYDSTVAIWDLCSNKLIRRL-------SGHTDGVKTLYF-- 301
           DGV T+     + + +  GS D  V +WD  +  L+ RL       +GH D V ++ F  
Sbjct: 639 DGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTR 698

Query: 302 DEAKLVTGSLDKTIRVWNYK------------TGECISTYRGHTD--------------- 334
           D   +V+GSLD+++++WN +            +G C  TY GH D               
Sbjct: 699 DGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYIL 758

Query: 335 ---------------------------SVMSVDAFK--------KIIVSGSADKTVKIW 358
                                      SV+SV             I  +GS D   +IW
Sbjct: 759 SGSKDRGVLFWDKVSGNPLLMLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIW 817

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 14/82 (17%)

Query: 480 LLSCSLDNTIKLWDVQ------------TGQCIRTQFGHVEGVWDIAA--DNFRIISGSH 525
           ++S SLD ++KLW+++            +G C  T  GH + V  +A   D+  I+SGS 
Sbjct: 703 VVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSK 762

Query: 526 DGSIKIWDLQSGKCMHTFHGKR 547
           D  +  WD  SG  +    G R
Sbjct: 763 DRGVLFWDKVSGNPLLMLQGHR 784

>YNL006W (LST8) [4579] chr14 (620066..620977) Protein required for
           transport of permeases from the Golgi to the plasma
           membrane [912 bp, 303 aa]
          Length = 303

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/290 (23%), Positives = 124/290 (42%), Gaps = 12/290 (4%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTG 323
           +L +  YD T+  W+  +    R +      V  L   ++ KL+  +  + +R+++ +T 
Sbjct: 4   ILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTT 63

Query: 324 EC--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378
               ++++ GH  +V SV +F+   + +V+ S D T+K+W V S +      H   VN V
Sbjct: 64  NPNPVASFEGHRGNVTSV-SFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAPVNEV 122

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            +HP      S   D  IR+WD+  N C            + + +   D   L   N  G
Sbjct: 123 VIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMA-SDGSMLAAANTKG 181

Query: 439 SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQ 498
           +    + P                +      +  S     HL +CS D+T ++W +    
Sbjct: 182 NCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVK-HLATCSADHTARVWSIDDDF 240

Query: 499 CIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
            + T   GH   VWD A  AD+  +++ S D  +++WDL + + +  + G
Sbjct: 241 KLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGG 290

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/225 (20%), Positives = 86/225 (38%), Gaps = 58/225 (25%)

Query: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK--TLYF 301
           V  F+GH   V ++ F  + R + T S D T+ +WD+ S  + R    H   V    ++ 
Sbjct: 68  VASFEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVIHP 126

Query: 302 DEAKLVTGSLDKTIRVWNYKTGEC------------------------------------ 325
           ++ +L++   D  IR+W+    +C                                    
Sbjct: 127 NQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVW 186

Query: 326 -------------ISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVES--RTCYTL 368
                        ++ +R H+  +  +   +  K + + SAD T ++W ++   +   TL
Sbjct: 187 EMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTL 246

Query: 369 RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
            GH  WV        S    + S D  +R+WD+ T   ++ + GH
Sbjct: 247 DGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 46/112 (41%), Gaps = 20/112 (17%)

Query: 241 KGNCQVQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTVAIWDLCSN 283
           KGNC V E   H D                   + L  + + L T S D T  +W +  +
Sbjct: 180 KGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDD 239

Query: 284 -KLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGH 332
            KL   L GH   V    F  D A LVT S D  +R+W+  T E +  Y GH
Sbjct: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGH 291

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 8/76 (10%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 537
           +++ S D TIK+WDV++    R  + H   V ++    +   +IS   DG+I+IWDL   
Sbjct: 90  MVTSSEDGTIKVWDVRSPSIPR-NYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGEN 148

Query: 538 KCMHTFHGKRLQPQDE 553
           +C H     +L P+D+
Sbjct: 149 QCTH-----QLTPEDD 159

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 52/272 (19%), Positives = 105/272 (38%), Gaps = 32/272 (11%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDLCSNKL--IRRLSGHTDGVKTLYF--DEAKLVTGSLD 312
           L +  + +LL T  + + V ++D+ +     +    GH   V ++ F  D   +VT S D
Sbjct: 38  LEITNDKKLLATAGHQN-VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWMVTSSED 96

Query: 313 KTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRG 370
            TI+VW+ ++      Y+ H   V  + +   +  ++S   D  ++IW +    C     
Sbjct: 97  GTIKVWDVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTH--- 152

Query: 371 HTEWVNCVKLHPKSFTCFS----GSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTII 426
                   +L P+  T        SD + +   + + N  +     H      + P+T  
Sbjct: 153 --------QLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHT-DASHLKPVTKF 203

Query: 427 DAENLVVDNISGSNE-------GDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT- 478
            A +  +  I  S++         D                  +  +    D +    + 
Sbjct: 204 RAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSA 263

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV 510
           +L++ S D+ ++LWD+ T + +R   GH +G 
Sbjct: 264 YLVTASSDHYVRLWDLSTREIVRQYGGHHKGA 295

>CAGL0C03608g 360681..362612 similar to sp|P16649 Saccharomyces
           cerevisiae YCR084c TUP1 general transcription repressor,
           hypothetical start
          Length = 643

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 118/301 (39%), Gaps = 74/301 (24%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEA-KLVTGSLDKTIRVWNYK 321
           + L TG+ D  + IWD+   K++  L GH   + +L YF    KLV+GS D+TIR+W+  
Sbjct: 386 KFLATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLH 445

Query: 322 TGEC---ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVES--------RTCYTLRG 370
           TG+C   +S   G T   +S       + +GS D+TV++W   S            T  G
Sbjct: 446 TGQCSLTLSIEDGVTTVAVS-PGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVG 504

Query: 371 HTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAEN 430
           H + V  V          SGS D ++++W++R                            
Sbjct: 505 HKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLR---------------------------- 536

Query: 431 LVVDNISGSN-------EGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSC 483
               NI+G++       EG+ E                 ND+             ++LS 
Sbjct: 537 ----NINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQ-------------YILSG 579

Query: 484 SLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRII--------SGSHDGSIKIWDLQ 535
           S D  +  WD  +G  +    GH   V  +A  N + +        +GS D   KIW  Q
Sbjct: 580 SKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIWKFQ 639

Query: 536 S 536
           +
Sbjct: 640 T 640

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 119/280 (42%), Gaps = 52/280 (18%)

Query: 193 LHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGH 252
           L+++   F  +    AT       +  KL+R W +  R+   V              +GH
Sbjct: 374 LYIRSVCFSPDGKFLATG------AEDKLIRIWDIAQRKIVMV-------------LRGH 414

Query: 253 MDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK---LV 307
              + +L +  +   L +GS D T+ IWDL + +    LS   DGV T+         + 
Sbjct: 415 EQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLSIE-DGVTTVAVSPGNGNYVA 473

Query: 308 TGSLDKTIRVWNYKTGECIS-------TYRGHTDSVMSVDAFK--KIIVSGSADKTVKIW 358
            GSLD+T+RVW+  +G  +        T  GH DSV SV   +  K IVSGS D++VK+W
Sbjct: 474 AGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLW 533

Query: 359 HV--------------ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN 404
           ++              E     T  GH ++V  V          SGS D  +  WD  + 
Sbjct: 534 NLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSG 593

Query: 405 SCLKVFRGHVGQVQKVIPLTIIDAENLVVD-NISGSNEGD 443
             L + +GH      VI + + + + L  + N+  +  GD
Sbjct: 594 VPLLMLQGH---RNSVISVAVANGKPLGANYNVFATGSGD 630

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 105/264 (39%), Gaps = 70/264 (26%)

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESR 363
           L TG+ DK IR+W+    + +   RGH   + S+D F+    +VSGS D+T++IW + + 
Sbjct: 388 LATGAEDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTG 447

Query: 364 TCYTLRGHTEWVNCVKLHPKSFT-CFSGSDDTTIRMWDIRTNSCLKVFR----GHVGQVQ 418
            C       + V  V + P +     +GS D T+R+WD  +NS   V R    G  G   
Sbjct: 448 QCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWD--SNSGFLVERLDSEGETGVGH 505

Query: 419 KVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT 478
           K       D+   VV    G N                                      
Sbjct: 506 K-------DSVYSVVFTRDGKN-------------------------------------- 520

Query: 479 HLLSCSLDNTIKLWDVQT-------------GQCIRTQFGHVEGVWDIAA--DNFRIISG 523
            ++S SLD ++KLW+++              G C  T  GH + V  +    ++  I+SG
Sbjct: 521 -IVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYILSG 579

Query: 524 SHDGSIKIWDLQSGKCMHTFHGKR 547
           S D  +  WD  SG  +    G R
Sbjct: 580 SKDRGVIFWDKVSGVPLLMLQGHR 603

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 85/184 (46%), Gaps = 34/184 (18%)

Query: 254 DGVLTLQF---NYRLLFTGSYDSTVAIWDLCSNKLIRRLS-------GHTDGVKTLYF-- 301
           DGV T+     N   +  GS D TV +WD  S  L+ RL        GH D V ++ F  
Sbjct: 457 DGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVFTR 516

Query: 302 DEAKLVTGSLDKTIRVWNYKT-------------GECISTYRGHTDSVMSVDAFK--KII 346
           D   +V+GSLD+++++WN +              G C  TY GH D V+SV   +  + I
Sbjct: 517 DGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSVTTTENDQYI 576

Query: 347 VSGSADKTVKIW-HVESRTCYTLRGHTEWVNCVKLH-----PKSFTCFS-GSDDTTIRMW 399
           +SGS D+ V  W  V       L+GH   V  V +        ++  F+ GS D   ++W
Sbjct: 577 LSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATGSGDCKAKIW 636

Query: 400 DIRT 403
             +T
Sbjct: 637 KFQT 640

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 78/187 (41%), Gaps = 24/187 (12%)

Query: 374 WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVV 433
           ++  V   P      +G++D  IR+WDI     + V RGH    Q +  L    + N +V
Sbjct: 375 YIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKIVMVLRGH---EQDIYSLDYFQSGNKLV 431

Query: 434 DNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWD 493
              SGS    D                   ++   T+  S     ++ + SLD T+++WD
Sbjct: 432 ---SGSG---DRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWD 485

Query: 494 VQTGQCI-------RTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFH 544
             +G  +        T  GH + V+ +    D   I+SGS D S+K+W+L++       +
Sbjct: 486 SNSGFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRN------IN 539

Query: 545 GKRLQPQ 551
           G    PQ
Sbjct: 540 GASTSPQ 546

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 44/82 (53%), Gaps = 9/82 (10%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA---ADNFRIISGSHDGSIKIWDLQS 536
           L+S S D TI++WD+ TGQC  T     +GV  +A    +   + +GS D ++++WD  S
Sbjct: 430 LVSGSGDRTIRIWDLHTGQCSLT-LSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNS 488

Query: 537 GKCMHTFHGKRLQPQDEEGSTH 558
           G     F  +RL  + E G  H
Sbjct: 489 G-----FLVERLDSEGETGVGH 505

>Kwal_0.212
          Length = 303

 Score = 74.7 bits (182), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 125/299 (41%), Gaps = 30/299 (10%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD-EAKLVTGSLDKTIRVWNYKTG 323
           +L +  YD T+  W+  +    R +      V  L    + + +  +    +R+++ +T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEISSDKRFLAAAGHLNVRLYDIRTT 63

Query: 324 EC--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378
               ++++ GH  +V S+ AF+   K +VS S D T+K+W V + +      H   VN V
Sbjct: 64  NPNPVTSFEGHRGNVTSI-AFQQENKWMVSSSEDGTIKVWDVRAPSVQRNYKHQAAVNEV 122

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            +HP      S   D  +R+WD+  N C+     H    +   PL  +   +     ++G
Sbjct: 123 VIHPNQGELISCDQDGNVRIWDLGENQCV-----HQLAPEDDTPLQSLSVASDGSMLVAG 177

Query: 439 SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT---------HLLSCSLDNTI 489
           +N+G+                   N +          Y T         HL +CS D+T 
Sbjct: 178 NNKGN------CYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSADHTA 231

Query: 490 KLWDVQTGQCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           ++W +     + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 232 RVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 77/183 (42%), Gaps = 15/183 (8%)

Query: 246 VQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDG-VKTLYF- 301
           VQ    H   V  + +  N   L +   D  V IWDL  N+ + +L+   D  +++L   
Sbjct: 109 VQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGENQCVHQLAPEDDTPLQSLSVA 168

Query: 302 -DEAKLVTGSLDKTIRVW------NYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSAD 352
            D + LV G+      VW      +    + ++ +R H   +  V   +  K + + SAD
Sbjct: 169 SDGSMLVAGNNKGNCYVWQMPHQTDAANPKPVTKFRSHAKYITRVLLSSDVKHLATCSAD 228

Query: 353 KTVKIWHVES--RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
            T ++W ++   +   TL  H  WV        S    +   D  +R+WD+ T   ++ +
Sbjct: 229 HTARVWSIDDNFQLETTLDNHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQY 288

Query: 411 RGH 413
            GH
Sbjct: 289 GGH 291

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 8/76 (10%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 537
           ++S S D TIK+WDV+    ++  + H   V ++    +   +IS   DG+++IWDL   
Sbjct: 90  MVSSSEDGTIKVWDVR-APSVQRNYKHQAAVNEVVIHPNQGELISCDQDGNVRIWDLGEN 148

Query: 538 KCMHTFHGKRLQPQDE 553
           +C+H     +L P+D+
Sbjct: 149 QCVH-----QLAPEDD 159

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 44/99 (44%), Gaps = 5/99 (5%)

Query: 246 VQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSN-KLIRRLSGHTDGVKTLYF- 301
           V +F+ H   +  + L  + + L T S D T  +W +  N +L   L  H   V    F 
Sbjct: 200 VTKFRSHAKYITRVLLSSDVKHLATCSADHTARVWSIDDNFQLETTLDNHQRWVWDCAFS 259

Query: 302 -DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV 339
            D A LVT   D  +R+W+  T E +  Y GH    + V
Sbjct: 260 ADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAICV 298

>CAGL0C02937g 290289..291692 similar to sp|P39946 Saccharomyces
           cerevisiae YOR269w PAC1, hypothetical start
          Length = 467

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 100/213 (46%), Gaps = 51/213 (23%)

Query: 246 VQEFKGHMDGVLTLQFNYR-----LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY 300
           ++ F  H D  ++ Q  ++     LL + S D+TV +W +  ++ ++  S H++ VK++ 
Sbjct: 214 IRSFNAH-DSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSID 272

Query: 301 FDEAKLVTGSLDKTIRVWNYKTGECISTYRGH------------TDSVMSVDAFK----- 343
             +  +++GSLD T+R+ ++ +G  +S   GH            +DS +    ++     
Sbjct: 273 VLDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSPYRDQNEH 332

Query: 344 --------KIIVSGSADKTVKIWHVE--------------SRTCY----TLRGHTEWVNC 377
                   K   S + D T+KIW V               + T +    TLRGHT WV  
Sbjct: 333 SAFAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKD 392

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
           +KL       FS SDD TI+ WD+ T +C+K +
Sbjct: 393 LKLRGDHL--FSCSDDETIKCWDLNTGNCVKTW 423

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 115/271 (42%), Gaps = 57/271 (21%)

Query: 300 YFDEAKLV-TGSLDKTIRVWNYK--TGEC--ISTYRGHTDSVMSVDAFKK----IIVSGS 350
           + D   LV T S D  I V+++   TGE   I ++  H  +V S   ++K    ++ S S
Sbjct: 183 FIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVLLASSS 242

Query: 351 ADKTVKIWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKV 409
            D TVK+W V +SR   +   H+EWV  + +  +     SGS D+T+R+    + + L V
Sbjct: 243 RDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYI--LSGSLDSTLRLTHWPSGNGLSV 300

Query: 410 FRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQT 469
             GH   +++V+ +   D++                                  D+   +
Sbjct: 301 GTGHEFPIERVLIIPFSDSK---------------------------ICTSPYRDQNEHS 333

Query: 470 LDKSIPYPTHLLSCSLDNTIKLWDV-----------------QTGQCIRTQFGHVEGVWD 512
               + +  +  S + DNTIK+W+V                  T +C+ T  GH   V D
Sbjct: 334 AFAPLRF-KYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKD 392

Query: 513 IAADNFRIISGSHDGSIKIWDLQSGKCMHTF 543
           +      + S S D +IK WDL +G C+ T+
Sbjct: 393 LKLRGDHLFSCSDDETIKCWDLNTGNCVKTW 423

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 88/205 (42%), Gaps = 49/205 (23%)

Query: 265 LLFTGSYDSTVAIWDLCSN----KLIRRLSGHTDGV---KTLYFD-EAKLVTGSLDKTIR 316
           L+ T S D+ + ++D  SN    KLIR  + H   V   KT   D +  L + S D T++
Sbjct: 189 LVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVLLASSSRDATVK 248

Query: 317 VWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTL-RGHTEWV 375
           VW      C+ ++  H++ V S+D   + I+SGS D T+++ H  S    ++  GH   +
Sbjct: 249 VWRVNDSRCLQSFSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPI 308

Query: 376 NCVKLHPKSFT-----------------------CFSGSDDTTIRMWDI-----RTNS-- 405
             V + P S +                       C S + D TI++W++     + NS  
Sbjct: 309 ERVLIIPFSDSKICTSPYRDQNEHSAFAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAP 368

Query: 406 ----------CLKVFRGHVGQVQKV 420
                     C+   RGH   V+ +
Sbjct: 369 VPSTTNTTFKCVMTLRGHTSWVKDL 393

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 56/130 (43%), Gaps = 33/130 (25%)

Query: 259 LQFNYRLLFTGSYDSTVAIWDL-----------------CSNKLIRRLSGHTDGVKTLYF 301
           L+F Y    + + D+T+ IW++                  + K +  L GHT  VK L  
Sbjct: 338 LRFKY--CASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKDLKL 395

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRG---------HTDSVMSVDAF-----KKIIV 347
               L + S D+TI+ W+  TG C+ T+             D   +++ F     ++I+V
Sbjct: 396 RGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNNFINCIDIDREATIEQFSPSLQREILV 455

Query: 348 SGSADKTVKI 357
           SG  D  VKI
Sbjct: 456 SGDMDNKVKI 465

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/187 (21%), Positives = 72/187 (38%), Gaps = 45/187 (24%)

Query: 239 WRKGNCQ-VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGH---TD 294
           WR  + + +Q F  H + V ++      + +GS DST+ +    S   +   +GH    +
Sbjct: 250 WRVNDSRCLQSFSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIE 309

Query: 295 GVKTLYFDEAKLVT----------------------GSLDKTIRVWNYK----------- 321
            V  + F ++K+ T                       + D TI++W              
Sbjct: 310 RVLIIPFSDSKICTSPYRDQNEHSAFAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAPV 369

Query: 322 ------TGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRG--HTE 373
                 T +C+ T RGHT  V  +      + S S D+T+K W + +  C       H  
Sbjct: 370 PSTTNTTFKCVMTLRGHTSWVKDLKLRGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNN 429

Query: 374 WVNCVKL 380
           ++NC+ +
Sbjct: 430 FINCIDI 436

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 73/190 (38%), Gaps = 31/190 (16%)

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSC-LKVFRGHVGQVQKVIPLTIIDAENL-- 431
           V  +KLHP     + G+D   +  +DI   +  L V   H    + +  + +I+A N   
Sbjct: 126 VTAIKLHPSLAIVYVGTDTGRLIAYDILNYTIPLAVTTAHS---KAITSIEVIEAHNFEE 182

Query: 432 VVDNIS----------------GSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIP 475
            +D+ +                 SN G+ +                   ++N  L     
Sbjct: 183 FIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFNAHDSTVSSQKTWQKDNDVL----- 237

Query: 476 YPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQ 535
               L S S D T+K+W V   +C+++   H E V  I   +  I+SGS D ++++    
Sbjct: 238 ----LASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDEYILSGSLDSTLRLTHWP 293

Query: 536 SGKCMHTFHG 545
           SG  +    G
Sbjct: 294 SGNGLSVGTG 303

>YCR057C (PWP2) [586] chr3 complement(220452..223223) Essential
           protein required for cell separation, has eight WD
           (WD-40) repeats, component of U3 snoRNP (also called
           small subunit processome), which is required for 18S
           rRNA biogenesis [2772 bp, 923 aa]
          Length = 923

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/161 (31%), Positives = 81/161 (50%), Gaps = 9/161 (5%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKT 322
           L F  S    + +++  S   I +  GH D   +L +  D +++VT S D  I+VW+  +
Sbjct: 317 LAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITS 376

Query: 323 GECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWH-VESRTCYTLRGHTEWV--NC 377
           G C++T+  HT SV +V   K+  ++ S S D TV+ W  +  R   T  G TE +  NC
Sbjct: 377 GFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQFNC 435

Query: 378 VKLHPKSFTCFSGS-DDTTIRMWDIRTNSCLKVFRGHVGQV 417
           + + P      +GS D+  I +W ++T   L    GH G V
Sbjct: 436 LAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPV 476

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 85/186 (45%), Gaps = 23/186 (12%)

Query: 250 KGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLV 307
           +GH D   +L +  +   + T S D  + +WD+ S   +     HT  V  + F +   V
Sbjct: 342 QGHFDSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQV 401

Query: 308 --TGSLDKTIRVWNYKTGECISTYRGHTDSV----MSVDAFKKIIVSGSADK-TVKIWHV 360
             + SLD T+R W+        T+ G T+ +    ++VD   +++ +GS D   + +W V
Sbjct: 402 MFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 460

Query: 361 ES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 419
           ++ +    L GH   V+C+    ++    S S D TIR+W I             G+ Q+
Sbjct: 461 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI------------FGRSQQ 508

Query: 420 VIPLTI 425
           V P+ +
Sbjct: 509 VEPIEV 514

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 63/125 (50%), Gaps = 10/125 (8%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT--LYFDEA 304
           F+ H   V  +QF  R  ++F+ S D TV  WDL   +  R  +G T+ ++   L  D +
Sbjct: 383 FEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFTG-TERIQFNCLAVDPS 441

Query: 305 KLV--TGSLDK-TIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWH 359
             V   GSLD   I VW+ +TG+ +    GH   V  +S      ++ S S DKT++IW 
Sbjct: 442 GEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWS 501

Query: 360 VESRT 364
           +  R+
Sbjct: 502 IFGRS 506

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 110/282 (39%), Gaps = 63/282 (22%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLD-KTIRVWNY 320
           RLL  G       ++DL    LI++LS   + V T+  ++    L  GS     + V+ +
Sbjct: 273 RLLAVGFTSGEFRLYDLPDFTLIQQLSMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEW 332

Query: 321 KTGECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVN 376
           ++   I   +GH DS  S+ A+      +V+ S D  +K+W + S  C  T   HT  V 
Sbjct: 333 QSESYILKQQGHFDSTNSL-AYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVT 391

Query: 377 CVKLHPKSFTCFSGSDDTTIRMWD-IRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDN 435
            V+   +    FS S D T+R WD IR     + FR   G  +       I    L VD 
Sbjct: 392 AVQFAKRGQVMFSSSLDGTVRAWDLIR----YRNFRTFTGTER-------IQFNCLAVD- 439

Query: 436 ISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDN-TIKLWDV 494
                                                  P    + + SLDN  I +W V
Sbjct: 440 ---------------------------------------PSGEVVCAGSLDNFDIHVWSV 460

Query: 495 QTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDL 534
           QTGQ +    GH   V     + +N  + S S D +I+IW +
Sbjct: 461 QTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI 502

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 119/309 (38%), Gaps = 30/309 (9%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCS---NKLIRRLSGHTDGVKTLYF--DE 303
           GH   + +L +  + R + T S D +  IW + S   N      +GH D V   +F  D+
Sbjct: 144 GHFQDITSLTWSQDSRFILTTSKDLSAKIWSVDSEEKNLAATTFNGHRDYVMGAFFSHDQ 203

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESR 363
            K+ T S D  + VW +       T R   D     +   K       D +   W +  +
Sbjct: 204 EKIYTVSKDGAVFVWEF-------TKRPSDDDDNESEDDDK---QEEVDISKYSWRITKK 253

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPL 423
             +    +   V CV  HP +     G      R++D+   + ++     +GQ     P+
Sbjct: 254 HFF--YANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQL--SMGQN----PV 305

Query: 424 TIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSC 483
             +           GS++                      D  N +L  S P  + +++ 
Sbjct: 306 NTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTN-SLAYS-PDGSRVVTA 363

Query: 484 SLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMH 541
           S D  IK+WD+ +G C+ T   H   V  +  A     + S S DG+++ WDL   +   
Sbjct: 364 SEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFR 423

Query: 542 TFHG-KRLQ 549
           TF G +R+Q
Sbjct: 424 TFTGTERIQ 432

>KLLA0F21406g complement(1996260..1998377) similar to sp|P47025
           Saccharomyces cerevisiae YJL112w MDV1, start by
           similarity
          Length = 705

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 89/204 (43%), Gaps = 40/204 (19%)

Query: 245 QVQEFKGHMDGVLTLQFN-YRLLFTGSYDSTVAIWDL-------CSNKL------IRRLS 290
           Q+    GH+  +  +Q + Y  L TG  D+ + +WD+        SN        +    
Sbjct: 432 QIATLHGHLASISCMQIDQYSTLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFD 491

Query: 291 GHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECIST---------YRGHTD------- 334
            H D +  + FD   LV+GS D+T+R W+  +G+C  T          R   +       
Sbjct: 492 SHVDEITAISFDGDNLVSGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSV 551

Query: 335 -------SVMSVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFT 386
                  ++ ++  F   + +G+ D  V++W + S +    L GHT+ +  ++    S  
Sbjct: 552 LLTKEPPAIGALQCFDAALATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQF--DSVN 609

Query: 387 CFSGSDDTTIRMWDIRTNSCLKVF 410
             +G+ D +IR+WD+RT     VF
Sbjct: 610 LVTGAMDRSIRIWDLRTGILSDVF 633

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 61/95 (64%), Gaps = 3/95 (3%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L TG+ D  V +WDL S K++R L GHTD + +L FD   LVTG++D++IR+W+ +TG  
Sbjct: 570 LATGTKDGIVRLWDLRSGKVVRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTG-I 628

Query: 326 ISTYRGHTDSVMSVD-AFKKIIVSGSADKTVKIWH 359
           +S    +   + S+     KI++S + + TVKI++
Sbjct: 629 LSDVFAYEQPITSLHFDLDKIVISNN-EPTVKIYN 662

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 65/327 (19%), Positives = 128/327 (39%), Gaps = 93/327 (28%)

Query: 250 KGHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE-AK 305
           K H + +  L F+     +   GS D +V +WDL   K I  L GH   +  +  D+ + 
Sbjct: 394 KAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLASISCMQIDQYST 453

Query: 306 LVTGSLDKTIRVWNYKTG-------------ECISTYRGHTDSVMSVDAFKKIIVSGSAD 352
           L+TG  D  +++W+                  C+ T+  H D + ++      +VSGS D
Sbjct: 454 LITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAISFDGDNLVSGSQD 513

Query: 353 KTVKIWHVESRTCYTL------------RGHTEWVNCVKLHPK-----SFTCF-----SG 390
           +TV+ W + S  C               + +    N V L  +     +  CF     +G
Sbjct: 514 RTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVLLTKEPPAIGALQCFDAALATG 573

Query: 391 SDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXX 450
           + D  +R+WD+R+   +++  GH   +  +      D+ NLV                  
Sbjct: 574 TKDGIVRLWDLRSGKVVRMLEGHTDAITSL----QFDSVNLV------------------ 611

Query: 451 XXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV 510
                                          + ++D +I++WD++TG  +   F + + +
Sbjct: 612 -------------------------------TGAMDRSIRIWDLRTG-ILSDVFAYEQPI 639

Query: 511 WDIAADNFRIISGSHDGSIKIWDLQSG 537
             +  D  +I+  +++ ++KI++ + G
Sbjct: 640 TSLHFDLDKIVISNNEPTVKIYNRKDG 666

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/267 (20%), Positives = 103/267 (38%), Gaps = 95/267 (35%)

Query: 320 YKTGECISTY-RGHTDSVMSVD---AFKKIIVSGSADKTVKIWHV-ESRTCYTLRGHTEW 374
           Y +G  I++  + H + +  +D    F  +  +GS D +VK+W + + +   TL GH   
Sbjct: 383 YDSGSKITSLPKAHDEDITCLDFDMPFGTMCSAGSLDHSVKVWDLSKKKQIATLHGHLAS 442

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIR-------------TNSCLKVFRGHVGQVQKVI 421
           ++C+++   S T  +G  D  +++WDI               ++CL  F  HV ++  + 
Sbjct: 443 ISCMQIDQYS-TLITGGRDAVLKLWDIDKAMADEASNSSEDNDACLYTFDSHVDEITAI- 500

Query: 422 PLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLL 481
                            S +GD+                                   L+
Sbjct: 501 -----------------SFDGDN-----------------------------------LV 508

Query: 482 SCSLDNTIKLWDVQTGQCIRT-----QFGHVEGVWDIAADNFRIIS-------------- 522
           S S D T++ WD+ +G+C +T       G +    +I   N  +++              
Sbjct: 509 SGSQDRTVRQWDLNSGKCTQTIDISFATGPMRSQRNIPLRNSVLLTKEPPAIGALQCFDA 568

Query: 523 ----GSHDGSIKIWDLQSGKCMHTFHG 545
               G+ DG +++WDL+SGK +    G
Sbjct: 569 ALATGTKDGIVRLWDLRSGKVVRMLEG 595

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 50/86 (58%), Gaps = 2/86 (2%)

Query: 238 NWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK 297
           + R G   V+  +GH D + +LQF+   L TG+ D ++ IWDL +  ++  +  +   + 
Sbjct: 583 DLRSGKV-VRMLEGHTDAITSLQFDSVNLVTGAMDRSIRIWDLRTG-ILSDVFAYEQPIT 640

Query: 298 TLYFDEAKLVTGSLDKTIRVWNYKTG 323
           +L+FD  K+V  + + T++++N K G
Sbjct: 641 SLHFDLDKIVISNNEPTVKIYNRKDG 666

>AAL009C [178] [Homologous to ScYNL006W (LST8) - SH]
           (325785..326696) [912 bp, 303 aa]
          Length = 303

 Score = 72.8 bits (177), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 129/294 (43%), Gaps = 20/294 (6%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTG 323
           +L +  YD T+  W+  +    R +      V  L    + + +  +    +R+++ +T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRYLAAAGHLHVRMYDIRTT 63

Query: 324 EC--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378
               ++++ GH  +V S+ AF+   K +VS S D T+K+W V S +      H   VN V
Sbjct: 64  NPNPVTSFEGHRGNVTSI-AFQQDNKWMVSSSEDGTIKVWDVRSPSVQRNYKHDAPVNEV 122

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            +HP      S   D  I++WD+  N C       +     +  L+I    +++V   +G
Sbjct: 123 VIHPNQGELISCDQDGNIKIWDLGENQCTNQLA--LEDNTALQSLSIASDGSMLV---AG 177

Query: 439 SNEGD----DEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV 494
           +N+G+      P                + +    +  S+    HL +CS D+T ++W V
Sbjct: 178 NNKGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVK-HLATCSADHTARVWSV 236

Query: 495 QTGQCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           +    + T    H   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 237 EDNFQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 77/172 (44%), Gaps = 17/172 (9%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTD-GVKTLYF--DEAKLVTGSLDK 313
           + +  N   L +   D  + IWDL  N+   +L+   +  +++L    D + LV G+   
Sbjct: 122 VVIHPNQGELISCDQDGNIKIWDLGENQCTNQLALEDNTALQSLSIASDGSMLVAGNNKG 181

Query: 314 TIRVW------NYKTGECISTYRGH----TDSVMSVDAFKKIIVSGSADKTVKIWHVES- 362
              VW      +  + + ++ +R H    T  ++SVD   K + + SAD T ++W VE  
Sbjct: 182 NCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDV--KHLATCSADHTARVWSVEDN 239

Query: 363 -RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
            +   TL  H+ WV        S    +   D  +R+WD+ T   ++ + GH
Sbjct: 240 FQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 45/112 (40%), Gaps = 20/112 (17%)

Query: 241 KGNCQVQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTVAIWDLCSN 283
           KGNC V +   H D                   + L  + + L T S D T  +W +  N
Sbjct: 180 KGNCYVWKMPNHTDTASLKPVTKFRSHSKYITRVLLSVDVKHLATCSADHTARVWSVEDN 239

Query: 284 -KLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGH 332
            +L   L  H+  V    F  D A LVT   D  +R+W+  T E +  Y GH
Sbjct: 240 FQLETTLDAHSRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

>Sklu_2442.2 YNL006W, Contig c2442 3831-4742
          Length = 303

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/299 (22%), Positives = 126/299 (42%), Gaps = 30/299 (10%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTG 323
           +L +  YD T+  W+  +    R +      V  L    + + +  +    +R+++ +T 
Sbjct: 4   ILASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKRFLAAAGHLHVRLYDIRTT 63

Query: 324 EC--ISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378
               ++++ GH  +V S+ +F+   K +VS S D T+K+W V + +      H   VN V
Sbjct: 64  NPNPVTSFEGHRGNVTSI-SFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEV 122

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISG 438
            +HP      S   D  IR+WD+  N C      H    +   PL  +   +     ++G
Sbjct: 123 VIHPNQGELISCDQDGNIRIWDLGENQCT-----HQLTPEDDTPLQSLSIASDGSMLVAG 177

Query: 439 SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT---------HLLSCSLDNTI 489
           +N+G+                   N +          Y T         HL +CS D+T 
Sbjct: 178 NNKGN------CYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTA 231

Query: 490 KLWDVQTGQCIRTQF-GHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           ++W ++    + T   GH   VWD A  AD+  +++   D  +++WDL + + +  + G
Sbjct: 232 RVWSIEDNFKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGG 290

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/224 (19%), Positives = 84/224 (37%), Gaps = 56/224 (25%)

Query: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTD-GVKTLYFD 302
           V  F+GH   V ++ F  + + + + S D T+ +WD+ +  + R    H       ++ +
Sbjct: 68  VTSFEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVVIHPN 127

Query: 303 EAKLVTGSLDKTIRVWNYKTGEC------------------------------------- 325
           + +L++   D  IR+W+    +C                                     
Sbjct: 128 QGELISCDQDGNIRIWDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAGNNKGNCYVWQ 187

Query: 326 ------------ISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVES--RTCYTLR 369
                       ++ +R HT  +  V   +  K + + SAD T ++W +E   +   TL 
Sbjct: 188 MPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDNFKLETTLD 247

Query: 370 GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
           GH  WV        S    +   D  +R+WD+ T   ++ + GH
Sbjct: 248 GHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGH 291

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 47/119 (39%), Gaps = 20/119 (16%)

Query: 241 KGNCQVQEFKGHMDGV-----------------LTLQFNYRLLFTGSYDSTVAIWDLCSN 283
           KGNC V +   H D                   + L  + + L T S D T  +W +  N
Sbjct: 180 KGNCYVWQMPNHTDAANLKPVTKFRSHTKYITRVLLSSDVKHLATCSADHTARVWSIEDN 239

Query: 284 -KLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV 339
            KL   L GH   V    F  D A LVT   D  +R+W+  T E +  Y GH    + V
Sbjct: 240 FKLETTLDGHQRWVWDCAFSADSAYLVTACSDHYVRLWDLSTREIVRQYGGHHKGAVCV 298

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (51%), Gaps = 10/77 (12%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHV---EGVWDIAADNFRIISGSHDGSIKIWDLQS 536
           ++S S D TIK+WDV+     R    H    E V  I  +   +IS   DG+I+IWDL  
Sbjct: 90  MVSSSEDGTIKVWDVRAPSVQRNYKHHAPVNEVV--IHPNQGELISCDQDGNIRIWDLGE 147

Query: 537 GKCMHTFHGKRLQPQDE 553
            +C H     +L P+D+
Sbjct: 148 NQCTH-----QLTPEDD 159

>Scas_713.50
          Length = 983

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 98/248 (39%), Gaps = 60/248 (24%)

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTYR-GHTDSVMSVDAFKK---------------IIV 347
            +++TG+L+  + +W+ KTGE  S    G      SVDA                  ++ 
Sbjct: 64  GQIITGALE-NVNIWDLKTGELASFLNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLA 122

Query: 348 SGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSC 406
            G  D  VK+W + S+T    L GH+  +  +K         SGS D+ I +WD+ +   
Sbjct: 123 VGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVG 182

Query: 407 LKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEE 466
           L   R H   +  +         N V +N                           N EE
Sbjct: 183 LYKLRSHKDAITGIWC-------NEVTNN---------------------------NQEE 208

Query: 467 NQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHD 526
           N+ LD        L+S S D  IK+WD++  QC+ T   H    W +A  N  +I+ S D
Sbjct: 209 NE-LD-------WLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSD 260

Query: 527 GSIKIWDL 534
             +K W L
Sbjct: 261 SQVKFWQL 268

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 87/182 (47%), Gaps = 21/182 (11%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDL---------CSNKLIRRLSGHTDGVKTLYFD----- 302
           L L  + + L TGS D +V  W+           S+K + +L  H D    L  D     
Sbjct: 517 LDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVR 576

Query: 303 ---EAKLVTGSL-DKTIRVWNYKTGECISTYRGHTDSVMSVD-AF-KKIIVSGSADKTVK 356
              E K +  SL D T++V+   + +   +  GH   V+S+D +F  K+I++ SADK +K
Sbjct: 577 VSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 636

Query: 357 IWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           IW ++   C+ +L  H + +  VK  P+S   FS S D  I+ WD     C++    H  
Sbjct: 637 IWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQS 696

Query: 416 QV 417
           +V
Sbjct: 697 EV 698

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/293 (23%), Positives = 106/293 (36%), Gaps = 75/293 (25%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV---KTLYFDEAKLVTGSLDKTIRVWNY- 320
           L+  G+    + ++DL S+  I  +    D       L  D  +L+TGS DK+++ WN+ 
Sbjct: 482 LVIIGTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQ 541

Query: 321 ---------------KTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVESR 363
                          K G    T    +D ++SV      K +     D TVK++ ++S 
Sbjct: 542 LEQELVPGTSDKFVPKLGLHHDTTLELSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSM 601

Query: 364 TCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP 422
             + +L GH   V  + +   S    + S D  I++W +    C K    H   +  V  
Sbjct: 602 KFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV-- 659

Query: 423 LTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLS 482
                                                            K +P   +  S
Sbjct: 660 -------------------------------------------------KFVPESHNFFS 670

Query: 483 CSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWD 533
           CS D  IK WD    +CI+    H   VW   IA D   ++S SHD SI+IW+
Sbjct: 671 CSKDGIIKYWDGDKFECIQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWE 723

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 60/125 (48%), Gaps = 13/125 (10%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK- 305
             GH   +  L+F+     L +GS DS + +WDL S   + +L  H D +  ++ +E   
Sbjct: 144 LNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTN 203

Query: 306 ----------LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTV 355
                     L++ S D  I++W+ K  +C+ T+  HT    S+     ++++ S+D  V
Sbjct: 204 NNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQV 263

Query: 356 KIWHV 360
           K W +
Sbjct: 264 KFWQL 268

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 70/151 (46%), Gaps = 16/151 (10%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEA--KLVTGSLDKTIRVWNYKT 322
           LL  G  D  V +WDL S  ++  L+GH+  +  L FD +  +L++GS D  I VW+  +
Sbjct: 120 LLAVGYNDGVVKVWDLYSKTVLCNLNGHSSAITALKFDTSGTRLISGSRDSNIIVWDLVS 179

Query: 323 GECISTYRGHTDSVMSV-----------DAFKKIIVSGSADKTVKIWHVESRTCY-TLRG 370
              +   R H D++  +           +     ++S S D  +KIW ++ + C  T   
Sbjct: 180 EVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKDGLIKIWDLKIQQCVETHIA 239

Query: 371 HTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
           HT    C  L  ++    + S D+ ++ W +
Sbjct: 240 HTG--ECWSLAVRNDLVITTSSDSQVKFWQL 268

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 64/142 (45%), Gaps = 5/142 (3%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL--YFDEAKLVTGSLDKTIRVWNYK 321
           + L     D+TV ++ L S K    L GH   V ++   FD   ++T S DK I++W   
Sbjct: 582 KFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 641

Query: 322 TGECISTYRGHTDSVMSVDAFKKI--IVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCV 378
            G+C  +   H DS+M+V    +     S S D  +K W  +   C   L  H   V  +
Sbjct: 642 FGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFECIQKLAAHQSEVWAL 701

Query: 379 KLHPKSFTCFSGSDDTTIRMWD 400
            +   +    S S D +IR+W+
Sbjct: 702 AIANDASFVVSSSHDHSIRIWE 723

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 109/267 (40%), Gaps = 45/267 (16%)

Query: 281 CSNKLIR-RLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTGECISTYR-GHTDSVM 337
            +NKL    L G    ++++   D+ KL+  + + ++++WN KT  CI T+  G+  +  
Sbjct: 416 IANKLYNVELQGQRTDIRSIDISDDNKLLATASNGSLKIWNLKTKLCIRTFECGYALTCK 475

Query: 338 SVDAFKKIIVSGSADKTVKIWHVESRT--CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTT 395
            +     +I+ G+    ++++ + S T        H   +  + L        +GS D +
Sbjct: 476 FLPGGMLVII-GTRAGELQLFDLASSTQIANIEEAHDAAIWSLDLTSDGKRLITGSADKS 534

Query: 396 IRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXX 455
           ++ W+ +    L       G   K +P        L + + +     DD           
Sbjct: 535 VKFWNFQLEQELVP-----GTSDKFVP-------KLGLHHDTTLELSDD----------- 571

Query: 456 XXXXXXXNDEENQTLDKSIPYPTHLLSCSL-DNTIKLWDVQTGQCIRTQFGHVEGVW--D 512
                         L   +      L+ SL DNT+K++ + + +   + +GH   V   D
Sbjct: 572 -------------ILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSID 618

Query: 513 IAADNFRIISGSHDGSIKIWDLQSGKC 539
           I+ D+  II+ S D +IKIW L  G C
Sbjct: 619 ISFDSKMIITSSADKNIKIWGLDFGDC 645

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 11/76 (14%)

Query: 478 THLLSCSLDNTIKLWDV--QTGQC-IRTQFGHVEGVW--DIAADNFR------IISGSHD 526
           T L+S S D+ I +WD+  + G   +R+    + G+W  ++  +N        +IS S D
Sbjct: 161 TRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQEENELDWLISTSKD 220

Query: 527 GSIKIWDLQSGKCMHT 542
           G IKIWDL+  +C+ T
Sbjct: 221 GLIKIWDLKIQQCVET 236

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 8/72 (11%)

Query: 473 SIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIW 532
           SIPY     +  + N  KL++V+  Q  RT    +    DI+ DN ++++ + +GS+KIW
Sbjct: 404 SIPYEKREPTQPIAN--KLYNVEL-QGQRTDIRSI----DISDDN-KLLATASNGSLKIW 455

Query: 533 DLQSGKCMHTFH 544
           +L++  C+ TF 
Sbjct: 456 NLKTKLCIRTFE 467

>AAR057W [243] [Homologous to ScYCR057C (PWP2) - SH]
           complement(442821..445589) [2769 bp, 922 aa]
          Length = 922

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 79/160 (49%), Gaps = 7/160 (4%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKT 322
           L F  S    + +++  S   I +  GH D +  L +  D A++VT + D  I++W+  +
Sbjct: 328 LAFGSSTLGQLLVYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVS 387

Query: 323 GECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVESRTCYTLRGHTEWV--NCV 378
           G C++T+  HT SV SV   K  +I+ S S D TVK W +     +     TE +  +C+
Sbjct: 388 GFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCL 447

Query: 379 KLHPKSFTCFSGS-DDTTIRMWDIRTNSCLKVFRGHVGQV 417
              P      +GS D+  I++W ++T   L    GH G V
Sbjct: 448 AADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPV 487

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 89/194 (45%), Gaps = 24/194 (12%)

Query: 250 KGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK-- 305
           +GH D +  L +  +   + T + D  + IWD+ S   +     HT  V ++ F +    
Sbjct: 353 QGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQI 412

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTD---SVMSVDAFKKIIVSGSADK-TVKIWHVE 361
           + + SLD T++ W+        T+        S ++ D   +++ +GS D   +++W V+
Sbjct: 413 MFSSSLDGTVKAWDLMRFRNFRTFTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSVQ 472

Query: 362 S-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           + +   TL GH   V+C+    ++    S S D TIR+W I             G+ Q+V
Sbjct: 473 TGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIRVWSI------------FGRSQQV 520

Query: 421 IPLTIIDAENLVVD 434
            P   I+A + V+D
Sbjct: 521 EP---IEAYSDVLD 531

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 68/132 (51%), Gaps = 11/132 (8%)

Query: 242 GNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT- 298
           G C +  F+ H   V ++QF  N +++F+ S D TV  WDL   +  R  +  T+ ++  
Sbjct: 388 GFC-LATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMRFRNFRTFTA-TERIQFS 445

Query: 299 -LYFDEAKLV--TGSLDK-TIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSAD 352
            L  D    V   GSLD   I+VW+ +TG+ + T  GH   V  +S      I+ S S D
Sbjct: 446 CLAADPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWD 505

Query: 353 KTVKIWHVESRT 364
           KT+++W +  R+
Sbjct: 506 KTIRVWSIFGRS 517

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 75/184 (40%), Gaps = 20/184 (10%)

Query: 358 WHVESRTCYTLR--GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           W  ES   Y L+  GH + +N +   P      + ++D  I++WDI +  CL  F  H  
Sbjct: 343 WQSES---YILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTS 399

Query: 416 QVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIP 475
            V  V      + + +   ++ G+ +  D                     E         
Sbjct: 400 SVTSVQFAK--NGQIMFSSSLDGTVKAWD--------LMRFRNFRTFTATERIQFSCLAA 449

Query: 476 YPTHLLSC--SLDN-TIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIK 530
            PT  + C  SLDN  I++W VQTGQ + T  GH   V     + +N  + S S D +I+
Sbjct: 450 DPTGEVVCAGSLDNYDIQVWSVQTGQLLDTLSGHEGPVSCLSFSRENSILASASWDKTIR 509

Query: 531 IWDL 534
           +W +
Sbjct: 510 VWSI 513

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 42/78 (53%), Gaps = 3/78 (3%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-ADNFRII-SGSHDGSIKIW 532
           P    +++ + D  IK+WD+ +G C+ T   H   V  +  A N +I+ S S DG++K W
Sbjct: 366 PDGARIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAW 425

Query: 533 DLQSGKCMHTFHG-KRLQ 549
           DL   +   TF   +R+Q
Sbjct: 426 DLMRFRNFRTFTATERIQ 443

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 491 LWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTF 543
           +++ Q+   I  Q GH + +  +A   D  RI++ + DG IKIWD+ SG C+ TF
Sbjct: 340 VYEWQSESYILKQQGHFDALNALAYSPDGARIVTAAEDGKIKIWDIVSGFCLATF 394

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD--IAAD--NFRIISGSHDG-SIKIWDL 534
           + S SLD T+K WD+   +  RT F   E +    +AAD     + +GS D   I++W +
Sbjct: 413 MFSSSLDGTVKAWDLMRFRNFRT-FTATERIQFSCLAADPTGEVVCAGSLDNYDIQVWSV 471

Query: 535 QSGKCMHTFHG 545
           Q+G+ + T  G
Sbjct: 472 QTGQLLDTLSG 482

>CAGL0C00737g complement(75028..77478) similar to tr|Q05946
           Saccharomyces cerevisiae YLR222c, hypothetical start
          Length = 816

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/209 (29%), Positives = 94/209 (44%), Gaps = 27/209 (12%)

Query: 249 FKGHMDGVLT------LQFNY-RLLFTGSYDSTVAIW-------DLCSNKLIRRLSGHTD 294
           F GH   V        ++ NY + + T S D TV  W       DL     I + S +T 
Sbjct: 432 FVGHAASVSAVCLPNVMEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTR 491

Query: 295 -------GVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKI 345
                     ++  +++   T S DKT ++WN  TGE ++T   H   +  V     +K 
Sbjct: 492 HAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKW 551

Query: 346 IVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN 404
           I + S DKTVKIW +ES T   TL GHT  V       K     S   D  I++WDI + 
Sbjct: 552 IATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASG 611

Query: 405 SCLKVFRGHVGQVQKVIPLTIIDAENLVV 433
            C+K   GH     ++  L++++  +L++
Sbjct: 612 DCIKNLDGH---SNRIWALSVLEDGDLII 637

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 83/182 (45%), Gaps = 12/182 (6%)

Query: 188 WGLPLLH--MKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERF--KVESNWRKGN 243
           W +P +   +    F+  +SI  T +   KD N   M P   I+      K    W    
Sbjct: 468 WEIPPMKNDLNEVPFIVKSSI-YTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDT 526

Query: 244 CQ-VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY 300
            + V     H  G+  + F  + + + T S D TV IW L S  +++ L GHT+ V+   
Sbjct: 527 GEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCS 586

Query: 301 F--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVK 356
           F   + +LV+   D  I+VW+  +G+CI    GH++ + ++   +   +I+S  AD   +
Sbjct: 587 FMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQ 646

Query: 357 IW 358
            W
Sbjct: 647 FW 648

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/297 (21%), Positives = 113/297 (38%), Gaps = 38/297 (12%)

Query: 291 GHTDGVKTLYFDEAK--LVTGSLDKTIRVWNY----KTGECISTYRGHTDSVMSV----- 339
           GH+D + +L   E    L T S DKT  +W++    K     +T+ GH  SV +V     
Sbjct: 388 GHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNV 447

Query: 340 --DAFKKIIVSGSADKTVKIWHVE-------------SRTCYTLRGHTEWVNCVKLHPKS 384
               + K I++ S D TVK W +                + YT   H + +N + + P  
Sbjct: 448 MEKNYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPND 507

Query: 385 FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDD 444
               + S D T ++W++ T   +     H   +  V   +  ++E  +      +  GD 
Sbjct: 508 SIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDV---SFCESEKWI-----ATCSGDK 559

Query: 445 EPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQF 504
                             +    Q     +     L+S   D  IK+WD+ +G CI+   
Sbjct: 560 TVKIWSLESFTVLKTLEGHTNAVQRC-SFMNKQKQLVSAGADGLIKVWDIASGDCIKNLD 618

Query: 505 GHVEGVWDIAA--DNFRIISGSHDGSIKIW-DLQSGKCMHTFHGKRLQPQDEEGSTH 558
           GH   +W ++   D   IIS   D   + W D    +        +++ + E+  T+
Sbjct: 619 GHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVEQEQSLTN 675

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 93/236 (39%), Gaps = 57/236 (24%)

Query: 326 ISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVE--SRTCY---TLRGHTEWVNCV 378
           ++ Y GH+D + S+   +  + + + S DKT  +WH    S+  Y   T  GH   V+ V
Sbjct: 383 VNLYEGHSDLLNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAV 442

Query: 379 -------KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENL 431
                  K +PK     + S+D T++ W+I         +  + +V  ++  +I      
Sbjct: 443 CLPNVMEKNYPKYI--ITASNDLTVKKWEIPP------MKNDLNEVPFIVKSSI------ 488

Query: 432 VVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKL 491
                                            E++       P  +   + S D T KL
Sbjct: 489 ---------------------------YTRHAHEKDINAISMAPNDSIFATASYDKTCKL 521

Query: 492 WDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           W+V TG+ + T   H  G+WD++       I + S D ++KIW L+S   + T  G
Sbjct: 522 WNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSLESFTVLKTLEG 577

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/188 (18%), Positives = 78/188 (41%), Gaps = 20/188 (10%)

Query: 256 VLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAK-----LVTG 309
           V+T      L+  G  D ++ + D+ +  +     GH   + +L ++ E       L +G
Sbjct: 108 VMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTNIWLLGSG 167

Query: 310 SLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI------IVSGSADKTVKIWHV--- 360
             +   +VW+  T +C  T + H+ ++  +D  K        +++G  D  + +W     
Sbjct: 168 DTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNVLNLWRFNIK 227

Query: 361 --ESRTCYTLRGHTEWVNCVKL-HPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQ- 416
              S+   T+  H +   C  + H      ++   D   ++ D+  +S +K  +  + + 
Sbjct: 228 GKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLNESSVVKCTKKPIEEL 287

Query: 417 -VQKVIPL 423
            +  VIP+
Sbjct: 288 FITGVIPI 295

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 38/83 (45%), Gaps = 1/83 (1%)

Query: 464 DEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRT-QFGHVEGVWDIAADNFRIIS 522
           DE+  T     P   +L+  S    +K+ +V+TG   R+ +      V      +  +  
Sbjct: 61  DEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKVSSPSYVMTCDPTSTLVAI 120

Query: 523 GSHDGSIKIWDLQSGKCMHTFHG 545
           G  DGSI + D+++G   H+F G
Sbjct: 121 GGTDGSITVIDIENGYIAHSFKG 143

>CAGL0K09284g 914937..917672 highly similar to sp|P25635
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 79/160 (49%), Gaps = 7/160 (4%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKT 322
           L F  S    + +++  S   I +  GH D   +L +  D +++VT + D  I+VW+  +
Sbjct: 313 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVAS 372

Query: 323 GECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESRTCYTLRGHTEWV--NCV 378
           G C++T+  HT +V +V   KK  ++ S S D TV+ W +     + +   TE V   C+
Sbjct: 373 GFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCL 432

Query: 379 KLHPKSFTCFSGSDDT-TIRMWDIRTNSCLKVFRGHVGQV 417
            + P      +GS D+  + +W ++T   L    GH G V
Sbjct: 433 AVEPSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPV 472

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 84/186 (45%), Gaps = 21/186 (11%)

Query: 250 KGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK-- 305
           +GH D   +L +  +   + T + D  + +WD+ S   +     HT  V  + F +    
Sbjct: 338 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFAKKGQV 397

Query: 306 LVTGSLDKTIRVWN---YKTGECISTYRGHTDSVMSVDAFKKIIVSGSADK-TVKIWHVE 361
           L + SLD T+R W+   Y+     +       + ++V+   +++ +GS D   V +W V+
Sbjct: 398 LFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFVWSVQ 457

Query: 362 S-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           + +   TL GH   V+C+    ++    S S D TIR+W I             G+ Q+V
Sbjct: 458 TGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSI------------FGRSQQV 505

Query: 421 IPLTII 426
            PL + 
Sbjct: 506 EPLEVF 511

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 491 LWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFH 544
           +++ Q+   I  Q GH +    +  + D  R+++ + DG IK+WD+ SG C+ TF 
Sbjct: 325 VYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFE 380

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 71/183 (38%), Gaps = 18/183 (9%)

Query: 358 WHVESRTCYTLR--GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           W  ES   Y L+  GH +  N +   P      + ++D  I++WD+ +  CL  F  H  
Sbjct: 328 WQSES---YILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTS 384

Query: 416 QVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIP 475
            V  V        + L   ++ G+    D                    E  Q    ++ 
Sbjct: 385 AVTAVQFAK--KGQVLFSASLDGTVRAWD-------LIRYRNFRVFTATERVQFTCLAVE 435

Query: 476 YPTHLLSCSLDNT--IKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKI 531
               ++S    ++  + +W VQTGQ + T  GH   V     + +N  + S S D +I+I
Sbjct: 436 PSGEVVSAGSTDSFDVFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRI 495

Query: 532 WDL 534
           W +
Sbjct: 496 WSI 498

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 3/78 (3%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIW 532
           P  + +++ + D  IK+WDV +G C+ T   H   V  +  A     + S S DG+++ W
Sbjct: 351 PDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFAKKGQVLFSASLDGTVRAW 410

Query: 533 DLQSGKCMHTFHG-KRLQ 549
           DL   +    F   +R+Q
Sbjct: 411 DLIRYRNFRVFTATERVQ 428

>Sklu_2160.3 YGL137W, Contig c2160 2536-4818 reverse complement
          Length = 760

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 78/157 (49%), Gaps = 13/157 (8%)

Query: 238 NWRKGNCQVQEFKGHMDGVLTLQFNYR---LLFTGSYDSTVAIWDLCSNKLIRRLSGH-T 293
           NW K     Q F+GH   V+ + FN +      +   D TV IW L        ++ H T
Sbjct: 7   NWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTAHET 66

Query: 294 DGVKTLYF----DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK---KII 346
            GV  + +    D+  L+T S D+++++W+Y+T  C++T  GH  +V S   F     II
Sbjct: 67  RGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANV-SYAIFHPSLPII 125

Query: 347 VSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHP 382
           +SGS D TVKIW+  + +   TL    E   CV  HP
Sbjct: 126 ISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHP 162

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 67/140 (47%), Gaps = 10/140 (7%)

Query: 274 TVAIWDLCSN-KLIRRLSGHTDGVKTLYF---DEAKLVTGSLDKTIRVWNYKTGECISTY 329
           T+ +W+   N  L +   GH   V  + F   D     +  LD T+++W+        T 
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 330 RGH-TDSVMSVDAF----KKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPK 383
             H T  V  VD +    K  +++ S D++VKIW  ++++C  TL GH   V+    HP 
Sbjct: 62  TAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPS 121

Query: 384 SFTCFSGSDDTTIRMWDIRT 403
                SGS+D T+++W+  T
Sbjct: 122 LPIIISGSEDGTVKIWNANT 141

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 68/141 (48%), Gaps = 22/141 (15%)

Query: 314 TIRVWNYKTGECIS-TYRGHTDSVMSVDAFK----KIIVSGSADKTVKIWHVESRTC-YT 367
           TI++WN++    +  T+ GH   VM V AF         S   D TVKIW +  ++  +T
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCV-AFNPKDPNTFASACLDHTVKIWSLGQQSPNFT 60

Query: 368 LRGH-TEWVNCVKLHPKSFTCF--SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI--- 421
           +  H T  VN V  +P     +  + SDD ++++WD +T SC+    GH+  V   I   
Sbjct: 61  MTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHP 120

Query: 422 PLTIIDAENLVVDNISGSNEG 442
            L II         ISGS +G
Sbjct: 121 SLPII---------ISGSEDG 132

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 77/196 (39%), Gaps = 53/196 (27%)

Query: 354 TVKIWHVESRTCY--TLRGHTEWVNCVKLHPKSFTCFSGS-DDTTIRMWDIRTNSCLKVF 410
           T+K+W+ E       T  GH  +V CV  +PK    F+ +  D T+++W +   S     
Sbjct: 2   TIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTM 61

Query: 411 RGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTL 470
             H                        G N  D  P                        
Sbjct: 62  TAH---------------------ETRGVNFVDYYPLQ---------------------- 78

Query: 471 DKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV-WDIAADNFR-IISGSHDGS 528
           DK  PY   L++ S D ++K+WD QT  C+ T  GH+  V + I   +   IISGS DG+
Sbjct: 79  DK--PY---LITSSDDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDGT 133

Query: 529 IKIWDLQSGKCMHTFH 544
           +KIW+  + K   T +
Sbjct: 134 VKIWNANTYKLEKTLN 149

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 34/74 (45%), Gaps = 5/74 (6%)

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCIRTQFGH-VEGV----WDIAADNFRIISGSHDGSIKI 531
           P    S  LD+T+K+W +       T   H   GV    +    D   +I+ S D S+KI
Sbjct: 35  PNTFASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKI 94

Query: 532 WDLQSGKCMHTFHG 545
           WD Q+  C+ T  G
Sbjct: 95  WDYQTKSCVATLEG 108

>CAGL0L10890g 1163084..1164457 highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein, start by similarity
          Length = 457

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 83/370 (22%), Positives = 139/370 (37%), Gaps = 126/370 (34%)

Query: 256 VLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKT 314
            L +  ++R +++GSYD  V  W++ S K+ ++ SGHT  VK + Y    ++V+   D++
Sbjct: 108 ALDVSDDFRHIYSGSYDGVVRTWNM-SGKVEKQYSGHTGAVKAVKYISNTRIVSAGNDRS 166

Query: 315 IRVW--------------------NYKTGECISTYRGHTDSVMSVD-AFKKIIVSGSADK 353
           +R+W                    N + G+ ++   GH   V+S+D A    I+S S D 
Sbjct: 167 LRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASNSRILSASYDN 226

Query: 354 TVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
           TV +W    +    +    E  N    + K  T        T++   IR  + L +   H
Sbjct: 227 TVALWSTIYKEMTAIDHLEEIQNP---NNKISTAAKKRRKLTLKDGTIRRRAPLSLLESH 283

Query: 414 VGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKS 473
            G V++VI                  + GD+                            +
Sbjct: 284 TGPVEQVI-----------------FDHGDN----------------------------T 298

Query: 474 IPYPTHLLSCSLDNTIKLWDVQTGQCIRTQ------------------------------ 503
           + Y     S S D+TIK WD+ T +CI T+                              
Sbjct: 299 VGY-----SVSQDHTIKTWDLVTARCIDTKTTSYPLLSIAQMPTLNLLACGSSVRHITLH 353

Query: 504 ---------------FGH---VEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
                           GH   V G+   + + + + S SHDG++K+WD++S   M+T   
Sbjct: 354 DPRVSSSAKITQKQLVGHKNFVVGLDTCSENEYLLCSASHDGTVKVWDVRSTSPMYTI-- 411

Query: 546 KRLQPQDEEG 555
            R  P  E+G
Sbjct: 412 TRQDPTVEKG 421

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 86/210 (40%), Gaps = 53/210 (25%)

Query: 249 FKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLC----------------SNKL----- 285
            +GH   V++L    N R+L + SYD+TVA+W                   +NK+     
Sbjct: 201 LEGHKAPVVSLDVASNSRIL-SASYDNTVALWSTIYKEMTAIDHLEEIQNPNNKISTAAK 259

Query: 286 -----------IRR------LSGHTDGVKTLYFDEAKLVTG---SLDKTIRVWNYKTGEC 325
                      IRR      L  HT  V+ + FD      G   S D TI+ W+  T  C
Sbjct: 260 KRRKLTLKDGTIRRRAPLSLLESHTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTARC 319

Query: 326 ISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIW--HVESRTCYT---LRGHTEWVNCV 378
           I T +  +  ++S+       ++  GS+ + + +    V S    T   L GH  +V  +
Sbjct: 320 IDT-KTTSYPLLSIAQMPTLNLLACGSSVRHITLHDPRVSSSAKITQKQLVGHKNFVVGL 378

Query: 379 KL-HPKSFTCFSGSDDTTIRMWDIRTNSCL 407
                  +   S S D T+++WD+R+ S +
Sbjct: 379 DTCSENEYLLCSASHDGTVKVWDVRSTSPM 408

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 79/222 (35%), Gaps = 55/222 (24%)

Query: 373 EWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLT---IIDAE 429
           +WV+ + +       +SGS D  +R W++ +    K + GH G V+ V  ++   I+ A 
Sbjct: 104 DWVSALDVSDDFRHIYSGSYDGVVRTWNM-SGKVEKQYSGHTGAVKAVKYISNTRIVSAG 162

Query: 430 N--------LVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLL 481
           N           D+ S SN   DE                 +     +LD  +   + +L
Sbjct: 163 NDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLD--VASNSRIL 220

Query: 482 SCSLDNTIKLW--------------DVQTG---------------------------QCI 500
           S S DNT+ LW              ++Q                               +
Sbjct: 221 SASYDNTVALWSTIYKEMTAIDHLEEIQNPNNKISTAAKKRRKLTLKDGTIRRRAPLSLL 280

Query: 501 RTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHT 542
            +  G VE V     DN    S S D +IK WDL + +C+ T
Sbjct: 281 ESHTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTARCIDT 322

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 463 NDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-ADNFRII 521
           ND+    LD S  +  H+ S S D  ++ W++ +G+  +   GH   V  +    N RI+
Sbjct: 102 NDDWVSALDVSDDF-RHIYSGSYDGVVRTWNM-SGKVEKQYSGHTGAVKAVKYISNTRIV 159

Query: 522 SGSHDGSIKIW 532
           S  +D S+++W
Sbjct: 160 SAGNDRSLRLW 170

>AEL269C [2236] [Homologous to ScYPR178W (PRP4) - SH]
           (134760..136127) [1368 bp, 455 aa]
          Length = 455

 Score = 71.2 bits (173), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 52/169 (30%), Positives = 83/169 (49%), Gaps = 12/169 (7%)

Query: 240 RKGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK 297
           RK   Q+QE  GH   V T+ F  +  LL +   D+  AIWDL S + I +L GH   + 
Sbjct: 287 RKVELQLQE--GHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAIS 344

Query: 298 TLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK----IIVSGSA 351
            + +  +  +L T   D T+RVW+ +     S    H  + + V  FKK     +VS   
Sbjct: 345 GVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDV-KFKKNNGTFLVSCGH 403

Query: 352 DKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
           D+ V I++ ++ +   +L GHT+ V  V +     T +SG  D +++ W
Sbjct: 404 DRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 108/263 (41%), Gaps = 66/263 (25%)

Query: 280 LCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKT-GECISTYRGHTDSVMS 338
           L ++K + +++ H DG         +L TG    +I+V + +T G   S    H   +  
Sbjct: 169 LVADKHVSQVAVHRDG--------QQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGG 220

Query: 339 VD--AFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTI 396
           +D       ++SG  D  VK+W + S +   LRGH   V+ VK+HP      S S D T 
Sbjct: 221 LDWHPDGNHLLSGGGDNLVKLWDMTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTW 280

Query: 397 RMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXX 456
            +WD+                ++ + L + +  +  V  I+  ++G              
Sbjct: 281 ILWDL----------------ERKVELQLQEGHSKAVYTIAFQSDG-------------- 310

Query: 457 XXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH---VEGVWDI 513
                                  L S  LD    +WD+++G+ I    GH   + GV D 
Sbjct: 311 ---------------------ALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGV-DW 348

Query: 514 AADNFRIISGSHDGSIKIWDLQS 536
           + + +++ +   DG++++WD+++
Sbjct: 349 SPNGYQLATAGADGTVRVWDIRN 371

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/275 (22%), Positives = 100/275 (36%), Gaps = 60/275 (21%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTG 323
           L +G  D+ V +WD+ SN     L GH   V  +    +     + S D T  +W+ +  
Sbjct: 230 LLSGGGDNLVKLWDMTSNSF-EELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERK 288

Query: 324 ECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVK 379
             +    GH+ +V ++ AF+    ++ S   D    IW + S      L GH   ++ V 
Sbjct: 289 VELQLQEGHSKAVYTI-AFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVD 347

Query: 380 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS 439
             P  +   +   D T+R+WDIR          H     +V  L +   +N         
Sbjct: 348 WSPNGYQLATAGADGTVRVWDIRNVGTESALLAH-----QVAALDVKFKKN--------- 393

Query: 440 NEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQC 499
                                      N T          L+SC  D  + +++    Q 
Sbjct: 394 ---------------------------NGTF---------LVSCGHDRLVNIFNADNWQK 417

Query: 500 IRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIW 532
           + +  GH + V+  DI  D   I SG  D S+K W
Sbjct: 418 LASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 62/177 (35%), Gaps = 54/177 (30%)

Query: 371 HTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAEN 430
           H   +  +  HP      SG  D  +++WD+ +NS  +  RGH G+V +V          
Sbjct: 214 HEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNS-FEELRGHAGRVSRV---------- 262

Query: 431 LVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIK 490
                                                    K  P      S S D T  
Sbjct: 263 -----------------------------------------KVHPSGRLAASASFDLTWI 281

Query: 491 LWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           LWD++    ++ Q GH + V+ IA  +D   + S   D    IWDL+SG+ +    G
Sbjct: 282 LWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEG 338

>YLR129W (DIP2) [3539] chr12 (399658..402489) Component of U3 snoRNP
           (renamed small subunit processome - SSU processome),
           which is required for 18S rRNA biogenesis [2832 bp, 943
           aa]
          Length = 943

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/293 (22%), Positives = 110/293 (37%), Gaps = 75/293 (25%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV---KTLYFDEAKLVTGSLDKTIRVWNYK 321
           L+  G+ +  + ++DL S+ L+  +    D       L  D  +LVTGS DKT++ W++K
Sbjct: 444 LVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFK 503

Query: 322 T---------GECISTYRGHTDSVMS---------VDAFKKIIVSGSADKTVKIWHVESR 363
                      + +   + H D+ +          V    + +     D TVK++ ++S 
Sbjct: 504 VENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLDSM 563

Query: 364 TCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP 422
             Y +L GH   V  + +   S    + S D  I++W +    C K    H   +  V  
Sbjct: 564 KFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV-- 621

Query: 423 LTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLS 482
                                                            K +P   +  S
Sbjct: 622 -------------------------------------------------KFLPQSHNFFS 632

Query: 483 CSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWD 533
           CS D  +K WD +  +CI+  + H   VW   +A D   ++S SHD SI+IW+
Sbjct: 633 CSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 83/182 (45%), Gaps = 21/182 (11%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDL---------CSNKLIRRLSGHTDGVKTLY------- 300
           L L  + + L TGS D TV  WD            NK +  L  H D    L        
Sbjct: 479 LDLTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVR 538

Query: 301 --FDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD-AF-KKIIVSGSADKTVK 356
              D+  L    LD T++V+   + +   +  GH   V+S+D +F  K+I++ SADK +K
Sbjct: 539 VSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIK 598

Query: 357 IWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           IW ++   C+ +L  H + +  VK  P+S   FS S D  ++ WD     C++    H  
Sbjct: 599 IWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQS 658

Query: 416 QV 417
           +V
Sbjct: 659 EV 660

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 3/116 (2%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD-EAK 305
           F GH   +  LQF+     L +GS DS + +WDL     + +L  H D +   +   E  
Sbjct: 117 FNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDW 176

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVE 361
           L++ S D  I++W+ KT +CI T+  HT     +     ++++   D  VKIW ++
Sbjct: 177 LISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLD 232

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 78/184 (42%), Gaps = 16/184 (8%)

Query: 233 FKVESNWRKG--NCQVQEFKGHMDGVLTLQFNY---------RLLFTGSYDSTVAIWDLC 281
           FKVE++   G  N  +   K H D  L L  +          R L     D+TV ++ L 
Sbjct: 502 FKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVSPDDRYLAISLLDNTVKVFFLD 561

Query: 282 SNKLIRRLSGHTDGVKTL--YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV 339
           S K    L GH   V ++   FD   ++T S DK I++W    G+C  +   H DS+M+V
Sbjct: 562 SMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNV 621

Query: 340 DAFKKI--IVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTI 396
               +     S S D  VK W  E   C   L  H   V  + +        S S D +I
Sbjct: 622 KFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSI 681

Query: 397 RMWD 400
           R+W+
Sbjct: 682 RIWE 685

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 71/159 (44%), Gaps = 18/159 (11%)

Query: 275 VAIWDLCSNKLIRRLS-----GHTDG-----VKTLYFDEAK----LVTGSLDKTIRVWNY 320
           V IWD+ +  L+ +LS     G +D       +  Y +  K    L  G  D  I+VW+ 
Sbjct: 49  VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDL 108

Query: 321 KTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNC 377
            +   +  + GH  ++  +  D     ++SGS D  + +W +      Y LR H + +  
Sbjct: 109 MSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITG 168

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
                + +   S S D  I++WD++T+ C++    H G+
Sbjct: 169 FWCQGEDW-LISTSKDGMIKLWDLKTHQCIETHIAHTGE 206

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 64/141 (45%), Gaps = 6/141 (4%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKLVTGSLDKTIRVWNYKT 322
           LL  G  D  + +WDL S  ++   +GH   +  L FD    +L++GS D  I VW+   
Sbjct: 93  LLAVGYADGVIKVWDLMSKTVLLNFNGHKAAITLLQFDGTGTRLISGSKDSNIIVWDLVG 152

Query: 323 GECISTYRGHTDSVMSV-DAFKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKL 380
              +   R H DS+       +  ++S S D  +K+W +++  C  T   HT    C  L
Sbjct: 153 EVGLYKLRSHKDSITGFWCQGEDWLISTSKDGMIKLWDLKTHQCIETHIAHTG--ECWGL 210

Query: 381 HPKSFTCFSGSDDTTIRMWDI 401
             K     +   D+ +++W +
Sbjct: 211 AVKDDLLITTGTDSQVKIWKL 231

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 534
           L+S S D  IKLWD++T QCI T   H    W +A  +  +I+   D  +KIW L
Sbjct: 177 LISTSKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKL 231

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/244 (21%), Positives = 100/244 (40%), Gaps = 43/244 (17%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVE 361
           D+ KL+  + + ++++WN KT +CI T+               +++ G+ +  ++++ + 
Sbjct: 401 DDNKLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLA 460

Query: 362 SRTCY-TLR-GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 419
           S +   T+   H   +  + L        +GS D T++ WD +  + L       G   K
Sbjct: 461 SSSLLDTIEDAHDAAIWSLDLTSDGKRLVTGSADKTVKFWDFKVENSLVP-----GTKNK 515

Query: 420 VIPLTII--DAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYP 477
            +P+  +  D    + D+I                                   +  P  
Sbjct: 516 FLPVLKLHHDTTLELTDDI--------------------------------LCVRVSPDD 543

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQ 535
            +L    LDNT+K++ + + +   + +GH   V   DI+ D+  II+ S D +IKIW L 
Sbjct: 544 RYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIWGLD 603

Query: 536 SGKC 539
            G C
Sbjct: 604 FGDC 607

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 7/69 (10%)

Query: 478 THLLSCSLDNTIKLWDVQTGQC----IRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWD 533
           T L+S S D+ I +WD+  G+     +R+    + G W    D   +IS S DG IK+WD
Sbjct: 134 TRLISGSKDSNIIVWDL-VGEVGLYKLRSHKDSITGFWCQGED--WLISTSKDGMIKLWD 190

Query: 534 LQSGKCMHT 542
           L++ +C+ T
Sbjct: 191 LKTHQCIET 199

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 34/65 (52%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKC 539
           LL+ + + ++K+W+++T +CIRT                 +I G+ +G ++++DL S   
Sbjct: 405 LLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSL 464

Query: 540 MHTFH 544
           + T  
Sbjct: 465 LDTIE 469

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 15/85 (17%)

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCI-RTQFGHVEGVWDIAA-------------DNFRIIS 522
           P  L++ +L++ + +WD++TG  + +   G   G  D                D   +  
Sbjct: 38  PGQLITSALED-VNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAV 96

Query: 523 GSHDGSIKIWDLQSGKCMHTFHGKR 547
           G  DG IK+WDL S   +  F+G +
Sbjct: 97  GYADGVIKVWDLMSKTVLLNFNGHK 121

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 26/33 (78%), Gaps = 1/33 (3%)

Query: 512 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 544
           DI+ DN ++++ + +GS+KIW++++ KC+ TF 
Sbjct: 398 DISDDN-KLLATASNGSLKIWNIKTHKCIRTFE 429

>Scas_720.83d
          Length = 915

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 78/160 (48%), Gaps = 7/160 (4%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKT 322
           L F  S    + +++  S   I +  GH D   +L +  D +++VT + D  I+VW+  +
Sbjct: 315 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVS 374

Query: 323 GECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESRTCYTLRGHTEWV--NCV 378
           G C++T++ HT SV  V   K+  ++ S S D TV+ W +     +      E +  NC+
Sbjct: 375 GFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCL 434

Query: 379 KLHPKSFTCFSGS-DDTTIRMWDIRTNSCLKVFRGHVGQV 417
            + P      +GS D+  I +W ++T   L    GH G V
Sbjct: 435 AVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPV 474

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 83/185 (44%), Gaps = 21/185 (11%)

Query: 250 KGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK-- 305
           +GH D   +L +  +   + T + D  + +WD+ S   +     HT  V  + F +    
Sbjct: 340 QGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQV 399

Query: 306 LVTGSLDKTIRVWN---YKTGECISTYRGHTDSVMSVDAFKKIIVSGSADK-TVKIWHVE 361
           L + SLD T+R W+   Y+     +       + ++VD   +++ +GS D   + +W V+
Sbjct: 400 LFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQ 459

Query: 362 S-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           + +   TL GH   V+C+    ++    S S D T+R+W I             G+ Q+V
Sbjct: 460 TGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSI------------FGRSQQV 507

Query: 421 IPLTI 425
            P  +
Sbjct: 508 EPFDV 512

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 59/124 (47%), Gaps = 8/124 (6%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTD-GVKTLYFDEAK 305
           F+ H   V  +QF  R  +LF+ S D TV  WDL   +  R  +         L  D + 
Sbjct: 381 FQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDPSG 440

Query: 306 LV--TGSLDK-TIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHV 360
            V   GSLD   I VW+ +TG+ + T  GH   V  ++      ++ S S DKTV++W +
Sbjct: 441 EVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVWSI 500

Query: 361 ESRT 364
             R+
Sbjct: 501 FGRS 504

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 75/182 (41%), Gaps = 16/182 (8%)

Query: 358 WHVESRTCYTLR--GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           W  ES   Y L+  GH +  N +   P      + ++D  I++WD+ +  CL  F+ H  
Sbjct: 330 WQSES---YILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTS 386

Query: 416 QVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIP 475
            V +V        + L   ++ G+    D                  N      +D   P
Sbjct: 387 SVTQVQFAK--RGQVLFSSSLDGTVRAWDLIRYRNFRTFTAAERIQFN---CLAVD---P 438

Query: 476 YPTHLLSCSLDN-TIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 532
               + + SLDN  I +W VQTGQ + T  GH   V  +A   +N  + S S D ++++W
Sbjct: 439 SGEVVCAGSLDNFDIHVWSVQTGQLLDTLSGHEGPVSCLAFSQENSVLASASWDKTVRVW 498

Query: 533 DL 534
            +
Sbjct: 499 SI 500

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIW 532
           P  + +++ + D  IK+WDV +G C+ T   H   V  +  A     + S S DG+++ W
Sbjct: 353 PDGSRVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAW 412

Query: 533 DLQSGKCMHTF-HGKRLQ 549
           DL   +   TF   +R+Q
Sbjct: 413 DLIRYRNFRTFTAAERIQ 430

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 491 LWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFH 544
           +++ Q+   I  Q GH +    +  + D  R+++ + DG IK+WD+ SG C+ TF 
Sbjct: 327 VYEWQSESYILKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVVSGFCLATFQ 382

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV----WDIAADNFRIISGSHDG-SIKIWDL 534
           L S SLD T++ WD+   +  RT F   E +      +      + +GS D   I +W +
Sbjct: 400 LFSSSLDGTVRAWDLIRYRNFRT-FTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSV 458

Query: 535 QSGKCMHTFHG 545
           Q+G+ + T  G
Sbjct: 459 QTGQLLDTLSG 469

 Score = 30.4 bits (67), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/84 (22%), Positives = 35/84 (41%), Gaps = 6/84 (7%)

Query: 329 YRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESR----TCYTLRGHTEWVNCVKLHP 382
           + GH   ++S+      + I+S S D T +IW ++S        T  GH ++V       
Sbjct: 142 HAGHFQDILSLTWSLDSRFIISTSKDLTARIWSIDSEEKDLASMTFAGHRDYVMGAFFSA 201

Query: 383 KSFTCFSGSDDTTIRMWDIRTNSC 406
                ++ S D  + +W+    S 
Sbjct: 202 DQEKIYTVSKDGALFVWEFTKKST 225

>CAGL0M04279g 469040..471862 highly similar to sp|Q12220
           Saccharomyces cerevisiae YLR129w DIP2 DOM34P-interacting
           protein, start by similarity
          Length = 940

 Score = 71.2 bits (173), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 88/367 (23%), Positives = 136/367 (37%), Gaps = 94/367 (25%)

Query: 193 LHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGH 252
           LH +R   +++ SI   N      SNG L + W +      K +   R   C      G+
Sbjct: 384 LHGQRTD-IRSTSISDDNKLLATASNGSL-KIWNI------KTKRCIRSFEC------GY 429

Query: 253 MDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV---KTLYFDEAKLV 307
               LT +F     L+  G+ +  + ++D+ S+ ++    G  D       L  D  KLV
Sbjct: 430 ---ALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLV 486

Query: 308 TGSLDKTIRVWNYKTGEC-ISTYRGHT---------------DSVMSV--DAFKKIIVSG 349
           TGS DKT+R W ++  E  +S     T               D ++SV      K I   
Sbjct: 487 TGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVS 546

Query: 350 SADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
             D TVK++ ++S   + +L GH   V  + +   S    + S D  I++W +    C K
Sbjct: 547 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHK 606

Query: 409 VFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQ 468
               H   +  V                                                
Sbjct: 607 SLFAHQDSIMNV------------------------------------------------ 618

Query: 469 TLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA--DNFRIISGSHD 526
              K +P   +  SCS D T+K WD Q  +CI+    H   VW I+   D   +IS  HD
Sbjct: 619 ---KFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHD 675

Query: 527 GSIKIWD 533
            SI++W+
Sbjct: 676 HSIRVWE 682

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (52%), Gaps = 3/116 (2%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY-FDEAK 305
           F GH   +  L F+     L + S DS + +WDL     + +L  H D +  L+  DE  
Sbjct: 117 FNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENW 176

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVE 361
           L++ S D  +++W+ K+ +C+ T+  HT    S+   + + V+ SAD  VK+W ++
Sbjct: 177 LISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLD 232

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 66/143 (46%), Gaps = 10/143 (6%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYKT 322
           LL  G  D  + IWDL S  ++   +GH   +  L FD    +L++ S D  I VW+   
Sbjct: 93  LLAAGYADGVIKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVG 152

Query: 323 GECISTYRGHTDSVMSV---DAFKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCV 378
              +   R H D++  +   D  +  ++S S D  VKIW ++S+ C  T   HT    C 
Sbjct: 153 ESGLYKLRSHKDAITGLWCED--ENWLISTSKDGLVKIWDLKSQQCVETHLAHTG--ECW 208

Query: 379 KLHPKSFTCFSGSDDTTIRMWDI 401
            L        + S D+ +++W +
Sbjct: 209 SLGIIEDMAVTCSADSQVKLWKL 231

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/266 (19%), Positives = 107/266 (40%), Gaps = 23/266 (8%)

Query: 293 TDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSAD 352
           TD   T   D+ KL+  + + ++++WN KT  CI ++               ++V G+ +
Sbjct: 389 TDIRSTSISDDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRN 448

Query: 353 KTVKIWHVESRTCYTLR--GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI--------- 401
             ++++ + S T    +   H   +  + L        +GS D T+R W           
Sbjct: 449 GELQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSD 508

Query: 402 ---RTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXX 458
              +T   L++F     ++   I   +I  +    D     +  D+              
Sbjct: 509 ESNKTMPMLQLFHDTTLELDDDILSVVISPD----DKFIAVSLLDNTVKVFFLDSMKFFL 564

Query: 459 XXXXNDEENQTLDKSIPYPTHLL-SCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--A 515
               +     ++D  I Y + L+ +CS D  IK+W +  G C ++ F H + + ++    
Sbjct: 565 SLYGHKLPVLSMD--ISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLP 622

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMH 541
           +++   S S D ++K WD Q  +C+ 
Sbjct: 623 ESYNFFSCSKDATVKYWDGQKFECIQ 648

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 55/242 (22%), Positives = 95/242 (39%), Gaps = 54/242 (22%)

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESR 363
            +++ G L+  I VW+ KTGE I+     TD           +  G++D  +      S+
Sbjct: 39  GQVIVGGLE-NILVWDIKTGEQIAQL---TDG----------LPPGASDAKL------SK 78

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPL 423
              T          +K HP++    +G  D  I++WD+ + + L  F GH   +      
Sbjct: 79  PAET--------TFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGHKSAI------ 124

Query: 424 TIIDAENLVVDNISGSNEGD-------DEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPY 476
           T++  +      IS S + D        E                  ++EN         
Sbjct: 125 TVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENW-------- 176

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIW--DL 534
              L+S S D  +K+WD+++ QC+ T   H    W +       ++ S D  +K+W  DL
Sbjct: 177 ---LISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDL 233

Query: 535 QS 536
           Q+
Sbjct: 234 QA 235

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 7/69 (10%)

Query: 478 THLLSCSLDNTIKLWDVQTGQC----IRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWD 533
           T L+S S D+ I +WD+  G+     +R+    + G+W    D   +IS S DG +KIWD
Sbjct: 134 TRLISASKDSDIIVWDL-VGESGLYKLRSHKDAITGLW--CEDENWLISTSKDGLVKIWD 190

Query: 534 LQSGKCMHT 542
           L+S +C+ T
Sbjct: 191 LKSQQCVET 199

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 73/332 (21%), Positives = 120/332 (36%), Gaps = 44/332 (13%)

Query: 242 GNCQVQEFKGHMDGVLTLQ-FNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY 300
           G   + + + H D +  L   +   L + S D  V IWDL S + +     HT    +L 
Sbjct: 152 GESGLYKLRSHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLG 211

Query: 301 FDEAKLVTGSLDKTIRVWNYKTG-------------ECISTYRG-HTDSVMSVDAFKKII 346
             E   VT S D  +++W                  E  S  RG   D  ++ D  K   
Sbjct: 212 IIEDMAVTCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFY 271

Query: 347 VSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSC 406
           +  +ADKT++I        Y LR   E    +K   K         D  +   +I+    
Sbjct: 272 IQ-NADKTIEI--------YRLRKEEEISRALKKREKRL------QDKGMSEEEIKEAMG 316

Query: 407 LKV-FRGHVGQVQKVIPLTIIDAE---------NLVVDNISGSNEGDDEPXXXXXXXXXX 456
             V    H+ QV +  P  I  A+          LVV   + S E    P          
Sbjct: 317 SPVSLMYHLFQVVRS-PYKIKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQPA 375

Query: 457 XXXXXXNDEENQTLD---KSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI 513
                  D   Q  D    SI     LL+ + + ++K+W+++T +CIR+           
Sbjct: 376 PLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKF 435

Query: 514 AADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
                 ++ G+ +G ++++D+ S   +    G
Sbjct: 436 LPGGALVVVGTRNGELQLFDIASSTMLDNKEG 467

>Scas_631.17
          Length = 474

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 88/197 (44%), Gaps = 11/197 (5%)

Query: 245 QVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF- 301
           ++   +GH   V+ + F  + R + + S+D T  +WD+ S   ++   GH   V +L F 
Sbjct: 267 ELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQ 326

Query: 302 -DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIW 358
            D A L +G LD    VW+ +TG+ I   +GH   + SVD       I +G  D  + IW
Sbjct: 327 NDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIW 386

Query: 359 HVESRTCYT-LRGHTEWVNCVKLHPKSFTCF-SGSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
            +   T  T L  H   V  V+    +  C  S   D  IR++       +K   GH   
Sbjct: 387 DIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGH--- 443

Query: 417 VQKVIPLTIIDAENLVV 433
             K++ + I +   L+V
Sbjct: 444 TDKILDVDISEDAQLIV 460

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 99/247 (40%), Gaps = 61/247 (24%)

Query: 299 LYFDEAKLVTGSLDKTIRVWNYKTGECISTYR-GHTDSV--MSVDAFKKIIVSGSADKTV 355
           L  D A   TGS    I++ + KT + IS    GH   +  ++ ++    +VSG+ D  V
Sbjct: 194 LMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLV 253

Query: 356 KIWHVES-----RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
           KI   +      +    L+GHT  V  V  HP      S S D T R+WDI + + L+  
Sbjct: 254 KIHSFDPDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQ 313

Query: 411 RGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTL 470
            GH  +V                 ++S  N+G                            
Sbjct: 314 EGHGKEVY----------------SLSFQNDG---------------------------- 329

Query: 471 DKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGS 528
                    L S  LDN   +WDV+TG+ I    GH + ++  D + D + I +G  DG 
Sbjct: 330 -------ALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGV 382

Query: 529 IKIWDLQ 535
           I IWD++
Sbjct: 383 INIWDIR 389

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/280 (23%), Positives = 116/280 (41%), Gaps = 20/280 (7%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRL-SGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNY- 320
           L  TGS+   + I D  +  +I  + +GH   +  L ++     LV+G+ D  +++ ++ 
Sbjct: 200 LCATGSWAGDIKILDTKTLDVISGIENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFD 259

Query: 321 ---KTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIWHVESRTCYTLR-GHTEW 374
              K  + ++  +GHT  V++VD     + + S S D T ++W +ES T    + GH + 
Sbjct: 260 PDVKIIKELTALQGHTGRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKE 319

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVD 434
           V  +          SG  D    +WD+RT   +   +GH        P+  +D       
Sbjct: 320 VYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAK------PIYSVDWSPDGYH 373

Query: 435 NISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV 494
             +G  +G                    N        KS  +   L+SC  D  I+++  
Sbjct: 374 IATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHC--LVSCGYDKQIRIYSS 431

Query: 495 QTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIW 532
                ++T  GH + +   DI+ D   I+S   D S+K+W
Sbjct: 432 DNWIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLW 471

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 52/101 (51%), Gaps = 5/101 (4%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK---LVTGSLDKTIRVWNYKT 322
           + TG  D  + IWD+       RL  H + V  + F ++    LV+   DK IR+++   
Sbjct: 374 IATGGGDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDN 433

Query: 323 GECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVE 361
              + T  GHTD ++ VD  +  ++IVS   D+++K+W  E
Sbjct: 434 WIQVKTLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQE 474

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 532
           P    + S S D T +LWD+++   ++ Q GH + V+ ++   D   + SG  D +  +W
Sbjct: 285 PSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIVW 344

Query: 533 DLQSGKCMHTFHG 545
           D+++GK +    G
Sbjct: 345 DVRTGKSIMNLQG 357

>KLLA0C07425g complement(647673..649007) highly similar to sp|Q12024
           Saccharomyces cerevisiae YOR272w YTM1
           microtubule-interacting protein singleton, start by
           similarity
          Length = 444

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/352 (22%), Positives = 128/352 (36%), Gaps = 119/352 (33%)

Query: 254 DGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAKLVTGSLD 312
           D V +L      +++GSYD  V  ++L S K+ ++ SGH+  ++ + Y    +LV+   D
Sbjct: 104 DWVSSLDVGSNYIYSGSYDGIVRTYNL-SGKVEKQYSGHSGPIRAVHYISSTRLVSAGND 162

Query: 313 KTIRVWNYKT-------------GECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWH 359
           +T+R+W  K              G+ ++   GH   V+S+D  K  I+S S D TV +W 
Sbjct: 163 RTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCDNTVSLWS 222

Query: 360 VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 419
              +    +    +    V    K           T++   IR  + L +F  H   V+ 
Sbjct: 223 TNYKEMTVIDPMEDLGGNVSTAAKKRRKL------TLKDGSIRRRAPLALFESHSAPVEA 276

Query: 420 VIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTH 479
           VI                  ++ DD                            ++ Y   
Sbjct: 277 VI-----------------FDKSDD----------------------------TVGY--- 288

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQ------------------------------------ 503
             S S D+TIK WD+ T +C+ T+                                    
Sbjct: 289 --SVSQDHTIKTWDLITAKCVDTKTTSYSLLSVAQLPKLNLLACGSSARHITLHDPRVNS 346

Query: 504 ---------FGHVEGV--WDIAADN-FRIISGSHDGSIKIWDLQSGKCMHTF 543
                     GH   V   D   +N + I S SHDG++K+WD++S   M+T 
Sbjct: 347 SSKITQQQLVGHKNFVVALDTCPENEYMICSASHDGTVKVWDVRSNTAMYTI 398

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 70/330 (21%), Positives = 120/330 (36%), Gaps = 71/330 (21%)

Query: 218 NGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAI 277
           N + +R WK    +   ++    +    +   +GH   V+++  +   + + S D+TV++
Sbjct: 161 NDRTLRLWKTKNDDLKSIDEEEIEDGKTLAILEGHKAPVVSIDVSKDRILSASCDNTVSL 220

Query: 278 WDLCSNKL--IRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDS 335
           W     ++  I  +      V T      KL       T++  + +    ++ +  H+  
Sbjct: 221 WSTNYKEMTVIDPMEDLGGNVSTAAKKRRKL-------TLKDGSIRRRAPLALFESHSAP 273

Query: 336 VMSVDAFKK----IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGS 391
           V +V  F K    +  S S D T+K W + +  C   +  +  +  V   PK      GS
Sbjct: 274 VEAV-IFDKSDDTVGYSVSQDHTIKTWDLITAKCVDTKTTSYSLLSVAQLPKLNLLACGS 332

Query: 392 DDTTIRMWDIRTNSCLKVFRGH-VGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXX 450
               I + D R NS  K+ +   VG    V+ L                   D  P    
Sbjct: 333 SARHITLHDPRVNSSSKITQQQLVGHKNFVVAL-------------------DTCP---- 369

Query: 451 XXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCI----RTQFGH 506
                          EN+ +         + S S D T+K+WDV++   +    R     
Sbjct: 370 ---------------ENEYM---------ICSASHDGTVKVWDVRSNTAMYTITREDKNV 405

Query: 507 VEGVWDIA-----ADNFRIISGSHDGSIKI 531
           V+GV D       A    IISG  D  I+I
Sbjct: 406 VKGVNDKVFAVKWAKGVGIISGGQDKKIQI 435

>CAGL0L03201g complement(366795..368534) some similarities with
           sp|P47025 Saccharomyces cerevisiae YJL112w MDV1 or
           sp|P36130 Saccharomyces cerevisiae YKR036c CAF4 CCR4,
           hypothetical start
          Length = 579

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 88/208 (42%), Gaps = 40/208 (19%)

Query: 247 QEFKGHMDGVLTLQFNYRLLF---TGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +  K H D + +L  N +L     T + D+ + +WD+ + + +  LSGH   V T  F  
Sbjct: 274 KTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFID 333

Query: 302 DEAKLVTGSLDKTIRVW----------NYKTGECISTYRGHTDSVMSVDAFKKIIVSGSA 351
           D   L +   D +++VW          N     C++T+ GH DSV ++      IVSGS 
Sbjct: 334 DTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGSN 393

Query: 352 DKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFT----------------------CFS 389
           DKT++ W + S  C       +    +K+ P+S +                        +
Sbjct: 394 DKTLRHWDLGSGKCIQ---SIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDNALVT 450

Query: 390 GSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
           G+ D  + +WD+R    +    GH G +
Sbjct: 451 GTKDGIVYLWDLRIGRVVGSLEGHRGPI 478

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 67/292 (22%), Positives = 117/292 (40%), Gaps = 51/292 (17%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAKLV---TGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD 340
           +L + L  H D + +L  +    V   T +LD  I++W+  T +C+    GH  +V +  
Sbjct: 271 QLGKTLKCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTR 330

Query: 341 AF--KKIIVSGSADKTVKIWHVESRT-----------CYTLRGHTEWVNCVKLHPKSFTC 387
                +++ S   D +VK+W V++               T  GH + V    L       
Sbjct: 331 FIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTA--LATTGNAI 388

Query: 388 FSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPX 447
            SGS+D T+R WD+ +  C++            I LTI  A  +V  ++S   + D  P 
Sbjct: 389 VSGSNDKTLRHWDLGSGKCIQS-----------IDLTI--ALKMVPQSVS---KLDITPS 432

Query: 448 XXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHV 507
                                 +  +      L++ + D  + LWD++ G+ + +  GH 
Sbjct: 433 F-----------------NTPLIGGADCIDNALVTGTKDGIVYLWDLRIGRVVGSLEGHR 475

Query: 508 EGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEEGSTHL 559
             +  +      +I+GS D S +IWDL+ G        ++     EE  T L
Sbjct: 476 GPITSLKYMGSELITGSMDKSTRIWDLRMGSVAELLSFEKEVVSVEESQTQL 527

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/195 (25%), Positives = 81/195 (41%), Gaps = 35/195 (17%)

Query: 249 FKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCS----------NKLIRRLSGHTDGV 296
             GH   V T +F  + RLL +   D++V +WD+ +          N  +    GH D V
Sbjct: 319 LSGHRATVNTTRFIDDTRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSV 378

Query: 297 KTLYFDEAKLVTGSLDKTIRVWNYKTGECIS--------------------TYRGHTDSV 336
             L      +V+GS DKT+R W+  +G+CI                     T   +T  +
Sbjct: 379 TALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLI 438

Query: 337 MSVDAFKKIIVSGSADKTVKIWHVE-SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTT 395
              D     +V+G+ D  V +W +   R   +L GH   +  +K         +GS D +
Sbjct: 439 GGADCIDNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSEL--ITGSMDKS 496

Query: 396 IRMWDIRTNSCLKVF 410
            R+WD+R  S  ++ 
Sbjct: 497 TRIWDLRMGSVAELL 511

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 56/103 (54%), Gaps = 1/103 (0%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L TG+ D  V +WDL   +++  L GH   + +L +  ++L+TGS+DK+ R+W+ + G  
Sbjct: 448 LVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSELITGSMDKSTRIWDLRMG-S 506

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTL 368
           ++        V+SV+  +  +++    + VKI+    R   +L
Sbjct: 507 VAELLSFEKEVVSVEESQTQLINALEGEPVKIYDRGERQYNSL 549

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 67/171 (39%), Gaps = 31/171 (18%)

Query: 243 NCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRL------------- 289
           N  +  F GH D V  L      + +GS D T+  WDL S K I+ +             
Sbjct: 365 NLCLATFDGHKDSVTALATTGNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSV 424

Query: 290 -------SGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF 342
                  S +T  +      +  LVTG+ D  + +W+ + G  + +  GH   + S+   
Sbjct: 425 SKLDITPSFNTPLIGGADCIDNALVTGTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYM 484

Query: 343 KKIIVSGSADKTVKIWHV-----------ESRTCYTLRGHTEWVNCVKLHP 382
              +++GS DK+ +IW +           E          T+ +N ++  P
Sbjct: 485 GSELITGSMDKSTRIWDLRMGSVAELLSFEKEVVSVEESQTQLINALEGEP 535

>AGL196C [4116] [Homologous to ScYLR129W (DIP2) - SH]
           (328838..331645) [2808 bp, 935 aa]
          Length = 935

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 118/281 (41%), Gaps = 51/281 (18%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLS-GHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           L+  G+    + ++DL S+ ++  +   HT  + +L    D  +LVT S DKT++ W++K
Sbjct: 438 LVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFK 497

Query: 322 TGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLH 381
                                ++ +V+G+ DK V    +   T   L G   W  CVK+ 
Sbjct: 498 V--------------------EQELVAGTLDKFVPKMKLIHDTTLDL-GEDLW--CVKIS 534

Query: 382 PKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDN------ 435
           P+         D T++++ + +   +K F    G    V+ + I     L++ +      
Sbjct: 535 PEDRFLAVSLLDNTVKVFFLDS---MKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNI 591

Query: 436 -ISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV 494
            I G + GD                            K +P   +  SCS D T+K WD 
Sbjct: 592 KIWGLDFGDCHKSLFAHQDSIMNV-------------KFLPESHNFFSCSKDGTVKYWDG 638

Query: 495 QTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWD 533
            +  CI+  +GH   VW +A  +D   ++S SHD SI++W+
Sbjct: 639 NSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 84/182 (46%), Gaps = 21/182 (11%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDL---------CSNKLIRRLSGHTDGVKTLYFD----- 302
           L L  + + L T S D TV  WD            +K + ++    D    L  D     
Sbjct: 473 LDLTSDGKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVK 532

Query: 303 ----EAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF--KKIIVSGSADKTVK 356
               +  L    LD T++V+   + +   +  GH   V+S+D     K+I++ SADK +K
Sbjct: 533 ISPEDRFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIK 592

Query: 357 IWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           IW ++   C+ +L  H + +  VK  P+S   FS S D T++ WD  +  C++   GH G
Sbjct: 593 IWGLDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQG 652

Query: 416 QV 417
           +V
Sbjct: 653 EV 654

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 91/231 (39%), Gaps = 38/231 (16%)

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESR 363
            +++TG+L++ ++ W  KTGE + T R         D      +   A+K  +       
Sbjct: 35  GQVITGALEE-VKCWEIKTGELLKTMR---------DGLPPGAIDTKAEKPAE------- 77

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPL 423
                         ++ H ++F    G  D TI++WD++T + L VF  H   +      
Sbjct: 78  -----------ATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSSAI------ 120

Query: 424 TIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSC 483
           TI+  +      ISGS +                        ++            L+S 
Sbjct: 121 TILRFDQTGTRLISGSRDA----TIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISV 176

Query: 484 SLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 534
           S D  IKLWD++  QC+ T   H    W +A  +  +I+ + +  IK+W+L
Sbjct: 177 SKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWEL 227

 Score = 62.4 bits (150), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 84/170 (49%), Gaps = 10/170 (5%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK- 305
           F  H   +  L+F+     L +GS D+T+ +WDL +   + +L  H D +  ++ +    
Sbjct: 113 FHSHSSAITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDW 172

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVE---- 361
           L++ S D  I++W+ K  +C+ T+  HT    S+     ++++ +A+  +K+W ++    
Sbjct: 173 LISVSKDGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERP 232

Query: 362 SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFR 411
           + +    +G  E  +  +    SFT  +   D T   + + ++  +++FR
Sbjct: 233 NGSMLLEKGSYEKQSKQRCTELSFTTVA---DGTTFFYSLNSDKTMEIFR 279

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 75/158 (47%), Gaps = 15/158 (9%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYKT 322
           +L  G  D T+ IWD+ +  ++     H+  +  L FD+   +L++GS D TI +W+   
Sbjct: 89  ILAVGYADGTIKIWDMQTQTVLIVFHSHSSAITILRFDQTGTRLISGSRDATIILWDLVA 148

Query: 323 GECISTYRGHTDSVMSV----DAFKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNC 377
              +   R H D++  +    D +   ++S S D  +K+W ++   C  T   HT    C
Sbjct: 149 ETGLCKLRSHKDAITGIWCENDDW---LISVSKDGLIKLWDMKVHQCVETHMAHTG--EC 203

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDI---RTNSCLKVFRG 412
             L  K     + + ++ I++W++   R N  + + +G
Sbjct: 204 WSLAVKDNMVITANAESEIKLWELDLERPNGSMLLEKG 241

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 57/115 (49%), Gaps = 6/115 (5%)

Query: 251 GHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKL 306
           GH   VL++  ++  +L+ T S D  + IW L      + L  H D +  + F  +    
Sbjct: 565 GHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESHNF 624

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWH 359
            + S D T++ W+  + +CI    GH   V  ++V +  + +VS S D+++++W 
Sbjct: 625 FSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALAVSSDGQAVVSVSHDRSIRVWE 679

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 5/68 (7%)

Query: 478 THLLSCSLDNTIKLWDV--QTGQC-IRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 534
           T L+S S D TI LWD+  +TG C +R+    + G+W    ++  +IS S DG IK+WD+
Sbjct: 130 TRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIW--CENDDWLISVSKDGLIKLWDM 187

Query: 535 QSGKCMHT 542
           +  +C+ T
Sbjct: 188 KVHQCVET 195

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/240 (21%), Positives = 90/240 (37%), Gaps = 41/240 (17%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRT 364
           KL+  + +  ++VWN KT  CI                  +++ G+    ++++ + S T
Sbjct: 398 KLLATASNGNLKVWNIKTKTCIRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASST 457

Query: 365 CY--TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP 422
                   HT  +  + L        + S D T++ WD +    L       G + K +P
Sbjct: 458 MLENIEEAHTAAIWSLDLTSDGKRLVTASADKTVKFWDFKVEQELVA-----GTLDKFVP 512

Query: 423 -LTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLL 481
            + +I    L +                                E+    K  P    L 
Sbjct: 513 KMKLIHDTTLDLG-------------------------------EDLWCVKISPEDRFLA 541

Query: 482 SCSLDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGKC 539
              LDNT+K++ + + +   + +GH   V   DI+ D+  II+ S D +IKIW L  G C
Sbjct: 542 VSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDFGDC 601

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 15/82 (18%)

Query: 477 PTHLLSCSLDNTIKLWDVQTGQCIRT-QFGHVEGVWDIAAD-------------NFRIIS 522
           P  +++ +L+  +K W+++TG+ ++T + G   G  D  A+              F +  
Sbjct: 34  PGQVITGALEE-VKCWEIKTGELLKTMRDGLPPGAIDTKAEKPAEATYLQYHEETFILAV 92

Query: 523 GSHDGSIKIWDLQSGKCMHTFH 544
           G  DG+IKIWD+Q+   +  FH
Sbjct: 93  GYADGTIKIWDMQTQTVLIVFH 114

>Scas_558.3
          Length = 725

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 82/165 (49%), Gaps = 11/165 (6%)

Query: 251 GHMDGVLTLQFNY-RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV---KTLYFDEAKL 306
           GH   V  L + +   + +GS+D+T  +W   +  L   L GH   V   K +  +E   
Sbjct: 100 GHHSNVCALSYKHMSAIISGSWDTTAKVW--INGALQWSLEGHQASVWDAKIISVEENTF 157

Query: 307 VTGSLDKTIRVWNYKTGECISTYRG-HTDSVMSVDAFK--KIIVSGSADKTVKIWHVESR 363
           +T S D+T+++W  K  + + T+ G H+D + +++     K I + S D T+KI  ++  
Sbjct: 158 ITASADRTVKLW--KENKLLKTFSGIHSDVIRNIEVLSSGKEIATCSNDGTIKISDLDGN 215

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
               L GH  +V  VKL  +     S  +D ++R+WDI  N  +K
Sbjct: 216 IKQVLSGHESFVYNVKLSKQGDKLVSCGEDRSLRIWDINNNFNIK 260

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 79/169 (46%), Gaps = 14/169 (8%)

Query: 262 NYRLLFTGSYDST---VAIWDLCS--NKLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKTI 315
           ++ LLF    +S    V++ D+ S     +  L GH   V  L Y   + +++GS D T 
Sbjct: 66  DHELLFYSGQESLINGVSLLDIESIDKDPLYTLIGHHSNVCALSYKHMSAIISGSWDTTA 125

Query: 316 RVWNYKTGECISTYRGHTDSVMS---VDAFKKIIVSGSADKTVKIWHVESRTCYTLRG-H 371
           +VW    G    +  GH  SV     +   +   ++ SAD+TVK+W  E++   T  G H
Sbjct: 126 KVW--INGALQWSLEGHQASVWDAKIISVEENTFITASADRTVKLWK-ENKLLKTFSGIH 182

Query: 372 TEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           ++ +  +++        + S+D TI++ D+  N   +V  GH   V  V
Sbjct: 183 SDVIRNIEVLSSGKEIATCSNDGTIKISDLDGN-IKQVLSGHESFVYNV 230

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 61/265 (23%), Positives = 108/265 (40%), Gaps = 28/265 (10%)

Query: 284 KLIRRLSGHTDGVK-TLYFDEAKLVTGSLDKTIRVWNYK-TGECISTYRGHTDSVMSVDA 341
           +L   L GHT  VK  +  D++++ + S D T+R+W +   G         ++  ++   
Sbjct: 3   QLSATLLGHTQDVKDIVVIDDSQVASVSRDGTLRLWKHNDNGTWQDIVMATSEKFLNAVC 62

Query: 342 FKK----IIVSG--SADKTVKIWHVES---RTCYTLRGHTEWVNCVKLHPKSFTCFSGSD 392
           + K    +  SG  S    V +  +ES      YTL GH   V C   +       SGS 
Sbjct: 63  YDKDHELLFYSGQESLINGVSLLDIESIDKDPLYTLIGHHSNV-CALSYKHMSAIISGSW 121

Query: 393 DTTIRMWDIRTNSCLK-VFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXX 451
           DTT ++W    N  L+    GH   V         DA+ + V+  +      D       
Sbjct: 122 DTTAKVW---INGALQWSLEGHQASVW--------DAKIISVEENTFITASADRTVKLWK 170

Query: 452 XXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW 511
                      + +  + ++  +     + +CS D TIK+ D+  G   +   GH   V+
Sbjct: 171 ENKLLKTFSGIHSDVIRNIE-VLSSGKEIATCSNDGTIKISDLD-GNIKQVLSGHESFVY 228

Query: 512 DI--AADNFRIISGSHDGSIKIWDL 534
           ++  +    +++S   D S++IWD+
Sbjct: 229 NVKLSKQGDKLVSCGEDRSLRIWDI 253

>AER448W [2948] [Homologous to ScYKL213C (DOA1) - SH]
           complement(1497416..1499560) [2145 bp, 714 aa]
          Length = 714

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 82/175 (46%), Gaps = 17/175 (9%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV-KTLYFDEAKLV 307
             GH   V  L+     L + S+D T  +W   + +  R LSGH   V   L     + +
Sbjct: 104 LAGHSGNVCALEARDGQLVSSSWDQTARVWREGTEE--RALSGHNATVWHALALGYDRFL 161

Query: 308 TGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTC 365
           T S DKTI++W+      ++TY  HTD V  +++        S S D +VK+  ++ +T 
Sbjct: 162 TASADKTIKLWD--GARDLATYNVHTDVVRHLALAPDGHHFASCSNDGSVKVHTLDGKTV 219

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
            T  GH  +V CVK  P       G +D T+R+WD+          GHV QV ++
Sbjct: 220 RTFDGHESFVYCVKYLPDGGLVSCG-EDKTVRVWDM---------SGHVRQVIRL 264

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 92/244 (37%), Gaps = 44/244 (18%)

Query: 321 KTGECISTYRGHTDSVMSVDAFKKI-IVSGSADKTVKIWHVESR-----TCYTLRGHTEW 374
           K  E  S+  GH+  V SV A     I SGS D TV++W  ++      +   L     +
Sbjct: 6   KMYELSSSLLGHSMDVKSVVAISDTQIASGSRDGTVRVWTRDTSDSRLWSGAILHSTERY 65

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLT--IIDAENLV 432
           VN V        C+               N  L  F G    +  V PL   + DA  L+
Sbjct: 66  VNAV--------CY-------------EENEQLVFFGGQEAVIGAVSPLVLEVQDASYLL 104

Query: 433 VDNISG---SNEGDDEPXXXXXXXXXXXXXXXXNDEE-----NQTLDKSIPYP-THLLSC 483
             + SG   + E  D                   +E      N T+  ++       L+ 
Sbjct: 105 AGH-SGNVCALEARDGQLVSSSWDQTARVWREGTEERALSGHNATVWHALALGYDRFLTA 163

Query: 484 SLDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGKCMH 541
           S D TIKLWD    + + T   H + V    +A D     S S+DGS+K+  L  GK + 
Sbjct: 164 SADKTIKLWD--GARDLATYNVHTDVVRHLALAPDGHHFASCSNDGSVKVHTLD-GKTVR 220

Query: 542 TFHG 545
           TF G
Sbjct: 221 TFDG 224

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 64/168 (38%), Gaps = 54/168 (32%)

Query: 284 KLIRRLSGHTDGVKTLY-FDEAKLVTGSLDKTIRVWNYKTGECI--------STYR---- 330
           +L   L GH+  VK++    + ++ +GS D T+RVW   T +          ST R    
Sbjct: 9   ELSSSLLGHSMDVKSVVAISDTQIASGSRDGTVRVWTRDTSDSRLWSGAILHSTERYVNA 68

Query: 331 -------------------------------------GHTDSVMSVDAFKKIIVSGSADK 353
                                                GH+ +V +++A    +VS S D+
Sbjct: 69  VCYEENEQLVFFGGQEAVIGAVSPLVLEVQDASYLLAGHSGNVCALEARDGQLVSSSWDQ 128

Query: 354 TVKIWHVESRTCYTLRGHTEWV-NCVKLHPKSFTCFSGSDDTTIRMWD 400
           T ++W  E      L GH   V + + L    F   + S D TI++WD
Sbjct: 129 TARVWR-EGTEERALSGHNATVWHALALGYDRF--LTASADKTIKLWD 173

>Scas_679.28
          Length = 815

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (49%), Gaps = 3/115 (2%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIWH 359
           +++   T S DKT ++W+ + GE  +T   H   +  V    + K+I + S DKT+KIW 
Sbjct: 502 NDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWS 561

Query: 360 VESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
           +++ +   TL GHT  V       K     S   D  I++WD  T  CLK   GH
Sbjct: 562 LDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGH 616

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 64/122 (52%), Gaps = 7/122 (5%)

Query: 256 VLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDK 313
            L +  N  +  T SYD T  IWDL + +L   LS H  G+  + F   +  + T S DK
Sbjct: 496 ALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDK 555

Query: 314 TIRVWNYKTGECISTYRGHTDSV---MSVDAFKKIIVSGSADKTVKIWHVESRTCY-TLR 369
           TI++W+  T   + T  GHT++V   M ++   +++ SG AD  +KIW   +  C  TL 
Sbjct: 556 TIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSG-ADGLIKIWDCSTGDCLKTLD 614

Query: 370 GH 371
           GH
Sbjct: 615 GH 616

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 54/99 (54%), Gaps = 4/99 (4%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           +L+ T S D T+ IW L +  +++ L GHT+ V+   F   + +LV+   D  I++W+  
Sbjct: 546 KLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCS 605

Query: 322 TGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIW 358
           TG+C+ T  GH + + ++       +IVS  AD   + W
Sbjct: 606 TGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFW 644

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 97/275 (35%), Gaps = 37/275 (13%)

Query: 286 IRRLSGHTDGVKTL--YFDEAKLVTGSLDKTIRVWNYKT----GECISTYRGHTDSVMSV 339
           +    GH D + +L    D   + T S D T  VW Y +     +    + GH+ +V +V
Sbjct: 379 VEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKYNSIINKFQPYVKFIGHSATVTAV 438

Query: 340 D-------AFKKIIVSGSADKTVKIWHVESRTC-------------YTLRGHTEWVNCVK 379
                    + + +++ S D T+K W +   +              YT R H + +N + 
Sbjct: 439 GLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINALA 498

Query: 380 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS 439
           + P      + S D T ++WD+           H           + D      D +  +
Sbjct: 499 ISPNDSIFATASYDKTCKIWDLENGELTATLSNH--------KRGLWDVAFCQYDKLIAT 550

Query: 440 NEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQC 499
             GD                   +    Q     I     L+S   D  IK+WD  TG C
Sbjct: 551 CSGDKTIKIWSLDTFSVMKTLEGHTNAVQRC-MFINKQLQLVSSGADGLIKIWDCSTGDC 609

Query: 500 IRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIW 532
           ++T  GH   +W +    D   I+S   DG  + W
Sbjct: 610 LKTLDGHDNRIWALTEINDGDMIVSADADGVFQFW 644

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 79/338 (23%), Positives = 123/338 (36%), Gaps = 60/338 (17%)

Query: 255 GVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRR---------LSGHTDGVKTLYF---D 302
           GVL +  N ++    S D T+ + D+ SN L            ++G+   +  + F   +
Sbjct: 291 GVLPILENDKMYLVMS-DQTLELVDIKSNLLNESSDIIEIESCIAGNNGTIADMKFVGPN 349

Query: 303 EAKLVTGSLDKTIRVWNYKTGE------CISTYRGHTDSVMSVDAFKKII--VSGSADKT 354
             KL   +   T+R+    + E       +  Y GH D + S+D     +   + S D T
Sbjct: 350 HDKLALATNSPTLRIIPVPSSEQEELPINVEMYEGHEDLLNSLDTTDDGLWMATASKDHT 409

Query: 355 VKIWHVES-----RTCYTLRGHTEWVNCVKL-------HPKSFTCFSGSDDTTIRMWDIR 402
             +W   S     +      GH+  V  V L       +P+     + S+D TI+ W I 
Sbjct: 410 AIVWKYNSIINKFQPYVKFIGHSATVTAVGLPNVMLRGYPEFL--LTASNDLTIKKWKIP 467

Query: 403 TNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXX 462
             S          Q+ KV   T    E  +       N     P                
Sbjct: 468 KPS---TTVEEDCQIVKVSEYTRRAHEKDI-------NALAISPNDSIFATASYDKTCKI 517

Query: 463 NDEENQTLDKSIP-------------YPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEG 509
            D EN  L  ++              Y   + +CS D TIK+W + T   ++T  GH   
Sbjct: 518 WDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNA 577

Query: 510 VWDIAADN--FRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           V      N   +++S   DG IKIWD  +G C+ T  G
Sbjct: 578 VQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDG 615

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 80/204 (39%), Gaps = 32/204 (15%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLF--TGSYDSTVAIWDLCSNKLIRRLS------GHTDGVK 297
           V+ ++GH D + +L      L+  T S D T  +W    N +I +        GH+  V 
Sbjct: 379 VEMYEGHEDLLNSLDTTDDGLWMATASKDHTAIVWKY--NSIINKFQPYVKFIGHSATVT 436

Query: 298 TLYFDEAKL-------VTGSLDKTIRVWNYKTGEC----------ISTY--RGHTDSV-- 336
            +      L       +T S D TI+ W                 +S Y  R H   +  
Sbjct: 437 AVGLPNVMLRGYPEFLLTASNDLTIKKWKIPKPSTTVEEDCQIVKVSEYTRRAHEKDINA 496

Query: 337 MSVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTT 395
           +++     I  + S DKT KIW +E+     TL  H   +  V          + S D T
Sbjct: 497 LAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDKLIATCSGDKT 556

Query: 396 IRMWDIRTNSCLKVFRGHVGQVQK 419
           I++W + T S +K   GH   VQ+
Sbjct: 557 IKIWSLDTFSVMKTLEGHTNAVQR 580

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/182 (18%), Positives = 81/182 (44%), Gaps = 15/182 (8%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAK-----LVTGSLDKTIRVW 318
           L+  G  D ++ + D+ +  +   L GH   +  L +F +A      L +G  +  ++VW
Sbjct: 120 LVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVW 179

Query: 319 NYKTGECISTYRGHTDSVMSVDAFKK----IIVSGSADKTVKIWHVE-SRTCYTLRG--- 370
           +    +C+ T + H+++V  +D  +      ++SG  D    +W+    + C  L+    
Sbjct: 180 DLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKKCTLLKTIPV 239

Query: 371 HTEWVNCVKL-HPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAE 429
           H +  +C  + H      ++   D  ++   +   + +K  + H+ ++  +  L I++ +
Sbjct: 240 HQQVESCGFINHEHDDLIYTAGGDALLQFISLEKATMIKKTKKHIEELFIIGVLPILEND 299

Query: 430 NL 431
            +
Sbjct: 300 KM 301

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 486 DNTIKLWDVQTGQCIRTQFGHVEGVWDI-----AADNFRII-SGSHDGSIKIWDLQSGKC 539
           D +I + D++ G    +  GH   +  +     A  N  ++ SG  +G +K+WDL   KC
Sbjct: 127 DGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSGDTNGMVKVWDLVKRKC 186

Query: 540 MHTFH 544
           +HT  
Sbjct: 187 LHTMQ 191

>CAGL0A02772g complement(289274..290599) similar to sp|P40968
           Saccharomyces cerevisiae YDR364c CDC40, hypothetical
           start
          Length = 441

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 87/178 (48%), Gaps = 18/178 (10%)

Query: 246 VQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSN-KLIRRLSGHTDGVKTLYF 301
           +  +KGH +G  +L+       L+ +G  D+TV +WD   + K +R   GH+  +KTL F
Sbjct: 141 IYRYKGHHNGTTSLRLLPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDF 200

Query: 302 --DEAKLVTGSLDKTIRVWNYKTGEC---ISTYRGHTDSVMSVDAFKKIIVSGSADKTVK 356
             D ++ ++GS D+ +++W+ +TG+    ++TY     +     +  + +V  S+ K   
Sbjct: 201 TSDSSQFLSGSYDQQVKIWDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSK--- 257

Query: 357 IWHVESRT------CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
           I H ++R             H   +  +K  P      S S+D T+R+W+ + N  +K
Sbjct: 258 IKHYDTRVSEKDGLVQVYDHHLSSILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIK 315

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 4/70 (5%)

Query: 474 IPYPTHL-LSCSLDNTIKLWDV-QTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSI 529
           +P   HL LS   DNT+KLWD     +C+R   GH + +   D  +D+ + +SGS+D  +
Sbjct: 157 LPGTGHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQV 216

Query: 530 KIWDLQSGKC 539
           KIWD ++GK 
Sbjct: 217 KIWDTETGKV 226

>Kwal_33.15591
          Length = 714

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 76/154 (49%), Gaps = 10/154 (6%)

Query: 251 GHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV--KTLYFDEAKLVT 308
           GH + V  L  +   + +GS+D+T  +W      L   L GHT  V    +  +    +T
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASVWDVKMLPEVGFYMT 160

Query: 309 GSLDKTIRVWNYKTGECISTYRG-HTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTC 365
            S D TI++W  +  + + T+ G HTD +  + +DA  +   S S D TVKI  +E +T 
Sbjct: 161 ASADGTIKLWEGE--KVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDMEGKTL 218

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
            TL GH  +V  VK  P      S  +D T+R+W
Sbjct: 219 KTLVGHESFVYSVKFAPNG-DVISCGEDRTVRIW 251

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/204 (24%), Positives = 85/204 (41%), Gaps = 57/204 (27%)

Query: 331 GHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSG 390
           GH ++V  +++ +  ++SGS D T K+W  +    + L+GHT  V  VK+ P+     + 
Sbjct: 103 GHENNVCVLNSSQGYVLSGSWDTTAKVWF-QGALKHELKGHTASVWDVKMLPEVGFYMTA 161

Query: 391 SDDTTIRMWDIRTNSCLKVFRG-HVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXX 449
           S D TI++W+      LK F G H   ++ +              +I  S E        
Sbjct: 162 SADGTIKLWE--GEKVLKTFTGLHTDVIRHI--------------DIDASGE-------- 197

Query: 450 XXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEG 509
                                           SCS D T+K+ D++ G+ ++T  GH   
Sbjct: 198 -----------------------------KFASCSNDGTVKINDME-GKTLKTLVGHESF 227

Query: 510 VWDIA-ADNFRIISGSHDGSIKIW 532
           V+ +  A N  +IS   D +++IW
Sbjct: 228 VYSVKFAPNGDVISCGEDRTVRIW 251

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 289 LSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI--I 346
           L GH + V  L   +  +++GS D T +VW    G      +GHT SV  V    ++   
Sbjct: 101 LIGHENNVCVLNSSQGYVLSGSWDTTAKVW--FQGALKHELKGHTASVWDVKMLPEVGFY 158

Query: 347 VSGSADKTVKIWHVESRTCYTLRG-HTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
           ++ SAD T+K+W  E +   T  G HT+ +  + +        S S+D T+++ D+   +
Sbjct: 159 MTASADGTIKLWEGE-KVLKTFTGLHTDVIRHIDIDASGEKFASCSNDGTVKINDMEGKT 217

Query: 406 CLKVFRGH 413
            LK   GH
Sbjct: 218 -LKTLVGH 224

>Sklu_2172.6 YLR129W, Contig c2172 11261-12048 reverse complement
          Length = 263

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 62/116 (53%), Gaps = 3/116 (2%)

Query: 249 FKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD-EAK 305
           F GH   +  L+F+     L +GS DS + IWDL     + +L  H D +  ++ + E  
Sbjct: 113 FNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDW 172

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVE 361
           L++ S D  I++W+ KT +C+ T+  HT     +     ++++ S +  +KIW+++
Sbjct: 173 LISTSKDGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLD 228

 Score = 58.9 bits (141), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 68/141 (48%), Gaps = 6/141 (4%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYKT 322
           LL  G  D  + IWDL S  ++   +GH   +  L FD    +L++GS D  I +W+   
Sbjct: 89  LLAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVG 148

Query: 323 GECISTYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKL 380
              +   R H DS+  +    +  ++S S D  +KIW ++++ C  T   HT    C  L
Sbjct: 149 EVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQQCVETHMAHTS--ECWGL 206

Query: 381 HPKSFTCFSGSDDTTIRMWDI 401
              +    + S ++ I++W++
Sbjct: 207 AIHNDLVITTSTESQIKIWNL 227

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 68/163 (41%), Gaps = 10/163 (6%)

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNIS 437
           ++ HP++     G  D  I++WD+ + + L  F GH   +      T++  +      IS
Sbjct: 81  LQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKSAI------TVLRFDPTGTRLIS 134

Query: 438 GSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTG 497
           GS + D                      ++            L+S S D  IK+WD++T 
Sbjct: 135 GSKDSD----IIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSKDGLIKIWDLKTQ 190

Query: 498 QCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCM 540
           QC+ T   H    W +A  N  +I+ S +  IKIW+L   K M
Sbjct: 191 QCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDM 233

 Score = 48.5 bits (114), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 4/114 (3%)

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDS--VMSVDAFKKIIVSGSADKTVKIWHVESR 363
           L  G  D  I++W+  +   +  + GH  +  V+  D     ++SGS D  + IW +   
Sbjct: 90  LAVGYADGVIKIWDLISKTVLINFNGHKSAITVLRFDPTGTRLISGSKDSDIIIWDLVGE 149

Query: 364 T-CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
              Y LR H + +  +    + +   S S D  I++WD++T  C++    H  +
Sbjct: 150 VGLYKLRSHKDSITGIWCENEDW-LISTSKDGLIKIWDLKTQQCVETHMAHTSE 202

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (56%), Gaps = 7/72 (9%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQC----IRTQFGHVEGVWDIAADNFRIISGSHDGSIK 530
           P  T L+S S D+ I +WD+  G+     +R+    + G+W    +   +IS S DG IK
Sbjct: 127 PTGTRLISGSKDSDIIIWDL-VGEVGLYKLRSHKDSITGIW--CENEDWLISTSKDGLIK 183

Query: 531 IWDLQSGKCMHT 542
           IWDL++ +C+ T
Sbjct: 184 IWDLKTQQCVET 195

>KLLA0D16390g 1378884..1381694 similar to sp|Q12220 Saccharomyces
           cerevisiae YLR129w DIP2 DOM34P-interacting protein,
           start by similarity
          Length = 936

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 64/121 (52%), Gaps = 5/121 (4%)

Query: 246 VQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE 303
           + +F GH  GV  L+ +     L +GS DS + IWDL     + +L  H D +  ++ D 
Sbjct: 108 LMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDH 167

Query: 304 AK--LVTGSLDKTIRVWNYKTG-ECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV 360
               L++ + D  I+VW+ K G +C+ T+  HT    S+   +++I++ S D   KIW +
Sbjct: 168 NMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWEL 227

Query: 361 E 361
           +
Sbjct: 228 D 228

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 65/141 (46%), Gaps = 5/141 (3%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           R L     D+TV ++   S K    L GH   V ++ F  D   L+T S DK I++W   
Sbjct: 535 RYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGVD 594

Query: 322 TGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCV 378
            G+C  +   H DS+MSV  +A      S   D  VK W  +   C   L GH   V C+
Sbjct: 595 FGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWCI 654

Query: 379 KLHPKSFTCFSGSDDTTIRMW 399
            + P   T  S S D +IR+W
Sbjct: 655 AVSPDGRTVVSTSHDHSIRVW 675

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 96/232 (41%), Gaps = 39/232 (16%)

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESR 363
            KL+TG+L+  I++W  KT E              V+     +  G+ +  +    V + 
Sbjct: 34  GKLITGALE-NIQIWTLKTNE--------------VEVLTDGLPIGAVETNISKPSVVTA 78

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPL 423
            C+              H ++     G +D  I++WD+ + S L  F GH    +  + +
Sbjct: 79  MCF--------------HKETELLCVGYEDGVIKVWDLLSKSVLMQFNGH----KSGVTV 120

Query: 424 TIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSC 483
             +D+E   +  +SGS + D                   +      +D ++ +   L+S 
Sbjct: 121 LRLDSEGTRL--VSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDW---LISV 175

Query: 484 SLDNTIKLWDVQTG-QCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 534
           + D  IK+WD++ G QC+ T   H    W +A D   II+ S D   KIW+L
Sbjct: 176 AKDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWEL 227

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 82/188 (43%), Gaps = 33/188 (17%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGS------ 310
           L L  N + L TGS D +   WD    +++ +L     G K  Y  + KLV  +      
Sbjct: 470 LDLTSNGKRLVTGSADKSCKFWDF---EVVEQL---VPGTKDKYIPQLKLVHDTTLELTD 523

Query: 311 ------------------LDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGS 350
                             LD T++V+ + + +   +  GH   V+S+D     K++++ S
Sbjct: 524 DILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSS 583

Query: 351 ADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKV 409
           ADK +KIW V+   C+ ++  H + +  V+    +   FS   D  ++ WD     C++ 
Sbjct: 584 ADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQK 643

Query: 410 FRGHVGQV 417
             GH  +V
Sbjct: 644 LNGHQSEV 651

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 56/270 (20%), Positives = 110/270 (40%), Gaps = 13/270 (4%)

Query: 288 RLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKII 346
            L GH   ++++   D+ KL++ + +  ++VWN  T +CI T+         +     ++
Sbjct: 378 ELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTKKCIRTFSCGYALCSQMLPGGLLV 437

Query: 347 VSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
           V G+    ++++ + S T   T   HT  +  + L        +GS D + + WD     
Sbjct: 438 VVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEVVE 497

Query: 406 CL--KVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEG------DDEPXXXXXXXXXXX 457
            L       ++ Q++ V   T+   ++++   IS  +        D+             
Sbjct: 498 QLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSEDRYLAVSLLDNTVKVFFFDSLKFY 557

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AA 515
                +     ++D S+     L++ S D  IK+W V  G C ++ F H + +  +   A
Sbjct: 558 LSLYGHKLPVLSIDFSVD-SKMLITSSADKNIKIWGVDFGDCHKSIFAHQDSIMSVRFEA 616

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           D     S   DG++K WD     C+   +G
Sbjct: 617 DTHNFFSCGKDGAVKRWDGDKFDCIQKLNG 646

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 85/202 (42%), Gaps = 10/202 (4%)

Query: 208 ATNNTCTKDSNGKL--MRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRL 265
           ATN+T  K   G L  ++ W +   E   +      G  +    K  +   +       L
Sbjct: 28  ATNSTSGKLITGALENIQIWTLKTNEVEVLTDGLPIGAVETNISKPSVVTAMCFHKETEL 87

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYKTG 323
           L  G  D  + +WDL S  ++ + +GH  GV  L  D    +LV+GS D  + +W+    
Sbjct: 88  LCVGYEDGVIKVWDLLSKSVLMQFNGHKSGVTVLRLDSEGTRLVSGSKDSDLIIWDLVGE 147

Query: 324 ECISTYRGHTDSVMS--VDAFKKIIVSGSADKTVKIWHVES--RTCYTLRGHTEWVNCVK 379
             +   R H D++    +D     ++S + D  +K+W +++  +   T   HT    C  
Sbjct: 148 VGLMKLRSHKDAITGIWIDHNMDWLISVAKDGLIKVWDLKAGGQCVETHMAHTG--QCWS 205

Query: 380 LHPKSFTCFSGSDDTTIRMWDI 401
           +        + S D+  ++W++
Sbjct: 206 MAIDEEVIITTSMDSQAKIWEL 227

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 110/280 (39%), Gaps = 52/280 (18%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKT 322
           L+  G+    + ++DL S+ L+     HT  + +L    +  +LVTGS DK+ + W+++ 
Sbjct: 436 LVVVGTRQGELQLFDLASSTLLSTTEAHTAAIWSLDLTSNGKRLVTGSADKSCKFWDFEV 495

Query: 323 GECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHP 382
            E +                    V G+ DK +    +   T   L   T+ +  VK+  
Sbjct: 496 VEQL--------------------VPGTKDKYIPQLKLVHDTTLEL---TDDILAVKISS 532

Query: 383 KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI-IDAENLVVDN------ 435
           +         D T++++   +   LK +    G    V+ +   +D++ L+  +      
Sbjct: 533 EDRYLAVSLLDNTVKVFFFDS---LKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIK 589

Query: 436 ISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTH-LLSCSLDNTIKLWDV 494
           I G + GD                      ++  +       TH   SC  D  +K WD 
Sbjct: 590 IWGVDFGDCHKSIFA--------------HQDSIMSVRFEADTHNFFSCGKDGAVKRWDG 635

Query: 495 QTGQCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIW 532
               CI+   GH   VW IA   D   ++S SHD SI++W
Sbjct: 636 DKFDCIQKLNGHQSEVWCIAVSPDGRTVVSTSHDHSIRVW 675

>Kwal_26.8975
          Length = 445

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 126/318 (39%), Gaps = 48/318 (15%)

Query: 254 DGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAKLVTGSLD 312
           D V  L      + +GSYD  V  W+L S K+ ++ +GH+  V+ + Y    +LV+G+ D
Sbjct: 103 DWVSALDVGGDKIVSGSYDGIVRTWNL-SGKVEKQYAGHSGAVRAVKYISSTRLVSGAND 161

Query: 313 KTIRVWNYKT----------------GECISTYRGHTDSVMSVDAFKKIIVSGSADKTVK 356
           +T+R+W  K                 G+ ++    H   V++VD     I+SGS D ++ 
Sbjct: 162 RTLRLWKTKNDELKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISGSYDNSIG 221

Query: 357 IW---HVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
            W   H E      +      V+      +      GS         +R  S L +   H
Sbjct: 222 FWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGS---------VRRRSPLALLESH 272

Query: 414 VGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKS 473
              V++V    + D      D   G +   D                        +L + 
Sbjct: 273 TAPVEEV----LFD----FADKTVGYSVSQDHTIKTWDLVTARCVDTKSTSYSLLSLAQ- 323

Query: 474 IPYPTHLLSC-SLDNTIKLWDVQTGQCIRTQFGHVEG--VWDIAADN-----FRIISGSH 525
           +P   +LL+C S    I L D + G   +     + G   + +A D      + + SGSH
Sbjct: 324 LP-QLNLLACGSSARHITLHDPRVGSSTKITQQQLNGHKNFVVALDTCPEMEYMLCSGSH 382

Query: 526 DGSIKIWDLQSGKCMHTF 543
           DG++K+WD++S   M+T 
Sbjct: 383 DGTVKVWDVRSSAPMYTI 400

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/243 (24%), Positives = 105/243 (43%), Gaps = 56/243 (23%)

Query: 217 SNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFK------GHMDGVLTLQFNYRLLFTGS 270
           +N + +R WK    E   +++N       V+E K       H   V+T+  +   + +GS
Sbjct: 159 ANDRTLRLWKTKNDE---LKNNLAAEEDDVEEGKTLAILEAHKAPVVTVDVSGDRIISGS 215

Query: 271 YDSTVAIWD--------------LCSN-----KLIRRLS----------------GHTDG 295
           YD+++  W               L SN     K  RRL+                 HT  
Sbjct: 216 YDNSIGFWSTNHKEMTAVDPMDALGSNVSSAAKKRRRLALKDGSVRRRSPLALLESHTAP 275

Query: 296 VKTLYFDEAKLVTG---SLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGS 350
           V+ + FD A    G   S D TI+ W+  T  C+ T +  + S++S+    +  ++  GS
Sbjct: 276 VEEVLFDFADKTVGYSVSQDHTIKTWDLVTARCVDT-KSTSYSLLSLAQLPQLNLLACGS 334

Query: 351 ADKTVKIW--HVESRTCYT---LRGHTEWVNCVKLHPK-SFTCFSGSDDTTIRMWDIRTN 404
           + + + +    V S T  T   L GH  +V  +   P+  +   SGS D T+++WD+R++
Sbjct: 335 SARHITLHDPRVGSSTKITQQQLNGHKNFVVALDTCPEMEYMLCSGSHDGTVKVWDVRSS 394

Query: 405 SCL 407
           + +
Sbjct: 395 APM 397

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 43/83 (51%), Gaps = 13/83 (15%)

Query: 247 QEFKGHMDGVLTL----QFNYRLLFTGSYDSTVAIWDLCSNK---LIRRLSGHTDGVKTL 299
           Q+  GH + V+ L    +  Y +L +GS+D TV +WD+ S+     I R +    G+   
Sbjct: 355 QQLNGHKNFVVALDTCPEMEY-MLCSGSHDGTVKVWDVRSSAPMYTITREAEVVKGINDK 413

Query: 300 YFDE--AK---LVTGSLDKTIRV 317
            FD   AK   +++G  DK I++
Sbjct: 414 VFDVKWAKGLGIISGGQDKKIQI 436

>YLR222C (UTP13) [3622] chr12 complement(579320..581773) Component
           of U3 snoRNP (also called small subunit processome),
           which is required for 18S rRNA biogenesis,
           overproduction causes chromosome instability and
           increased mitotic recombination, contains WD (WD-40)
           repeats [2454 bp, 817 aa]
          Length = 817

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 57/115 (49%), Gaps = 3/115 (2%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIWH 359
           +++   T S DKT ++WN + GE  +T   H   +  V    + K++ + S DKTVKIW 
Sbjct: 502 NDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWS 561

Query: 360 VESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
           +++ +   TL GHT  V       K     S   D  I++WD  +  CLK   GH
Sbjct: 562 LDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGH 616

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 99/268 (36%), Gaps = 35/268 (13%)

Query: 291 GHTDGVKTLYFDEAKL--VTGSLDKTIRVWNYKTGEC----ISTYRGHTDSVMSVD---- 340
           GH D + +L   E  L   T S D T  VW Y    C     + Y GH+ +V +V     
Sbjct: 386 GHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAVGLPNI 445

Query: 341 ---AFKKIIVSGSADKTVKIWHVESRTC-----------YTLRGHTEWVNCVKLHPKSFT 386
               + + +++ S D T+K W +   T            YT   H + +N + + P    
Sbjct: 446 VSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSI 505

Query: 387 CFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEP 446
             + S D T ++W++           H           + D      D +  ++ GD   
Sbjct: 506 FATASYDKTCKIWNLENGELEATLANH--------KRGLWDVSFCQYDKLLATSSGDKTV 557

Query: 447 XXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH 506
                           +    Q     I     L+SC  D  IK+WD  +G+C++T  GH
Sbjct: 558 KIWSLDTFSVMKTLEGHTNAVQRC-SFINKQKQLISCGADGLIKIWDCSSGECLKTLDGH 616

Query: 507 VEGVWDIAA--DNFRIISGSHDGSIKIW 532
              +W ++   D   I+S   DG  + W
Sbjct: 617 NNRLWALSTMNDGDMIVSADADGVFQFW 644

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query: 239 WRKGNCQVQE-FKGHMDGVLTLQF-NY-RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDG 295
           W   N +++     H  G+  + F  Y +LL T S D TV IW L +  +++ L GHT+ 
Sbjct: 518 WNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNA 577

Query: 296 VKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSA 351
           V+   F   + +L++   D  I++W+  +GEC+ T  GH + + ++       +IVS  A
Sbjct: 578 VQRCSFINKQKQLISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADA 637

Query: 352 DKTVKIW 358
           D   + W
Sbjct: 638 DGVFQFW 644

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 97/244 (39%), Gaps = 33/244 (13%)

Query: 326 ISTYRGHTDSVMSVDAFKKI--IVSGSADKTVKIWHVESRTC-----YTLRGHTEWVNCV 378
           +  Y GH D + S+DA +    I + S D T  +W     +C         GH+  V  V
Sbjct: 381 VEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAV 440

Query: 379 KLH---PKSFTCF--SGSDDTTIRMWDI-RTNSCLKVFRGHVGQVQKVIPLTIIDAENLV 432
            L     K +  F  + S+D TI+ W I +  + + V      Q+ KV   T    E   
Sbjct: 441 GLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDV------QIIKVSEYTRHAHEK-- 492

Query: 433 VDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTL--------DKSI-PYPTHLLSC 483
            D  + S   +D                  N E   TL        D S   Y   L + 
Sbjct: 493 -DINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATS 551

Query: 484 SLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSGKCMH 541
           S D T+K+W + T   ++T  GH   V   +  N +  +IS   DG IKIWD  SG+C+ 
Sbjct: 552 SGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLISCGADGLIKIWDCSSGECLK 611

Query: 542 TFHG 545
           T  G
Sbjct: 612 TLDG 615

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 81/200 (40%), Gaps = 26/200 (13%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLF--TGSYDSTVAIW----DLCSNKLIRRLSGHTDGVKTL 299
           V+ ++GH D + +L      L+  T S D+T  +W    + C   +  +  GH+  V  +
Sbjct: 381 VEIYEGHEDLLNSLDATEDGLWIATASKDNTAIVWRYNENSCKFDIYAKYIGHSAAVTAV 440

Query: 300 YFDEAK-------LVTGSLDKTIRVWNYKTGEC--------ISTYRGHTD----SVMSVD 340
                        L+T S D TI+ W               +S Y  H      + +SV 
Sbjct: 441 GLPNIVSKGYPEFLLTASNDLTIKKWIIPKPTASMDVQIIKVSEYTRHAHEKDINALSVS 500

Query: 341 AFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
               I  + S DKT KIW++E+     TL  H   +  V          + S D T+++W
Sbjct: 501 PNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATSSGDKTVKIW 560

Query: 400 DIRTNSCLKVFRGHVGQVQK 419
            + T S +K   GH   VQ+
Sbjct: 561 SLDTFSVMKTLEGHTNAVQR 580

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 94/198 (47%), Gaps = 12/198 (6%)

Query: 255 GVLTLQFNYRLLFTGSYDSTVAIWDLC--SNKLIRRLSGHTDGVKT---LYFDEAKLVTG 309
            V T+  N ++L T   D  + I DL   S K++ ++S   +   T   L  D   L   
Sbjct: 21  AVATVSENGKILATPVLDE-INIIDLTPGSRKILHKISNEDEQEITALKLTPDGQYLTYV 79

Query: 310 SLDKTIRVWNYKTGECISTYRGHTDS-VMSVDAFKKIIVSGSADKTVKIWHVES-RTCYT 367
           S  + +++++ KTG+ + + +  + S ++  D+   ++  G  D ++ +  +E+    ++
Sbjct: 80  SQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAVGGTDGSIIVVDIENGYITHS 139

Query: 368 LRGHTEWVNCVK----LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPL 423
            +GH   ++ +K    L+ K +   SG  +  +++WD+    CL   + H   V+ +  +
Sbjct: 140 FKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDII 199

Query: 424 TIIDAENLVVDNISGSNE 441
            + D +   ++ +SG  +
Sbjct: 200 EVPDNDEPSLNLLSGGRD 217

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 60/145 (41%), Gaps = 18/145 (12%)

Query: 190 LPLLHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEF 249
           L + H+K  + V++  I + +     DS   L+    V   +   +  +   G      F
Sbjct: 85  LKIFHLKTGKVVRSMKISSPSYILDADSTSTLL---AVGGTDGSIIVVDIENGYI-THSF 140

Query: 250 KGHMDGVLTLQFNYRL------LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE 303
           KGH   + +L+F  +L      L +G  +  V +WDL   K +  L  HT  V+ L   E
Sbjct: 141 KGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIE 200

Query: 304 A--------KLVTGSLDKTIRVWNY 320
                     L++G  D  I +W++
Sbjct: 201 VPDNDEPSLNLLSGGRDDIINLWDF 225

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 1/83 (1%)

Query: 464 DEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRT-QFGHVEGVWDIAADNFRIIS 522
           DE+  T  K  P   +L   S    +K++ ++TG+ +R+ +      + D  + +  +  
Sbjct: 60  DEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISSPSYILDADSTSTLLAV 119

Query: 523 GSHDGSIKIWDLQSGKCMHTFHG 545
           G  DGSI + D+++G   H+F G
Sbjct: 120 GGTDGSIIVVDIENGYITHSFKG 142

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 6/73 (8%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGH------VEGVWDIAADNFRIISGSHDGSIKI 531
           T L     D +I + D++ G    +  GH      ++    + +  + + SG  +G +K+
Sbjct: 115 TLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASGDTNGMVKV 174

Query: 532 WDLQSGKCMHTFH 544
           WDL   KC+HT  
Sbjct: 175 WDLVKRKCLHTLQ 187

>CAGL0K00275g complement(25300..27447) similar to sp|P36037
           Saccharomyces cerevisiae YKL213c DOA1, hypothetical
           start
          Length = 715

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 77/155 (49%), Gaps = 11/155 (7%)

Query: 251 GHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV--KTLYFDEAKLVT 308
           GH   V  L+F   LL + S+D T  IWD  +NKL   L  H   V   T+  D+  ++T
Sbjct: 100 GHTGNVCGLRFQNGLLLSSSWDKTAKIWD--NNKLKYDLRNHEASVWDSTMVSDDI-ILT 156

Query: 309 GSLDKTIRVWNYKTGECISTYRG-HTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCY 366
            S DK+I VW    G+ I      H D +  ++     I  S S D T+K+ ++E     
Sbjct: 157 ASADKSIGVW--MEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKN 214

Query: 367 TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
              GH  +V CVK H  + T FS  +D+T+R+W I
Sbjct: 215 VFEGHESFVYCVK-HMNN-TLFSCGEDSTVRIWSI 247

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 106/265 (40%), Gaps = 34/265 (12%)

Query: 284 KLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKTIRVWN-YKTGECISTYRGHTDSVMSV-- 339
           +L   L GH+  VK +   ++ K+ + S D ++RVW    +G+        +D  ++   
Sbjct: 3   QLSATLRGHSQDVKDITAVNDNKIASVSRDGSLRVWTRSSSGDWEDVLVYQSDKFLNAVC 62

Query: 340 -DAFKKIIVSGSADKTVKIWHVE------SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSD 392
            D   + +  G  D  +   H+E      +   YTL GHT   N   L  ++    S S 
Sbjct: 63  YDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHTG--NVCGLRFQNGLLLSSSW 120

Query: 393 DTTIRMWDIRTNSCLKV-FRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXX 451
           D T ++WD   N+ LK   R H   V             +V D+I  +   D        
Sbjct: 121 DKTAKIWD---NNKLKYDLRNHEASVWD---------STMVSDDIILTASADKSIGVWME 168

Query: 452 XXXXXXXXXXXNDEENQTLDKSIPYPTH--LLSCSLDNTIKLWDVQTGQCIRTQFGHVEG 509
                      +D     + + + Y ++    SCS D TIKL +++ G+      GH   
Sbjct: 169 GKLIKKLSNIHDD-----VIRHLEYISNDIFASCSNDGTIKLLNLE-GEIKNVFEGHESF 222

Query: 510 VWDIAADNFRIISGSHDGSIKIWDL 534
           V+ +   N  + S   D +++IW +
Sbjct: 223 VYCVKHMNNTLFSCGEDSTVRIWSI 247

>Kwal_56.23920
          Length = 937

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 60/115 (52%), Gaps = 3/115 (2%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD-EAK 305
           F GH   +  L F+     L +GS DS + +WDL     + +L  H D +  L+ + E  
Sbjct: 113 FNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEW 172

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV 360
           L++ S D  I+VW+ K  +C+ T+  H     S+   + ++++  AD  +K+W++
Sbjct: 173 LISTSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNL 227

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 111/294 (37%), Gaps = 79/294 (26%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSG-HTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           L+  G+    + ++DL S+ L+  + G H+  + +L    D  +LVTGS DKT+  W+++
Sbjct: 438 LVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQ 497

Query: 322 TGECISTYRGHTDS--------------------VMSVDAFKKIIVSGSADKTVKIWHVE 361
             +      G TD                      + +    +++     D TVK++ ++
Sbjct: 498 VEQ--EPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMD 555

Query: 362 SRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           S   + +L GH   V  + +   S    + S D  I++W +    C +    H   + KV
Sbjct: 556 SMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKV 615

Query: 421 IPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHL 480
           +                                                    +P   + 
Sbjct: 616 V---------------------------------------------------FVPESHNF 624

Query: 481 LSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 532
            SCS D  +K WD    +CI+    H + VW +A  +D   ++S SHD SI++W
Sbjct: 625 FSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYK 321
           RLL  G  D  + IWDL S  ++   +GH   +  L FD+   +L++GS D  I VW+  
Sbjct: 88  RLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLV 147

Query: 322 TGECISTYRGHTDSVMSV-DAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVN-CVK 379
               +   R H DS+  +    ++ ++S S D  +K+W ++ + C  +  H   V  C  
Sbjct: 148 GEVGLYKLRSHKDSITGLWCEGEEWLISTSKDGLIKVWDLKVQQC--VETHVAHVGECWS 205

Query: 380 LHPKSFTCFSGSDDTTIRMWDI 401
           +        +   D  I++W++
Sbjct: 206 MGVHEDLVITAGADNQIKLWNL 227

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 81/182 (44%), Gaps = 21/182 (11%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDL---------CSNKLIRRLSGHTDGVKTL-------- 299
           L +  + + L TGS D TV  WD           ++K   +L    D    L        
Sbjct: 473 LDMTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVK 532

Query: 300 -YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD-AF-KKIIVSGSADKTVK 356
              D   L    LD T++V+   + +   +  GH   V+S+D +F  K++++ SADK +K
Sbjct: 533 ISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIK 592

Query: 357 IWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           IW ++   C+ +L  H + +  V   P+S   FS S D  ++ WD     C++    H  
Sbjct: 593 IWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQK 652

Query: 416 QV 417
           +V
Sbjct: 653 EV 654

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 69/153 (45%), Gaps = 7/153 (4%)

Query: 254 DGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL--YFDEAKLVTG 309
           D VL ++   + RLL     D+TV ++ + S K    L GH   V ++   FD   L+T 
Sbjct: 526 DDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITS 585

Query: 310 SLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI--IVSGSADKTVKIWHVESRTCYT 367
           S DK I++W    G+C  +   H DS+M V    +     S S D  VK W  +   C  
Sbjct: 586 SADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQ 645

Query: 368 -LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
            L  H + V  + +        S S D +IR+W
Sbjct: 646 KLAAHQKEVWTLAISSDGRFVVSASHDQSIRVW 678

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 94/233 (40%), Gaps = 42/233 (18%)

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVM--SVDAFKKIIVSGSADKTVKIWHVE 361
            +++TG+L+  +  W+ K+GE I T    TD +   +VDA           K+ K     
Sbjct: 35  GQVLTGALE-NVNCWSMKSGELIGTL---TDGLPPGAVDA-----------KSTK----P 75

Query: 362 SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI 421
           + T Y           ++ HP++     G +D  I++WD+ + S L  F GH   +    
Sbjct: 76  AETSY-----------LQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKSAI---- 120

Query: 422 PLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLL 481
             TI+  +      ISGS + D                      ++            L+
Sbjct: 121 --TILTFDQTGTRLISGSRDSD----IIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLI 174

Query: 482 SCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDL 534
           S S D  IK+WD++  QC+ T   HV   W +      +I+   D  IK+W+L
Sbjct: 175 STSKDGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNL 227

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 77/168 (45%), Gaps = 19/168 (11%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLS-----GHTDGVKT--------LYFDEAKLVT-GSL 311
           + TG+ ++ V  W + S +LI  L+     G  D   T         Y  E +L+  G  
Sbjct: 37  VLTGALEN-VNCWSMKSGELIGTLTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYN 95

Query: 312 DKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRT-CYTL 368
           D  I++W+  +   + ++ GH  ++  ++ D     ++SGS D  + +W +      Y L
Sbjct: 96  DGAIKIWDLLSKSVLISFNGHKSAITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKL 155

Query: 369 RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
           R H + +  +    + +   S S D  I++WD++   C++    HVG+
Sbjct: 156 RSHKDSITGLWCEGEEW-LISTSKDGLIKVWDLKVQQCVETHVAHVGE 202

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 97/223 (43%), Gaps = 16/223 (7%)

Query: 330 RGHTDSVMSVD-AFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCF 388
           RGH   V ++D +    +++ +++ T+KIW++++ +C         + C K  P      
Sbjct: 382 RGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSCIRTFECGYALAC-KFLPGGALVV 440

Query: 389 SGSDDTTIRMWDIRTNSCLKVFRG-HVGQVQKVIPLTIIDAENLVVDNISGSN------- 440
            G+    + ++D+ +++ L    G H G +  +   T  D + LV  +   +        
Sbjct: 441 LGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTT--DGKRLVTGSADKTVCFWDFQV 498

Query: 441 EGDDEPXXXXXXXXXXXXXXXXNDEENQ-TLDKSIPYPTHLLSCSL-DNTIKLWDVQTGQ 498
           E +  P                  E N   L   I     LL+ SL DNT+K++ + + +
Sbjct: 499 EQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNRLLAVSLLDNTVKVFFMDSMK 558

Query: 499 CIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKC 539
              + +GH   V   DI+ D+  +I+ S D +IKIW L  G C
Sbjct: 559 FFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDFGDC 601

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 128/307 (41%), Gaps = 54/307 (17%)

Query: 248 EFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLS-GHTDGVKTLYFDEA 304
           + +GH   V  +    + +LL T S + T+ IW++ +N  IR    G+    K L    A
Sbjct: 380 DIRGHRSDVRAIDISGDNKLLATAS-NGTLKIWNIKTNSCIRTFECGYALACKFLP-GGA 437

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRG-HTDSVMSVDAFK--KIIVSGSADKTVKIWHVE 361
            +V G+    + +++  +   ++T  G H+ ++ S+D     K +V+GSADKTV  W  +
Sbjct: 438 LVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTDGKRLVTGSADKTVCFWDFQ 497

Query: 362 SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI 421
                 + G T+     K +PK         DTT+ + D        V    +    +++
Sbjct: 498 VEQ-EPVPGTTD-----KFNPK----LKMFHDTTLELND-------DVLAVKISPDNRLL 540

Query: 422 PLTIID--AENLVVDNISG--SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYP 477
            ++++D   +   +D++    S  G   P                       L   I + 
Sbjct: 541 AVSLLDNTVKVFFMDSMKFFLSLYGHKLP----------------------VLSIDISFD 578

Query: 478 THLL-SCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDL 534
           + LL + S D  IK+W +  G C R+ F H + +  +    ++    S S D  +K WD 
Sbjct: 579 SKLLITSSADKNIKIWGLDFGDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDG 638

Query: 535 QSGKCMH 541
              +C+ 
Sbjct: 639 DKFECIQ 645

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRT-QFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGK 538
           LL+ + + T+K+W+++T  CIRT + G+      +      ++ G+  G + ++DL S  
Sbjct: 399 LLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGAL-VVLGTKTGDLHLYDLASST 457

Query: 539 CMHTFHG 545
            ++T  G
Sbjct: 458 LLNTIEG 464

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 25/33 (75%), Gaps = 1/33 (3%)

Query: 512 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFH 544
           DI+ DN ++++ + +G++KIW++++  C+ TF 
Sbjct: 392 DISGDN-KLLATASNGTLKIWNIKTNSCIRTFE 423

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 18/25 (72%)

Query: 523 GSHDGSIKIWDLQSGKCMHTFHGKR 547
           G +DG+IKIWDL S   + +F+G +
Sbjct: 93  GYNDGAIKIWDLLSKSVLISFNGHK 117

>YOR269W (PAC1) [5055] chr15 (826382..827866) Protein required in
           the absence of Cin8p, contains WD (WD-40) repeats [1485
           bp, 494 aa]
          Length = 494

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 134/323 (41%), Gaps = 70/323 (21%)

Query: 259 LQFNYRLLFTGSYDSTVAIWDLCSNKL-IRRLSGHTDGVKTL------YFDEAK-----L 306
           L  N  ++F  +    +  +DL +  + +  L  HT  + ++      Y + +K     +
Sbjct: 163 LHPNLPIVFVATDHGKLYAFDLFNYTIPLASLQSHTKAITSMDVLFTNYTNSSKKNYLVI 222

Query: 307 VTGSLDKTIRVWNYKTGEC----ISTYRGHTDSVMSVDAFKK----IIVSGSADKTVKIW 358
           VT S D  I V+ + + EC    I +  GH   V +V  ++K     I S S D+TVKIW
Sbjct: 223 VTASKDLQIHVFKWVSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIW 282

Query: 359 HVESR-TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
              +  +  T + H++WV  + +        SGS DTT+R+    + + L V  GH   +
Sbjct: 283 DFHNGWSLKTFQPHSQWVRSIDVLGDYI--ISGSHDTTLRLTHWPSGNGLSVGTGHEFPI 340

Query: 418 QKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYP 477
           +KV  +  I                +D P                +  +N  +       
Sbjct: 341 EKVKFIHFI----------------EDSP-------EIRFRTPSTDRYKNWGMQ------ 371

Query: 478 THLLSCSLDNTIKLWDV-----------------QTGQCIRTQFGHVEGVWDIAADNFRI 520
            + +S S D TIK+W++                    +C+ T  GH+  V DI+     +
Sbjct: 372 -YCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKGHLSWVRDISIRGQYL 430

Query: 521 ISGSHDGSIKIWDLQSGKCMHTF 543
            S + D S++ WDL +G+C+H +
Sbjct: 431 FSCADDKSVRCWDLNTGQCLHVW 453

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 96/228 (42%), Gaps = 51/228 (22%)

Query: 239 WRKGNCQVQEFK---GHMDGVLTLQF----NYRLLFTGSYDSTVAIWDLCSNKLIRRLSG 291
           W    C+ Q+ +   GH   V  ++     N   + + S D TV IWD  +   ++    
Sbjct: 236 WVSEECKFQQIRSLLGHEHIVSAVKIWQKNNDVHIASCSRDQTVKIWDFHNGWSLKTFQP 295

Query: 292 HTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV------------ 339
           H+  V+++      +++GS D T+R+ ++ +G  +S   GH   +  V            
Sbjct: 296 HSQWVRSIDVLGDYIISGSHDTTLRLTHWPSGNGLSVGTGHEFPIEKVKFIHFIEDSPEI 355

Query: 340 -------DAFK----KIIVSGSADKTVKIWHV------------------ESRTCYTLRG 370
                  D +K    +  VS S D+T+KIW +                    R   TL+G
Sbjct: 356 RFRTPSTDRYKNWGMQYCVSASRDRTIKIWEIPLPTLMAHRAPIPNPTDSNFRCVLTLKG 415

Query: 371 HTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF-RGHVGQV 417
           H  WV  + +  +    FS +DD ++R WD+ T  CL V+ + H G V
Sbjct: 416 HLSWVRDISIRGQYL--FSCADDKSVRCWDLNTGQCLHVWEKLHTGFV 461

>YKL213C (DOA1) [3062] chr11 complement(31961..34108) Protein
           required in ubiquitin proteolysis and found complexed
           with Cdc48p, has WD (WD-40) repeats [2148 bp, 715 aa]
          Length = 715

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 80/166 (48%), Gaps = 16/166 (9%)

Query: 251 GHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV---KTLYFDEAKLV 307
           GH   V +L F   ++ +GS+D T  +W   S  L+  L  H   V   K + F E K +
Sbjct: 97  GHQGNVCSLSFQDGVVISGSWDKTAKVWKEGS--LVYNLQAHNASVWDAKVVSFSENKFL 154

Query: 308 TGSLDKTIRVWNYKTGECISTYRG-HTDSVMSVDAFKKI-IVSGSADKTVKIWHVESRTC 365
           T S DKTI++W  +  + I T+ G H D V  +        +S S D  +K+  V+  T 
Sbjct: 155 TASADKTIKLW--QNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKL--VDMHTG 210

Query: 366 YTLR---GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
             LR   GH  +V C+KL P      S  +D T+R+W  + N  LK
Sbjct: 211 DVLRTYEGHESFVYCIKLLPNG-DIVSCGEDRTVRIWS-KENGSLK 254

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 86/212 (40%), Gaps = 56/212 (26%)

Query: 328 TYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTC 387
           T  GH  +V S+     +++SGS DKT K+W  E    Y L+ H   V   K+   S   
Sbjct: 94  TLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK-EGSLVYNLQAHNASVWDAKVVSFSENK 152

Query: 388 F-SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEP 446
           F + S D TI++W  + +  +K F G                 N VV +++  ++G    
Sbjct: 153 FLTASADKTIKLW--QNDKVIKTFSG---------------IHNDVVRHLAVVDDG---- 191

Query: 447 XXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH 506
                                           H +SCS D  IKL D+ TG  +RT  GH
Sbjct: 192 --------------------------------HFISCSNDGLIKLVDMHTGDVLRTYEGH 219

Query: 507 VEGVWDIA-ADNFRIISGSHDGSIKIWDLQSG 537
              V+ I    N  I+S   D +++IW  ++G
Sbjct: 220 ESFVYCIKLLPNGDIVSCGEDRTVRIWSKENG 251

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 73/157 (46%), Gaps = 11/157 (7%)

Query: 264 RLLFTGSYDST---VAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNY 320
            LL  G  D+    V ++       +  L GH   V +L F +  +++GS DKT +VW  
Sbjct: 67  ELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVW-- 124

Query: 321 KTGECISTYRGHTDSV--MSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRG-HTEWVN 376
           K G  +   + H  SV    V +F +   ++ SADKT+K+W    +   T  G H + V 
Sbjct: 125 KEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQ-NDKVIKTFSGIHNDVVR 183

Query: 377 CVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
            + +        S S+D  I++ D+ T   L+ + GH
Sbjct: 184 HLAVVDDGH-FISCSNDGLIKLVDMHTGDVLRTYEGH 219

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 101/253 (39%), Gaps = 70/253 (27%)

Query: 304 AKLVTGSLDKTIRVWNYK---TGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV 360
           +K+ + S D T+R+W+      G  + T +G  +SV   D+ K++++ G  D  +    +
Sbjct: 25  SKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSV-CYDSEKELLLFGGKDTMINGVPL 83

Query: 361 ESRT----CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
            + +     YTL GH    N   L  +     SGS D T ++W  +  S +   + H   
Sbjct: 84  FATSGEDPLYTLIGHQG--NVCSLSFQDGVVISGSWDKTAKVW--KEGSLVYNLQAHNAS 139

Query: 417 V--QKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSI 474
           V   KV+  +                                         EN+      
Sbjct: 140 VWDAKVVSFS-----------------------------------------ENK------ 152

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFG-HVEGVWDIAA-DNFRIISGSHDGSIKIW 532
                 L+ S D TIKLW  Q  + I+T  G H + V  +A  D+   IS S+DG IK+ 
Sbjct: 153 -----FLTASADKTIKLW--QNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLV 205

Query: 533 DLQSGKCMHTFHG 545
           D+ +G  + T+ G
Sbjct: 206 DMHTGDVLRTYEG 218

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 270 SYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKTIRVWNYKTGECIST 328
           S D  + + D+ +  ++R   GH   V  +       +V+   D+T+R+W+ + G     
Sbjct: 197 SNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQV 256

Query: 329 YRGHTDSVMSVDAFKKI-IVSGSADKTVKIWHVE 361
                 S+ SVD      I+ GS+D  V+I+  E
Sbjct: 257 ITLPAISIWSVDCMSNGDIIVGSSDNLVRIFSQE 290

>KLLA0C08976g 784536..787271 highly similar to sgd|S0000653
           Saccharomyces cerevisiae YCR057c PWP2 periodic
           tryptophan protein, start by similarity
          Length = 911

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 103/236 (43%), Gaps = 24/236 (10%)

Query: 192 LLHMKRARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKG 251
             H  RA+   +A   A+N      SNG+    +++     F            +Q+   
Sbjct: 251 FFHANRAKVKCSAFHAASNILTVGFSNGE----FRLYELPEF----------IMIQQLSM 296

Query: 252 HMDGVLTLQFNYR---LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKL 306
             + V T+  N     L F  S    + +++  S   I +  GH D +  L +  D +K+
Sbjct: 297 GQNAVNTVAINSSGEWLAFGSSKLGQLIVYEWQSESYILKQQGHFDTLNGLCYSPDGSKI 356

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESRT 364
           VT S +  I++W+  +G C++T+  H   V +V+  KK  ++ S S D TVK W +    
Sbjct: 357 VTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYR 416

Query: 365 CYTLRGHTEWV--NCVKLHPKSFTCFSGSDDT-TIRMWDIRTNSCLKVFRGHVGQV 417
            +     TE +  N + + P      +GS+D+  I +W ++T   +    GH G +
Sbjct: 417 NFRTFTATERIQFNSLAVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPI 472

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 80/171 (46%), Gaps = 25/171 (14%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVW----- 318
           + T S++  + IWD+ S   +     H  GV  + F +    L + SLD T++ W     
Sbjct: 356 IVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRY 415

Query: 319 -NYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADK-TVKIWHVES-RTCYTLRGHTEWV 375
            N++T    +T R   +S ++VD   +++ +GS D   + +W V++ +   TL GH   +
Sbjct: 416 RNFRT--FTATERIQFNS-LAVDPSGEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPI 472

Query: 376 NCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTII 426
           +C+    ++    S S D TIR+W +             G+ Q+V P  + 
Sbjct: 473 SCLSFSNENGVLASASWDKTIRVWSL------------FGRSQQVEPFEVF 511

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 10/125 (8%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK--TLYFDEA 304
           F  H  GV  ++F  +  +LF+ S D TV  WDL   +  R  +  T+ ++  +L  D +
Sbjct: 379 FDEHAGGVSAVEFAKKGQVLFSASLDGTVKAWDLIRYRNFRTFTA-TERIQFNSLAVDPS 437

Query: 305 KLV--TGSLDK-TIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWH 359
             V   GS D   I VW+ +TG+ + T  GH   +  +S      ++ S S DKT+++W 
Sbjct: 438 GEVVCAGSEDSFDIFVWSVQTGQLVDTLSGHEGPISCLSFSNENGVLASASWDKTIRVWS 497

Query: 360 VESRT 364
           +  R+
Sbjct: 498 LFGRS 502

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIW 532
           P  + +++ S +  IK+WDV +G C+ T   H  GV   + A     + S S DG++K W
Sbjct: 351 PDGSKIVTASHEGKIKIWDVASGFCLATFDEHAGGVSAVEFAKKGQVLFSASLDGTVKAW 410

Query: 533 DLQSGKCMHTFHG-KRLQ 549
           DL   +   TF   +R+Q
Sbjct: 411 DLIRYRNFRTFTATERIQ 428

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 491 LWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTF 543
           +++ Q+   I  Q GH + +  +  + D  +I++ SH+G IKIWD+ SG C+ TF
Sbjct: 325 VYEWQSESYILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATF 379

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 72/182 (39%), Gaps = 16/182 (8%)

Query: 358 WHVESRTCYTLR--GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           W  ES   Y L+  GH + +N +   P      + S +  I++WD+ +  CL  F  H G
Sbjct: 328 WQSES---YILKQQGHFDTLNGLCYSPDGSKIVTASHEGKIKIWDVASGFCLATFDEHAG 384

Query: 416 QVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIP 475
            V  V        + L   ++ G+ +  D                  N   +  +D S  
Sbjct: 385 GVSAVEFAK--KGQVLFSASLDGTVKAWDLIRYRNFRTFTATERIQFN---SLAVDPSGE 439

Query: 476 YPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEG---VWDIAADNFRIISGSHDGSIKIW 532
                   S D  I +W VQTGQ + T  GH EG       + +N  + S S D +I++W
Sbjct: 440 VVCAGSEDSFD--IFVWSVQTGQLVDTLSGH-EGPISCLSFSNENGVLASASWDKTIRVW 496

Query: 533 DL 534
            L
Sbjct: 497 SL 498

>Kwal_23.6240
          Length = 913

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 45/161 (27%), Positives = 77/161 (47%), Gaps = 9/161 (5%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKT 322
           L F  S    + +++  S   I +  GH D    + +  D +++VT S D  I++W+  +
Sbjct: 313 LAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVS 372

Query: 323 GECISTYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWH-VESRTCYTLRGHTE-WVNC 377
           G C+ T++ HT +V ++ AF K   ++ S S D TV+ W  V  R   T         NC
Sbjct: 373 GFCLVTFQEHTAAVSAL-AFAKRGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNC 431

Query: 378 VKLHPKSFTCFSGSDDT-TIRMWDIRTNSCLKVFRGHVGQV 417
           +   P      +GS D+  + +W ++T   ++   GH G V
Sbjct: 432 LAADPSGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPV 472

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 82/185 (44%), Gaps = 21/185 (11%)

Query: 250 KGHMDG--VLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK-- 305
           +GH D    +T   +   + T S D  + IWD+ S   +     HT  V  L F +    
Sbjct: 338 QGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQV 397

Query: 306 LVTGSLDKTIRVWN---YKTGECISTYRGHTDSVMSVDAFKKIIVSGSADK-TVKIWHVE 361
           L + SLD T+R W+   Y+     +       + ++ D   +++ +GS D   V +W V+
Sbjct: 398 LFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQ 457

Query: 362 S-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           + +   TL GH   V+C+    ++    S S D TIR+W I             G+ Q+V
Sbjct: 458 TGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIWSI------------FGRSQQV 505

Query: 421 IPLTI 425
            PL +
Sbjct: 506 EPLEV 510

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 70/315 (22%), Positives = 122/315 (38%), Gaps = 46/315 (14%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNK---LIRRLSGHTDGVKTLYF--DE 303
           GH   +++L +  + R L + S D T  IW L S +        +GH D V   +F  D+
Sbjct: 144 GHFSNIISLTWSRDSRFLISTSKDLTARIWSLDSQEKGLASVTFAGHRDYVMGAFFSADQ 203

Query: 304 AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESR 363
            ++ T S D  +  W Y       +     ++ +              D ++  W +  +
Sbjct: 204 ERIYTVSKDGAVFQWEYTPRPGFESPEQDEETEI--------------DPSLYSWRITKK 249

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPL 423
             +        V CV  H  S T   G ++   R++++   + ++     +GQ       
Sbjct: 250 NYF--YASQARVKCVTFHANSNTLVVGFNNGEFRLYELPEFTLIQQLS--MGQ------- 298

Query: 424 TIIDAENLVVDNISG------SNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYP 477
              +A N V  N SG      S++                      D  N       P  
Sbjct: 299 ---NAVNTVCVNDSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYS--PDG 353

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-ADNFRII-SGSHDGSIKIWDLQ 535
           + +++ S D  IK+WDV +G C+ T   H   V  +A A   +++ S S DG+++ WDL 
Sbjct: 354 SRVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLV 413

Query: 536 SGKCMHTF-HGKRLQ 549
             +   TF   +R+Q
Sbjct: 414 RYRNFRTFTAAERIQ 428

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 72/182 (39%), Gaps = 16/182 (8%)

Query: 358 WHVESRTCYTLR--GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           W  ES   Y L+  GH +  N V   P      + S+D  I++WD+ +  CL  F+ H  
Sbjct: 328 WQSES---YILKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTA 384

Query: 416 QVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIP 475
            V  +        + L   ++ G+    D                  N         + P
Sbjct: 385 AVSALAFAK--RGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFN------CLAADP 436

Query: 476 YPTHLLSCSLDN-TIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIW 532
               + + S+D+  + +W VQTGQ + T  GH   V     + +N  + S S D +I+IW
Sbjct: 437 SGEVVCAGSVDSFAVHVWSVQTGQLVETLDGHEGPVSCLSFSQENSVLASASWDKTIRIW 496

Query: 533 DL 534
            +
Sbjct: 497 SI 498

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD--IAAD--NFRIISGSHDG-SIKIWDL 534
           L S SLD T++ WD+   +  RT F   E +    +AAD     + +GS D  ++ +W +
Sbjct: 398 LFSASLDGTVRAWDLVRYRNFRT-FTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSV 456

Query: 535 QSGKCMHTFHG 545
           Q+G+ + T  G
Sbjct: 457 QTGQLVETLDG 467

>Kwal_27.11585
          Length = 823

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIWH 359
           +++   T S DKT ++WN  +GE   T   H   +  V    + K++ + S DKT+K+W 
Sbjct: 515 NDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVWS 574

Query: 360 VESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
           +ES +   TL GHT  V       ++    S   D  I++WD+ T  C++    H  ++
Sbjct: 575 LESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAHSNRI 633

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 81/330 (24%), Positives = 135/330 (40%), Gaps = 53/330 (16%)

Query: 103 LDGILASSCFPQLSYISSQVSN----------MIRIDFISILPQELSL-----KILSYLD 147
           LD +  ++  P L  I++ V+             ++D  + LP E+ L      +L+ LD
Sbjct: 348 LDKLALATNSPALRVITAPVTKHNAAEKEDEPTSKVDIQNCLPLEVELYEGHTDLLNSLD 407

Query: 148 CQSLCNATKVCRK------WQILADDDRVWYHMCEQHIDRKCPNCGWGLP-LLHMKRARF 200
                     C K      W++ AD ++  +    +      P    GLP ++      F
Sbjct: 408 SSENGEWLATCSKDHTVILWKLNADSEK--FKPYARFTGHAGPVTAVGLPNVMRNTWPEF 465

Query: 201 VKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEF--KGHMDGV-- 256
           +  AS            N   ++ W V       V+ +    N +V ++  + H   +  
Sbjct: 466 IITAS------------NDLTIKKWSVPKPTSNDVDMH----NIKVSDYTRRAHEKDINA 509

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKT 314
           L++  N  +  T SYD T  IW++ S +L   L+ H  G+  + F   +  L T S DKT
Sbjct: 510 LSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKT 569

Query: 315 IRVWNYKTGECISTYRGHTDSVM--SVDAFKKIIVSGSADKTVKIWHVESRTCY-TLRGH 371
           I+VW+ ++   + T  GHT++V   S     K IVS  AD  +K+W + +  C  TL  H
Sbjct: 570 IKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWDLSTGECIRTLDAH 629

Query: 372 TE--WVNCVKLHPKSFTCFSGSDDTTIRMW 399
           +   W   V    K F   +   D   + W
Sbjct: 630 SNRIWALSVLSDGKEFV--TADADGVFQFW 657

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 99/269 (36%), Gaps = 36/269 (13%)

Query: 291 GHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTG----ECISTYRGHTDSVMSV----- 339
           GHTD + +L   E    L T S D T+ +W         +  + + GH   V +V     
Sbjct: 398 GHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHAGPVTAVGLPNV 457

Query: 340 --DAFKKIIVSGSADKTVKIWHVESRTC------------YTLRGHTEWVNCVKLHPKSF 385
             + + + I++ S D T+K W V   T             YT R H + +N + + P   
Sbjct: 458 MRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDYTRRAHEKDINALSISPNDS 517

Query: 386 TCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDE 445
              + S D T ++W++ +         H           + D      D +  +  GD  
Sbjct: 518 VFATASYDKTCKIWNVDSGELEGTLANH--------KRGLWDVTFCQYDKLLATCSGDKT 569

Query: 446 PXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFG 505
                            +    Q     I     ++S   D  IK+WD+ TG+CIRT   
Sbjct: 570 IKVWSLESMSVVKTLEGHTNAVQRC-SFINRNKQIVSTGADGLIKVWDLSTGECIRTLDA 628

Query: 506 HVEGVWDIA--ADNFRIISGSHDGSIKIW 532
           H   +W ++  +D    ++   DG  + W
Sbjct: 629 HSNRIWALSVLSDGKEFVTADADGVFQFW 657

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 88/211 (41%), Gaps = 38/211 (18%)

Query: 243 NC---QVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSN----KLIRRLSGHT 293
           NC   +V+ ++GH D + +L    N   L T S D TV +W L ++    K   R +GH 
Sbjct: 387 NCLPLEVELYEGHTDLLNSLDSSENGEWLATCSKDHTVILWKLNADSEKFKPYARFTGHA 446

Query: 294 DGVKTLYFDEAK-------LVTGSLDKTIRVW-------------NYKTGECISTYRGHT 333
             V  +             ++T S D TI+ W             N K  +   T R H 
Sbjct: 447 GPVTAVGLPNVMRNTWPEFIITASNDLTIKKWSVPKPTSNDVDMHNIKVSDY--TRRAHE 504

Query: 334 DSV--MSVDAFKKIIVSGSADKTVKIWHVESRTCY-TLRGHTE--WVNCVKLHPKSFTCF 388
             +  +S+     +  + S DKT KIW+V+S     TL  H    W      + K     
Sbjct: 505 KDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATC 564

Query: 389 SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 419
           SG  D TI++W + + S +K   GH   VQ+
Sbjct: 565 SG--DKTIKVWSLESMSVVKTLEGHTNAVQR 593

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 4/77 (5%)

Query: 476 YPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWD 533
           Y   L +CS D TIK+W +++   ++T  GH   V        N +I+S   DG IK+WD
Sbjct: 557 YDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVSTGADGLIKVWD 616

Query: 534 LQSGKCMHTF--HGKRL 548
           L +G+C+ T   H  R+
Sbjct: 617 LSTGECIRTLDAHSNRI 633

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIW 532
           P  +   + S D T K+W+V +G+   T   H  G+WD+    +   + + S D +IK+W
Sbjct: 514 PNDSVFATASYDKTCKIWNVDSGELEGTLANHKRGLWDVTFCQYDKLLATCSGDKTIKVW 573

Query: 533 DLQSGKCMHTFHG 545
            L+S   + T  G
Sbjct: 574 SLESMSVVKTLEG 586

 Score = 37.0 bits (84), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/88 (21%), Positives = 41/88 (46%), Gaps = 5/88 (5%)

Query: 336 VMSVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKS----FTCFSG 390
           VM  D+   ++  G  D +V +  +E+    ++ +GH   ++ VK H +     +   SG
Sbjct: 106 VMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASG 165

Query: 391 SDDTTIRMWDIRTNSCLKVFRGHVGQVQ 418
                +++WD+   +C+   + H   V+
Sbjct: 166 DTSGMVKVWDLVRRNCIHTIQEHAAAVR 193

 Score = 33.9 bits (76), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 35/83 (42%), Gaps = 15/83 (18%)

Query: 486 DNTIKLWDVQTGQCIRTQFGHVEGVWDI------AADNFRIISGSHDGSIKIWDLQSGKC 539
           D ++ + D++ G    +  GH   +  +      +   +R+ SG   G +K+WDL    C
Sbjct: 122 DGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVWDLVRRNC 181

Query: 540 MHTFHGK---------RLQPQDE 553
           +HT             RL P D+
Sbjct: 182 IHTIQEHAAAVRGLDFRLSPADD 204

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 463 NDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRT-QFGHVEGVWDIAADNFRII 521
           +DE+  T  K  P   +L   S    ++++ + + + IR+ +      V D  + +  + 
Sbjct: 58  DDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSSPVYVMDCDSSSTLVA 117

Query: 522 SGSHDGSIKIWDLQSGKCMHTFHG 545
            G  DGS+ + D+++G   H+F G
Sbjct: 118 LGGTDGSVTVVDIENGYVTHSFKG 141

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/82 (21%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEA------KLVTGSLDKTIRVW 318
           L+  G  D +V + D+ +  +     GH   + ++ F         +L +G     ++VW
Sbjct: 115 LVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLASGDTSGMVKVW 174

Query: 319 NYKTGECISTYRGHTDSVMSVD 340
           +     CI T + H  +V  +D
Sbjct: 175 DLVRRNCIHTIQEHAAAVRGLD 196

>ADR176W [1917] [Homologous to ScYOR269W (PAC1) - SH]
           complement(1012413..1013798) [1386 bp, 461 aa]
          Length = 461

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 127/315 (40%), Gaps = 54/315 (17%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDLCSNKL-IRRLSGHTDGVKTLYFDEAK-----LVTGS 310
           + L  +  + F  +    V  +DL +  + +     H  GV +L   EA+     + T S
Sbjct: 126 IKLHPSLPIAFLATDQGKVVAYDLFNRSMPLHSTQAHMKGVTSLAVMEAENGSLLISTTS 185

Query: 311 LDKTIRVWNYKTGECISTYRGHT--DSVMSVDAFKK-----IIVSGSADKTVKIWHVESR 363
            D   ++W++         R  +  + ++S   F +     ++ + S D TVK+W  +S 
Sbjct: 186 KDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCFLRSGSDLLLATCSRDLTVKVWDTKSG 245

Query: 364 TCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP 422
            C  + + H +WV  ++LH       +GS+D TIR+    + + L +   H   +++V+ 
Sbjct: 246 WCIKSFQPHNQWVRTLELHGDYV--ITGSNDATIRLSHWPSGNGLSMAVMHEFPIERVLI 303

Query: 423 LTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLS 482
           + +         N +   E DD+                  +      D S     + +S
Sbjct: 304 IPM-------RANTAQKTEADDDQVEL--------------EYRKYDPDYSPLGFKYCIS 342

Query: 483 CSLDNTIKLWDVQTGQCI----------RTQF-------GHVEGVWDIAADNFRIISGSH 525
           CS DN I LW +   + I          +T F       GH   V DI      + S S 
Sbjct: 343 CSRDNLIVLWKIPLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRGRHLFSCSD 402

Query: 526 DGSIKIWDLQSGKCM 540
           D SI+ WDL +G+C+
Sbjct: 403 DRSIRCWDLVTGQCL 417

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 74/196 (37%), Gaps = 52/196 (26%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGE 324
           LL T S D TV +WD  S   I+    H   V+TL      ++TGS D TIR+ ++ +G 
Sbjct: 227 LLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRLSHWPSGN 286

Query: 325 CISTYRGHTDSVMSVDAFK--------------------------------KIIVSGSAD 352
            +S    H   +  V                                    K  +S S D
Sbjct: 287 GLSMAVMHEFPIERVLIIPMRANTAQKTEADDDQVELEYRKYDPDYSPLGFKYCISCSRD 346

Query: 353 KTVKIWHVES------------------RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDT 394
             + +W +                       +  +GHT WV  +K+  +    FS SDD 
Sbjct: 347 NLIVLWKIPLPKFIPHRPPQPNLLQTNFEKVHVFKGHTSWVRDIKVRGRHL--FSCSDDR 404

Query: 395 TIRMWDIRTNSCLKVF 410
           +IR WD+ T  CLKV+
Sbjct: 405 SIRCWDLVTGQCLKVW 420

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 12/122 (9%)

Query: 250 KGHMDGVLTLQF-----NYRLLFTGSYDSTVAIWDLCSN---KLIRRLSGHTDGVKTLYF 301
           + HM GV +L          L+ T S D    IW    N   +L+R LS H   V    F
Sbjct: 160 QAHMKGVTSLAVMEAENGSLLISTTSKDLQCKIWSFTDNAAFQLLRTLSSHEHIVSQSCF 219

Query: 302 ----DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKI 357
                +  L T S D T++VW+ K+G CI +++ H   V +++     +++GS D T+++
Sbjct: 220 LRSGSDLLLATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRL 279

Query: 358 WH 359
            H
Sbjct: 280 SH 281

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKI--WDLQSG 537
           L +CS D T+K+WD ++G CI++   H + V  +      +I+GS+D +I++  W   +G
Sbjct: 228 LATCSRDLTVKVWDTKSGWCIKSFQPHNQWVRTLELHGDYVITGSNDATIRLSHWPSGNG 287

Query: 538 KCMHTFH 544
             M   H
Sbjct: 288 LSMAVMH 294

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 8/40 (20%)

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNF 518
           HL SCS D +I+ WD+ TGQC++        VW  A+  F
Sbjct: 396 HLFSCSDDRSIRCWDLVTGQCLK--------VWPEASHGF 427

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 10/77 (12%)

Query: 286 IRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV---MSVDA- 341
           +    GHT  V+ +      L + S D++IR W+  TG+C+  +   +      +SVD+ 
Sbjct: 377 VHVFKGHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTGQCLKVWPEASHGFINCLSVDSD 436

Query: 342 ------FKKIIVSGSAD 352
                  +++ +SGS D
Sbjct: 437 VSNDKLLRELFLSGSID 453

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 245 QVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIR 287
           +V  FKGH   V  ++   R LF+ S D ++  WDL + + ++
Sbjct: 376 KVHVFKGHTSWVRDIKVRGRHLFSCSDDRSIRCWDLVTGQCLK 418

>AER337W [2838] [Homologous to ScYOR272W (YTM1) - SH]
           complement(1256750..1258087) [1338 bp, 445 aa]
          Length = 445

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 76/353 (21%), Positives = 123/353 (34%), Gaps = 120/353 (33%)

Query: 254 DGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLD 312
           D V  L      + +GSYD  V  W+L S K+ ++ SGHT  V+ + F    +LV+G  D
Sbjct: 104 DWVSALDVGAERIVSGSYDGVVRTWNL-SGKIEKQYSGHTGAVRAVKFISSTRLVSGGND 162

Query: 313 KTIRVWNYKT--------------GECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIW 358
           +T+R+W  K                  ++   GH   V+SVD     I+S S D ++  W
Sbjct: 163 RTLRLWKTKNDDVKHVDELEGTEEAHTLAILEGHQAPVVSVDVQGDRILSASYDNSIGFW 222

Query: 359 HVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQ 418
               +    +           L  K+ +        T++   +R  + L +   H   V+
Sbjct: 223 STNHKDMTAVDPMDS------LGDKASSAAKKRRKLTMKDGSVRRRAPLSLLESHKAPVE 276

Query: 419 KVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT 478
           +V               I  SN                              D ++ Y  
Sbjct: 277 QV---------------IFASN------------------------------DSTVAY-- 289

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQ----------------------------------- 503
              S S D+TIK WD+ T +C+ T+                                   
Sbjct: 290 ---SVSQDHTIKTWDLVTSRCVDTKSTSYSLLSMVELPKLRLLACGSSARHITLHDPRAD 346

Query: 504 ----------FGHVEGV--WDIAADN-FRIISGSHDGSIKIWDLQSGKCMHTF 543
                      GH   V   D   +N + + S SHDG++K+WD++S   ++T 
Sbjct: 347 SSAKITQQQLLGHKNFVVALDTCPENEYMLCSASHDGTVKVWDIRSSSSIYTI 399

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 87/225 (38%), Gaps = 59/225 (26%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIW-----------------DLCSNKLIRR--- 288
            +GH   V+++      + + SYD+++  W                 D  S+   +R   
Sbjct: 193 LEGHQAPVVSVDVQGDRILSASYDNSIGFWSTNHKDMTAVDPMDSLGDKASSAAKKRRKL 252

Query: 289 ---------------LSGHTDGVKTLYF---DEAKLVTGSLDKTIRVWNYKTGECISTYR 330
                          L  H   V+ + F   D     + S D TI+ W+  T  C+ T +
Sbjct: 253 TMKDGSVRRRAPLSLLESHKAPVEQVIFASNDSTVAYSVSQDHTIKTWDLVTSRCVDT-K 311

Query: 331 GHTDSVMSVDAFKKI--IVSGS-----------ADKTVKIWHVESRTCYTLRGHTEWVNC 377
             + S++S+    K+  +  GS           AD + KI      T   L GH  +V  
Sbjct: 312 STSYSLLSMVELPKLRLLACGSSARHITLHDPRADSSAKI------TQQQLLGHKNFVVA 365

Query: 378 VKLHPKS-FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI 421
           +   P++ +   S S D T+++WDIR++S +         V+K I
Sbjct: 366 LDTCPENEYMLCSASHDGTVKVWDIRSSSSIYTITREDQSVEKGI 410

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 3/34 (8%)

Query: 512 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           D+ A+  RI+SGS+DG ++ W+L SGK    + G
Sbjct: 110 DVGAE--RIVSGSYDGVVRTWNL-SGKIEKQYSG 140

>AGR207C [4518] [Homologous to ScYBR175W (SWD3) - SH]
           (1146710..1147672) [963 bp, 320 aa]
          Length = 320

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 66/256 (25%), Positives = 101/256 (39%), Gaps = 32/256 (12%)

Query: 314 TIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESRTCYTLRGH 371
            I V++   G C      HT+ +  +        + SGS D TV+I H+E    + LRGH
Sbjct: 36  AICVYSVGDGGCARYETTHTEPINDICWSPDSACVASGSEDFTVEITHLEYGRLHKLRGH 95

Query: 372 TEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENL 431
           +  V  V  + K     + S D +I+ WD+ + + LK    H      V+ +   D +  
Sbjct: 96  SAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSAH---SDPVVSIDTPDCDAT 152

Query: 432 VVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT--------HLLSC 483
           ++   SGS +G                     D++ QT D  +P            LL  
Sbjct: 153 ILS--SGSYDG---LIRIFDTESGHCLKTLTYDKDWQTDDGVVPISQVKFSRNGKFLLVR 207

Query: 484 SLDNTIKLWDVQTGQCIRTQFGHVEG-------------VWDIAADNFRIISGSHDGSIK 530
           SLD  +KLWD   G  +RT F    G               D  A +  ++ G  DG+I 
Sbjct: 208 SLDGVVKLWDFIRGCVVRT-FKDASGESRMKYSCGMDFLYPDSEAADVMVVVGGEDGNIC 266

Query: 531 IWDLQSGKCMHTFHGK 546
           +W+ QS     T  G+
Sbjct: 267 VWNAQSKAVAQTLKGQ 282

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 66/129 (51%), Gaps = 15/129 (11%)

Query: 245 QVQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF- 301
           ++ + +GH   VL++ FN +  LL T S D ++  WD+ S  L++ +S H+D V ++   
Sbjct: 88  RLHKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTLLKTMSAHSDPVVSIDTP 147

Query: 302 --DEAKLVTGSLDKTIRVWNYKTGECISTYR-----GHTDSVMSVDAFK-----KIIVSG 349
             D   L +GS D  IR+++ ++G C+ T          D V+ +   K     K ++  
Sbjct: 148 DCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVVPISQVKFSRNGKFLLVR 207

Query: 350 SADKTVKIW 358
           S D  VK+W
Sbjct: 208 SLDGVVKLW 216

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 48/163 (29%), Positives = 78/163 (47%), Gaps = 15/163 (9%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKLVTGSLDKTIRVWNYKTGEC 325
           +GS D TV I  L   +L  +L GH+  V ++ F+     L T S+D++I+ W+  +G  
Sbjct: 72  SGSEDFTVEITHLEYGRL-HKLRGHSAPVLSVVFNCKGNLLCTASVDESIKQWDVLSGTL 130

Query: 326 ISTYRGHTDSVMSVDAF---KKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLH 381
           + T   H+D V+S+D       I+ SGS D  ++I+  ES  C  TL    +W     + 
Sbjct: 131 LKTMSAHSDPVVSIDTPDCDATILSSGSYDGLIRIFDTESGHCLKTLTYDKDWQTDDGVV 190

Query: 382 PKSFTCFS--------GSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
           P S   FS         S D  +++WD      ++ F+   G+
Sbjct: 191 PISQVKFSRNGKFLLVRSLDGVVKLWDFIRGCVVRTFKDASGE 233

>KLLA0E24508g complement(2175775..2176758) similar to sp|P38123
           Saccharomyces cerevisiae YBR175w, start by similarity
          Length = 327

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 82/161 (50%), Gaps = 15/161 (9%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYK 321
           + + +GS D TV I  +   + IRRL GHT  V ++ ++     L + S+D++I+ W+  
Sbjct: 82  KCIASGSEDFTVEITHIIYGR-IRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVL 140

Query: 322 TGECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNC 377
           +G  + T   H+D+V+S+D  K    I+ SGS D  ++I+  ES  C  TL    +W+  
Sbjct: 141 SGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAE 200

Query: 378 VKLHPKSFTCFS--------GSDDTTIRMWDIRTNSCLKVF 410
             + P S   FS         S D  +++W+    + ++ F
Sbjct: 201 DGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTF 241

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 3/67 (4%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR---IISGSHDGSIKIWDLQS 536
           L S S+D +IK W V +G  ++T   H + V  I    F    + SGS+DG I+I+D +S
Sbjct: 125 LCSSSMDESIKEWHVLSGTALKTMSAHSDAVVSIDIPKFDSSILSSGSYDGLIRIFDTES 184

Query: 537 GKCMHTF 543
           G C+ T 
Sbjct: 185 GHCLKTL 191

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 55/214 (25%), Positives = 86/214 (40%), Gaps = 30/214 (14%)

Query: 344 KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           K I SGS D TV+I H+       L GHT  V  +  + K     S S D +I+ W + +
Sbjct: 82  KCIASGSEDFTVEITHIIYGRIRRLMGHTAPVISICYNNKGNILCSSSMDESIKEWHVLS 141

Query: 404 NSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXN 463
            + LK    H      V+ + I   ++ ++   SGS +G                     
Sbjct: 142 GTALKTMSAH---SDAVVSIDIPKFDSSILS--SGSYDG---LIRIFDTESGHCLKTLTY 193

Query: 464 DEENQTLDKSIPYPT--------HLLSCSLDNTIKLWDVQTGQCIRTQF----------- 504
           D++    D  +P  T         LL  SLDN +KLW+   G  +RT             
Sbjct: 194 DKDWIAEDGVVPISTVKFSRNGKFLLVKSLDNVVKLWEYTRGTVVRTFLWPHQETKAKLK 253

Query: 505 --GHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 536
               +E ++    D   +ISG+  GS+ +W++ S
Sbjct: 254 YNCGLELIYPQGKDPL-VISGNDSGSMCVWNVYS 286

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 58/140 (41%), Gaps = 28/140 (20%)

Query: 205 SICATN--NTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTL--- 259
           SIC  N  N     S  + ++ W V+     K  S              H D V+++   
Sbjct: 115 SICYNNKGNILCSSSMDESIKEWHVLSGTALKTMS-------------AHSDAVVSIDIP 161

Query: 260 QFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTD--------GVKTLYFDEAK--LVTG 309
           +F+  +L +GSYD  + I+D  S   ++ L+   D         + T+ F      L+  
Sbjct: 162 KFDSSILSSGSYDGLIRIFDTESGHCLKTLTYDKDWIAEDGVVPISTVKFSRNGKFLLVK 221

Query: 310 SLDKTIRVWNYKTGECISTY 329
           SLD  +++W Y  G  + T+
Sbjct: 222 SLDNVVKLWEYTRGTVVRTF 241

>Sklu_1880.3 YDR364C, Contig c1880 4293-5708
          Length = 471

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 85/179 (47%), Gaps = 20/179 (11%)

Query: 246 VQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSNK-LIRRLSGHTDGVKTLYF 301
           +  FKGH++G   L+F      L  +G  D+ + IWD+   + L+R   GH   V+ + F
Sbjct: 171 IYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINF 230

Query: 302 --DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI----IVSGSADKTV 355
             D  + ++ S D+T++VW+ +TG+  S  + H  SV +   +        + G ++  +
Sbjct: 231 NSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWH--SVPNCATYHPTNNNEYIVGLSNSEI 288

Query: 356 KIWHVESRTC------YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
           +  H +SR         T   H   +  +K  P      S S+D T+R+W+ + N  +K
Sbjct: 289 R--HYDSRVSNKEGLIQTYNHHLSSIISLKYFPDGSKFISSSEDKTVRIWENQVNIPIK 345

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 4/72 (5%)

Query: 472 KSIPYPTHL-LSCSLDNTIKLWDV-QTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDG 527
           K +P   HL LS   DN I +WD+      +R   GH + V DI   +D    +S S D 
Sbjct: 185 KFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDINFNSDGTEFLSVSFDQ 244

Query: 528 SIKIWDLQSGKC 539
           ++K+WD ++GK 
Sbjct: 245 TLKVWDTETGKV 256

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 39/95 (41%), Gaps = 5/95 (5%)

Query: 324 ECISTYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWHV--ESRTCYTLRGHTEWVNCV 378
           + I T++GH +    +    +   + +SG  D  + IW +  E       RGH + V  +
Sbjct: 169 KIIYTFKGHVNGTTKLKFLPETGHLFLSGGNDNVINIWDMYHERTLLRDYRGHRKAVRDI 228

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
             +       S S D T+++WD  T       + H
Sbjct: 229 NFNSDGTEFLSVSFDQTLKVWDTETGKVKSRLKWH 263

>YBR175W (SWD3) [360] chr2 (582365..583312) Component of SET1 and
           COMPASS complex, has several WD (WD-40) repeats and may
           be involved in chromatin remodeling [948 bp, 315 aa]
          Length = 315

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (51%), Gaps = 15/128 (11%)

Query: 246 VQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +  F GH   V++L FN +  LLFT S D ++ IWD  +  L++ +S H++ V ++    
Sbjct: 89  LHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGSLMKTISAHSEAVVSVDVPM 148

Query: 302 -DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTD-----SVMSVDAFK-----KIIVSGS 350
            D + L +GS D  IR+++ +TG C+ T     D      V+ +   K     + ++  S
Sbjct: 149 NDSSILSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFSENARYLLVKS 208

Query: 351 ADKTVKIW 358
            D  VKIW
Sbjct: 209 LDGVVKIW 216

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 85/224 (37%), Gaps = 66/224 (29%)

Query: 346 IVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
           I + S D +V+I H+     +T  GHT  V  +  + K    F+ S D +I++WD    S
Sbjct: 70  IATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESIKIWDTLNGS 129

Query: 406 CLKVFRGHVGQVQKV-IPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXND 464
            +K    H   V  V +P+                                         
Sbjct: 130 LMKTISAHSEAVVSVDVPMN---------------------------------------- 149

Query: 465 EENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRT-----QFGHVEGVWDIAADNFR 519
                 D SI     L S S D  I+++D +TG C++T      +    GV  I+   F 
Sbjct: 150 ------DSSI-----LSSGSYDGLIRIFDAETGHCLKTLTYDKDWKRENGVVPISQVKFS 198

Query: 520 -----IISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEEGSTH 558
                ++  S DG +KIWD   G  + TF   ++QP  E+G  H
Sbjct: 199 ENARYLLVKSLDGVVKIWDCIGGCVVRTF---QVQPL-EKGVLH 238

>Scas_658.1
          Length = 442

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 80/174 (45%), Gaps = 20/174 (11%)

Query: 251 GHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSNK-LIRRLSGHTDGVKTLYF--DEA 304
           GH +G  +L F   +  LL +G  D+ V +WD    + L+R   GH+  + +L F  D  
Sbjct: 147 GHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGT 206

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI----IVSGSADKTVKIWHV 360
             ++ S D TI++W+ + G+  +  + H  S  +   F+       + G A+   KI+H 
Sbjct: 207 NFISSSFDHTIKIWDTEQGKVKT--KLHFKSTPNDVKFRPFNSSEFIVGFANS--KIYHY 262

Query: 361 ESRT------CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
           ++R             H   +  +K  P      S S+D T+R+WD + N  +K
Sbjct: 263 DTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWDNQVNVPIK 316

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 82/190 (43%), Gaps = 28/190 (14%)

Query: 246 VQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKLIRRL--SGHTDGVKTLYF 301
           ++++KGH   + +L FN       + S+D T+ IWD    K+  +L      + VK   F
Sbjct: 186 LRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQGKVKTKLHFKSTPNDVKFRPF 245

Query: 302 DEAKLVTGSLDKTIRVWNYKTGEC---ISTYRGHTDSVMSVDAFK--KIIVSGSADKTVK 356
           + ++ + G  +  I  ++ +  E    +  Y  H  S++++  F      +S S DKTV+
Sbjct: 246 NSSEFIVGFANSKIYHYDTRISENDGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVR 305

Query: 357 IW---------HVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN--- 404
           IW          +   T Y++         + +HP      + S D TI  + ++     
Sbjct: 306 IWDNQVNVPIKQISDTTQYSMP-------SIDIHPDKKNFCAQSMDNTIYTYSMKPKYRR 358

Query: 405 SCLKVFRGHV 414
           +  K+F+G  
Sbjct: 359 NPNKMFKGQT 368

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 33/70 (47%), Gaps = 3/70 (4%)

Query: 480 LLSCSLDNTIKLWDV-QTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 536
           LLS   DN +K+WD       +R   GH + +   D   D    IS S D +IKIWD + 
Sbjct: 165 LLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDFNDDGTNFISSSFDHTIKIWDTEQ 224

Query: 537 GKCMHTFHGK 546
           GK     H K
Sbjct: 225 GKVKTKLHFK 234

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 61/143 (42%), Gaps = 16/143 (11%)

Query: 228 IYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKL 285
           IY    ++  N    + +VQ +  HM  +L L+F  +     + S D TV IWD   N  
Sbjct: 259 IYHYDTRISEN----DGRVQVYDHHMSSILALKFFPDGSKFISSSEDKTVRIWDNQVNVP 314

Query: 286 IRRLSGHTDGVKT---LYFDEAKLVTGSLDKTIRVWNYKTG---ECISTYRGHTDS---- 335
           I+++S  T        ++ D+      S+D TI  ++ K          ++G T +    
Sbjct: 315 IKQISDTTQYSMPSIDIHPDKKNFCAQSMDNTIYTYSMKPKYRRNPNKMFKGQTSAGYGI 374

Query: 336 VMSVDAFKKIIVSGSADKTVKIW 358
            ++  A  + + SG +   V IW
Sbjct: 375 GLTFSADGRYVCSGDSKSKVHIW 397

>Scas_721.7
          Length = 325

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 68/144 (47%), Gaps = 17/144 (11%)

Query: 231 ERFKVESNWRKGNCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKLIRR 288
           + F +E       C +    GH   V++L +N    LLFT S D ++ IWD     +++ 
Sbjct: 77  DDFTIEITHLTHGC-LHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGAILKT 135

Query: 289 LSGHTDGVKTLYF----DEAKLVTGSLDKTIRVWNYKTGECISTYR-----GHTDSVMSV 339
           +S H++ V +L      D + L +GS D  IR+++ +TG C+ T          D V+ +
Sbjct: 136 ISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPI 195

Query: 340 DAFK-----KIIVSGSADKTVKIW 358
              +     K ++  S D  VKIW
Sbjct: 196 SQVRFSPNGKFLLVSSFDGIVKIW 219

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/219 (24%), Positives = 82/219 (37%), Gaps = 64/219 (29%)

Query: 346 IVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
           + S S D T++I H+     + L GHT  V  +  +      F+ S D +I++WD    +
Sbjct: 72  LASASDDFTIEITHLTHGCLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWDTFHGA 131

Query: 406 CLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDE 465
            LK    H    + V+ L+I                                        
Sbjct: 132 ILKTISAHS---ESVVSLSICPDR------------------------------------ 152

Query: 466 ENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRT-----QFGHVEGVWDIAADNFR- 519
                D S+     L S S D  I+L+D +TG C++T      +   +GV  I+   F  
Sbjct: 153 -----DSSV-----LASGSFDGLIRLFDTRTGHCLKTLTYDKDWKSDDGVVPISQVRFSP 202

Query: 520 ----IISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEE 554
               ++  S DG +KIWD   G  + TF     +P D E
Sbjct: 203 NGKFLLVSSFDGIVKIWDCVRGYVVRTF-----KPSDGE 236

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 55/114 (48%), Gaps = 6/114 (5%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWH 359
           D   L + S D TI + +   G C+    GHT  V+S+  +    ++ + S D+++KIW 
Sbjct: 68  DNQCLASASDDFTIEITHLTHG-CLHRLMGHTAPVISLTYNDSGNLLFTSSMDESIKIWD 126

Query: 360 V-ESRTCYTLRGHTEWVNCVKLHPK--SFTCFSGSDDTTIRMWDIRTNSCLKVF 410
                   T+  H+E V  + + P   S    SGS D  IR++D RT  CLK  
Sbjct: 127 TFHGAILKTISAHSESVVSLSICPDRDSSVLASGSFDGLIRLFDTRTGHCLKTL 180

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 77/195 (39%), Gaps = 58/195 (29%)

Query: 355 VKIWHVESRTCYTL--RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
           + I+ +++R  +++    H   ++ V   P +    S SDD TI +  + T+ CL    G
Sbjct: 38  ILIYDLQTRAIHSIIPTSHVAPISEVAWSPDNQCLASASDDFTIEITHL-THGCLHRLMG 96

Query: 413 HVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDK 472
           H      VI LT  D+ NL                                         
Sbjct: 97  HTA---PVISLTYNDSGNL----------------------------------------- 112

Query: 473 SIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA----DNFRIISGSHDGS 528
                  L + S+D +IK+WD   G  ++T   H E V  ++     D+  + SGS DG 
Sbjct: 113 -------LFTSSMDESIKIWDTFHGAILKTISAHSESVVSLSICPDRDSSVLASGSFDGL 165

Query: 529 IKIWDLQSGKCMHTF 543
           I+++D ++G C+ T 
Sbjct: 166 IRLFDTRTGHCLKTL 180

>KLLA0E07942g 717476..718648 similar to sp|P20484 Saccharomyces
           cerevisiae YKL021c MAK11 involved in cell growth and
           replication of M1 dsRNA virus singleton, start by
           similarity
          Length = 390

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 67/131 (51%), Gaps = 13/131 (9%)

Query: 286 IRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV------ 339
           I     H+  VK L   +  LV+GS D+ IR+++ +  + + T  GH  S+ ++      
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGK 93

Query: 340 DA------FKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSD 392
           DA        K ++S S D  + +W V+    + TL+GHT  +N   +HP +    S S+
Sbjct: 94  DADGQDIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSE 153

Query: 393 DTTIRMWDIRT 403
           D +IR+W++ T
Sbjct: 154 DHSIRLWNLMT 164

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 56/126 (44%), Gaps = 14/126 (11%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--- 305
           F+ H   V  L  + R L +GS D  + I+DL   K +  L GH   +  L F   K   
Sbjct: 37  FQAHSLSVKCLDISKRYLVSGSNDENIRIYDLQKRKELGTLLGHQGSITNLRFSRGKDAD 96

Query: 306 ---------LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF--KKIIVSGSADKT 354
                    L++ S D  I VW  K  E   T +GHT  +   D     ++ VS S D +
Sbjct: 97  GQDIQLNKWLLSASEDHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHS 156

Query: 355 VKIWHV 360
           +++W++
Sbjct: 157 IRLWNL 162

 Score = 37.4 bits (85), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 69/175 (39%), Gaps = 45/175 (25%)

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI 425
           +  + H+  V C+ +  +     SGS+D  IR++D++    L    GH G +        
Sbjct: 35  FHFQAHSLSVKCLDISKRYLV--SGSNDENIRIYDLQKRKELGTLLGHQGSIT------- 85

Query: 426 IDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSL 485
                    N+  S   D                    D ++  L+K       LLS S 
Sbjct: 86  ---------NLRFSRGKD-------------------ADGQDIQLNK------WLLSASE 111

Query: 486 DNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGK 538
           D+ I +W V+  +   T  GH   +  +DI   N   +S S D SI++W+L + K
Sbjct: 112 DHKIIVWRVKDWENFGTLKGHTARINDFDIHPSNRVAVSVSEDHSIRLWNLMTVK 166

>Kwal_23.5351
          Length = 474

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 64/124 (51%), Gaps = 8/124 (6%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRG-HTDSVMSV--DAFKKIIVSGSADKTVKIW 358
           D A L  GS +  +++ + ++ E + +  G H D +  V   +  +++ +G AD  VKIW
Sbjct: 193 DGASLAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIW 252

Query: 359 HVESRTC-----YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
           + ++++        LRGH   V+ VK HP      S S D T R+WD+   + L++  GH
Sbjct: 253 NPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGH 312

Query: 414 VGQV 417
             +V
Sbjct: 313 AKEV 316

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/166 (29%), Positives = 74/166 (44%), Gaps = 12/166 (7%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSG-HTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK- 321
           L  GS++  V I    S +++R L G H D +  + +  D   L TG  D  +++WN + 
Sbjct: 197 LAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQA 256

Query: 322 ---TGECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIWHVESRTCYTLR-GHTEWV 375
              +       RGH   V  V      + + S S D T ++W VE  T   L+ GH + V
Sbjct: 257 QSHSEASRVVLRGHEARVSKVKFHPSDRFVASASFDMTWRLWDVERETELQLQEGHAKEV 316

Query: 376 NCVKLH-PKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
            C+      S  C +G D +   +WD+RT   L V  GH   +  V
Sbjct: 317 YCLDFQCDGSLLCSAGLD-SVGHVWDMRTGRSLMVLEGHAKPIYGV 361

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 82/174 (47%), Gaps = 10/174 (5%)

Query: 240 RKGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK 297
           R+   Q+QE  GH   V  L F  +  LL +   DS   +WD+ + + +  L GH   + 
Sbjct: 302 RETELQLQE--GHAKEVYCLDFQCDGSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIY 359

Query: 298 TLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK---IIVSGSAD 352
            + +  +   + TGS D T++VW+ +     S+   H   V  V+  K+    +VS S D
Sbjct: 360 GVSWSPNGHHVATGSGDGTVQVWDIRKANKPSSILAHNSIVSEVNFEKENGNFLVSSSYD 419

Query: 353 KTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
           +T+ ++   S     +L+GHT+ +  V +       +S   D ++++W +   S
Sbjct: 420 RTIGVFATGSWIKLASLQGHTDKILSVDISRGGANLWSSGWDRSVKIWALGVRS 473

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 71/158 (44%), Gaps = 11/158 (6%)

Query: 255 GVLTLQFNYRLLFTGSYDSTVAIWD--LCSNKLIRR--LSGHTDGVKTLYFDEAK--LVT 308
           G +    + +LL TG  D+ V IW+    S+    R  L GH   V  + F  +   + +
Sbjct: 229 GGVAWSSDSQLLATGGADNLVKIWNPQAQSHSEASRVVLRGHEARVSKVKFHPSDRFVAS 288

Query: 309 GSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVES-RT 364
            S D T R+W+ +    +    GH   V  +D F+    ++ S   D    +W + + R+
Sbjct: 289 ASFDMTWRLWDVERETELQLQEGHAKEVYCLD-FQCDGSLLCSAGLDSVGHVWDMRTGRS 347

Query: 365 CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIR 402
              L GH + +  V   P      +GS D T+++WDIR
Sbjct: 348 LMVLEGHAKPIYGVSWSPNGHHVATGSGDGTVQVWDIR 385

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 84/198 (42%), Gaps = 17/198 (8%)

Query: 346 IVSGSADKTVKIWHVES-RTCYTLRG-HTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           + +GS +  VKI H +S     +L G H + +  V     S    +G  D  +++W+ + 
Sbjct: 197 LAAGSWNGDVKILHPQSLEVVRSLDGAHDDKIGGVAWSSDSQLLATGGADNLVKIWNPQA 256

Query: 404 NSCLK----VFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXX 459
            S  +    V RGH  +V KV        +    D    S   D                
Sbjct: 257 QSHSEASRVVLRGHEARVSKV--------KFHPSDRFVASASFDMTWRLWDVERETELQL 308

Query: 460 XXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADN 517
              + +E   LD      + L S  LD+   +WD++TG+ +    GH + ++ +  + + 
Sbjct: 309 QEGHAKEVYCLDFQCD-GSLLCSAGLDSVGHVWDMRTGRSLMVLEGHAKPIYGVSWSPNG 367

Query: 518 FRIISGSHDGSIKIWDLQ 535
             + +GS DG++++WD++
Sbjct: 368 HHVATGSGDGTVQVWDIR 385

>YDR364C (CDC40) [1190] chr4 complement(1202831..1204198) Protein
           required for the second catalytic step of mRNA splicing,
           member of WD (WD-40) repeat family [1368 bp, 455 aa]
          Length = 455

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 82/179 (45%), Gaps = 20/179 (11%)

Query: 246 VQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSN-KLIRRLSGHTDGVKTLYF 301
           ++ + GH +G   L+F      L+ +G  D T+ IWD   + + +R   GH   +K L F
Sbjct: 155 IRNYPGHPEGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRF 214

Query: 302 DE--AKLVTGSLDKTIRVWNYKTGECISTYRGHTDS----VMSVDAFKKIIVSGSADKTV 355
            E     ++ S D+++++W+ +TG+  +  R H +S    V S        + G ++   
Sbjct: 215 TEDCQSFLSSSFDRSVKIWDTETGKVKT--RLHLNSTPADVESRPTNPHEFIVGLSNS-- 270

Query: 356 KIWHVESRT------CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
           KI H + R         T   H   +  +K  P      S S+D T+R+W+ + N  +K
Sbjct: 271 KILHYDDRVSENQGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIK 329

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 466 ENQTLDKSIPYPTHL-LSCSLDNTIKLWDV-QTGQCIRTQFGHVEGVWDI--AADNFRII 521
           E  T  K +P   HL LS   D+TIK+WD     +C+R   GH + +  +    D    +
Sbjct: 163 EGTTALKFLPKTGHLILSGGNDHTIKIWDFYHDYECLRDFQGHNKPIKALRFTEDCQSFL 222

Query: 522 SGSHDGSIKIWDLQSGKCMHTFH 544
           S S D S+KIWD ++GK     H
Sbjct: 223 SSSFDRSVKIWDTETGKVKTRLH 245

>YKL021C (MAK11) [3234] chr11 complement(396987..398393) Protein
           essential for replication of M double-stranded RNA
           (dsRNA) virus, member of the WD (WD-40) repeat family
           [1407 bp, 468 aa]
          Length = 468

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 68/156 (43%), Gaps = 24/156 (15%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVT 308
           F+ H   +  L  + R L +GS D  + I+DL   K +  L  H   +  L F       
Sbjct: 102 FQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPA--- 158

Query: 309 GSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVES-RTCYT 367
                        + E  +  +G  +S        K ++S S D  + +W V+   T  T
Sbjct: 159 ------------SSSEDAAVSKGSKNS--------KWLLSASEDHKIMVWRVKDWETVGT 198

Query: 368 LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           L+GHT  VN V +HP +    S SDD +IR+W++ T
Sbjct: 199 LKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMT 234

 Score = 36.2 bits (82), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 49/108 (45%), Gaps = 16/108 (14%)

Query: 329 YRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKL-HPKSFT 386
           ++ H+ S+  +   ++ +VSGS D+ ++I+ ++ R    TL  H   +  ++  HP S +
Sbjct: 102 FQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPASSS 161

Query: 387 --------------CFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                           S S+D  I +W ++    +   +GH  +V  V
Sbjct: 162 EDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDV 209

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 63/173 (36%), Gaps = 40/173 (23%)

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI 425
           +  + H+  + C+ +  +     SGS+D  IR++D++    L     H G +  +     
Sbjct: 100 FHFQAHSLSIKCLAVSRRYLV--SGSNDEHIRIYDLQKRKELGTLLSHQGSITAL----- 152

Query: 426 IDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSL 485
                                                +  E+  + K       LLS S 
Sbjct: 153 -------------------------------QFSHPASSSEDAAVSKGSKNSKWLLSASE 181

Query: 486 DNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 536
           D+ I +W V+  + + T  GH   V   DI   N   IS S D SI++W+L +
Sbjct: 182 DHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMT 234

>KLLA0F13244g 1224178..1226622 similar to sgd|S0004212 Saccharomyces
           cerevisiae YLR222c, start by similarity
          Length = 814

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 5/140 (3%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIWH 359
           +++   T S DKT ++WN   GE  +T   H   +  V    + K++ + S DKT+KIW 
Sbjct: 506 NDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWS 565

Query: 360 VESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQ 418
           +ES     TL GHT  V       K+    S   D  + +WD+ T   +K    H  ++ 
Sbjct: 566 LESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLSTGESVKTLDAHNNRIW 625

Query: 419 KVIPLTIIDAENLVVDNISG 438
            +  +   D E+ V  +  G
Sbjct: 626 ALAVMN--DGESFVTADADG 643

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 68/138 (49%), Gaps = 9/138 (6%)

Query: 256 VLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDK 313
            +++  N  L  T SYD T  IW+L   +    L+ H  G+  + F   +  L T S DK
Sbjct: 500 AISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDK 559

Query: 314 TIRVWNYKTGECISTYRGHTDSVMS---VDAFKKIIVSGSADKTVKIWHVES-RTCYTLR 369
           TI++W+ ++   + T  GHT++V     ++  K++I +G AD  V IW + +  +  TL 
Sbjct: 560 TIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTG-ADGLVIIWDLSTGESVKTLD 618

Query: 370 GHTE--WVNCVKLHPKSF 385
            H    W   V    +SF
Sbjct: 619 AHNNRIWALAVMNDGESF 636

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 90/234 (38%), Gaps = 53/234 (22%)

Query: 326 ISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIW--HVESRTCY---TLRGHTEWVNCV 378
           +  Y GHTD + S+DA      + + S D +V +W  H +    Y      GH   VN V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 379 KL---HPKSFTCF--SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVV 433
            L    P+S+  F  + S+D TI+ W                   KV  +T  + E+L++
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKW-------------------KVPKVTSDEPEDLIL 483

Query: 434 DNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWD 493
              S       E                             P  +   + S D T K+W+
Sbjct: 484 VKTSEYTRRAHEKDINAISIS--------------------PNDSLFATASYDKTCKIWN 523

Query: 494 VQTGQCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSGKCMHTFHG 545
           +  G+   T   H  G+WD+A   +   + + S D +IKIW L+S   + T  G
Sbjct: 524 LDDGEFQATLANHKRGLWDVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEG 577

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 49/99 (49%), Gaps = 4/99 (4%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           +LL T S D T+ IW L S  +++ L GHT+ V+   F     +L++   D  + +W+  
Sbjct: 550 KLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLS 609

Query: 322 TGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIW 358
           TGE + T   H + + ++      +  V+  AD   + W
Sbjct: 610 TGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/275 (20%), Positives = 98/275 (35%), Gaps = 37/275 (13%)

Query: 286 IRRLSGHTDGVKTL--YFDEAKLVTGSLDKTIRVWNYKTGE----CISTYRGHTDSVMSV 339
           ++   GHTD + +L    D   + T S D ++ +W Y          + + GH  SV +V
Sbjct: 383 VKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYHAKYEDFYPYTKFVGHVGSVNAV 442

Query: 340 D-------AFKKIIVSGSADKTVKIWHVESRTC-------------YTLRGHTEWVNCVK 379
                   ++ + I++ S D T+K W V   T              YT R H + +N + 
Sbjct: 443 GLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYTRRAHEKDINAIS 502

Query: 380 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS 439
           + P      + S D T ++W++           H           + D      D +  +
Sbjct: 503 ISPNDSLFATASYDKTCKIWNLDDGEFQATLANH--------KRGLWDVAFCQYDKLLAT 554

Query: 440 NEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQC 499
             GD                   +    Q     I     L+S   D  + +WD+ TG+ 
Sbjct: 555 CSGDKTIKIWSLESYAVVKTLEGHTNAVQRC-SFINKNKQLISTGADGLVIIWDLSTGES 613

Query: 500 IRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIW 532
           ++T   H   +W +A   D    ++   DG  + W
Sbjct: 614 VKTLDAHNNRIWALAVMNDGESFVTADADGFFEFW 648

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 4/77 (5%)

Query: 476 YPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWD 533
           Y   L +CS D TIK+W +++   ++T  GH   V        N ++IS   DG + IWD
Sbjct: 548 YDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWD 607

Query: 534 LQSGKCMHTF--HGKRL 548
           L +G+ + T   H  R+
Sbjct: 608 LSTGESVKTLDAHNNRI 624

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 86/228 (37%), Gaps = 36/228 (15%)

Query: 224 PWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLF--TGSYDSTVAIWDLC 281
           P      E F+   N      +V+ ++GH D + +L      L+  T S D +V +W   
Sbjct: 361 PTPTSSEEEFENGENKETFPIEVKMYEGHTDLLNSLDATADGLWVATASKDHSVILWRYH 420

Query: 282 SNK----LIRRLSGHTDGVKTLYFDEAK-------LVTGSLDKTIRVWNY---------- 320
           +         +  GH   V  +             ++T S D TI+ W            
Sbjct: 421 AKYEDFYPYTKFVGHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPED 480

Query: 321 ----KTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHV-ESRTCYTLRGHTE 373
               KT E   T R H   +  +S+     +  + S DKT KIW++ +     TL  H  
Sbjct: 481 LILVKTSEY--TRRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKR 538

Query: 374 --WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 419
             W      + K     SG  D TI++W + + + +K   GH   VQ+
Sbjct: 539 GLWDVAFCQYDKLLATCSG--DKTIKIWSLESYAVVKTLEGHTNAVQR 584

 Score = 36.6 bits (83), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 51/118 (43%), Gaps = 15/118 (12%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEA------KLVTGSLDKTIRVW 318
           LL  G  D +V++ D+ +  +   L GH   + ++ F         KL +G  +  I+VW
Sbjct: 115 LLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVW 174

Query: 319 NYKTGECISTYRGHTDSVMSVDAFKKI--------IVSGSADKTVKIWHVESRTCYTL 368
           +     C  T + HT +V  +D F+          ++SG  D  + ++   S   Y L
Sbjct: 175 DLVKRNCQCTIQEHTTAVRGLD-FRVTDEEKGTLQLLSGGRDNILNLFEFNSTKKYKL 231

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 45/107 (42%), Gaps = 23/107 (21%)

Query: 474 IPYPTHLLSC----------SLDNTIKLWDVQTGQCIRTQFGH------VEGVWDIAADN 517
           I  P ++++C            D ++ + D++ G    +  GH      V+   ++ ++ 
Sbjct: 100 ISSPVYVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEI 159

Query: 518 FRIISGSHDGSIKIWDLQSGKCMHTFH-------GKRLQPQDEEGST 557
           +++ SG  +G IK+WDL    C  T         G   +  DEE  T
Sbjct: 160 WKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEEKGT 206

>AER255C [2757] [Homologous to ScYDR364C (CDC40) - SH]
           (1107932..1109335) [1404 bp, 467 aa]
          Length = 467

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 80/174 (45%), Gaps = 16/174 (9%)

Query: 249 FKGHMDGVLTLQFNYR---LLFTGSYDSTVAIWDLCSNKLI-RRLSGHTDGVKTLYF--D 302
           + GH  G   L+F  +   L  +G  D  + IWD+   +L+ R   GH   +    F  D
Sbjct: 170 YDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHD 229

Query: 303 EAKLVTGSLDKTIRVWNYKTGECIS--TYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV 360
             +  + S DKT+++W+ +TG+ I+  +++   + +      K+ ++ G +D   KI H 
Sbjct: 230 NVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDS--KIRHF 287

Query: 361 ESR------TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
           + R             H   +N ++  P      S SDD +IR+W+ + N  +K
Sbjct: 288 DLRVDKKDGVIQIYDHHLAAINALRYFPDGSKFISSSDDKSIRIWENQINIPIK 341

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 107/276 (38%), Gaps = 29/276 (10%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK---LVTGSLDKTIRVWN-YKTGECISTYRGHTDSVMSV 339
           +++    GH  G   L F        ++G  D  +++W+ Y     +  Y GH  ++ S 
Sbjct: 165 RILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYHERLLLRDYCGHRKAI-SA 223

Query: 340 DAFKK---IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKS-FTCFSGSDDTT 395
            +F        S S DKTVKIW  E+             NC+  HP++      G  D+ 
Sbjct: 224 TSFSHDNVQFASSSYDKTVKIWDTETGDIINRLSFKATPNCMTFHPQNKEQLLVGFSDSK 283

Query: 396 IRMWDIRTN---SCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXX-XX 451
           IR +D+R +     ++++  H         L  I+A     D     +  DD+       
Sbjct: 284 IRHFDLRVDKKDGVIQIYDHH---------LAAINALRYFPDGSKFISSSDDKSIRIWEN 334

Query: 452 XXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTG--QCIRTQF-GH-- 506
                       D+      +  P      + S+DN+I ++ ++    +  R  F GH  
Sbjct: 335 QINIPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYKRHPRKAFRGHKS 394

Query: 507 --VEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCM 540
                ++DIA D   + +G   G + IWD ++ K +
Sbjct: 395 AGYNSMFDIAPDGRYVAAGDTSGRLFIWDWKTTKIL 430

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 9/84 (10%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQF-GHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 536
            LS   D  +K+WD+   + +   + GH + +     + DN +  S S+D ++KIWD ++
Sbjct: 190 FLSGGNDGVLKIWDMYHERLLLRDYCGHRKAISATSFSHDNVQFASSSYDKTVKIWDTET 249

Query: 537 GKCMHTFHGKR------LQPQDEE 554
           G  ++    K         PQ++E
Sbjct: 250 GDIINRLSFKATPNCMTFHPQNKE 273

>AGR180W [4491] [Homologous to ScYLR222C - SH]
           complement(1090647..1093067) [2421 bp, 806 aa]
          Length = 806

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 73/320 (22%), Positives = 117/320 (36%), Gaps = 82/320 (25%)

Query: 245 QVQEFKGHMDGVLTLQFNYRLLF--TGSYDSTVAIWDL----CSNKLIRRLSGHTDGVKT 298
           + + ++GH D + +L      L+  T S D +V +W       S +   +  GH   V  
Sbjct: 374 ETEMYEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNEASSSFEPFTKFLGHAGPVTA 433

Query: 299 LYFDEAK-------LVTGSLDKTIRVW---NYKTGECIS----------TYRGHTDSV-- 336
           +             L+T S D TI+ W   N    + I           T R H   +  
Sbjct: 434 IALPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIELPHIVKASEYTRRAHEKDINA 493

Query: 337 MSVDAFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVNCVKLHPKSFTCFSGSDDTT 395
           +S+     I  + S DKT KIW+V++     TL  H   +  V      +   + S D +
Sbjct: 494 ISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDWLLATCSGDRS 553

Query: 396 IRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXX 455
           I +W + + + LK   GH   VQ+             V  I+G+ +              
Sbjct: 554 INLWSLESFTVLKTLEGHTNAVQR-------------VSFINGNKQ-------------- 586

Query: 456 XXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA 515
                                   L+S   D  +K+WD  TG+C+RT   H   +W +A 
Sbjct: 587 ------------------------LVSTGADGLVKIWDCSTGECVRTLDAHNNRIWALAV 622

Query: 516 --DNFRIISGSHDGSIKIWD 533
             D   II+   DG  + W+
Sbjct: 623 ANDGQLIITADADGVFQFWE 642

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 85/218 (38%), Gaps = 20/218 (9%)

Query: 344 KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           +II +  A +  ++  +E+       GHT+ +N +          + S D ++ +W    
Sbjct: 357 RIIPTPQASEDKEVMEIETEM---YEGHTDLLNSLDATSDGLWLATASKDHSVILWRYNE 413

Query: 404 NSC----LKVFRGHVGQVQKVI---------PLTIIDAEN-LVVDNISGSNEGDDEPXXX 449
            S        F GH G V  +          P  ++ A N L +      N  D +    
Sbjct: 414 ASSSFEPFTKFLGHAGPVTAIALPNVMNRNWPEFLLTASNDLTIKRWKVPNPNDRKAIEL 473

Query: 450 XXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEG 509
                        ++++   +  S P  +   + S D T K+W+V TG+   T   H  G
Sbjct: 474 PHIVKASEYTRRAHEKDINAISMS-PNDSIFATASYDKTCKIWNVDTGEVEATLANHKRG 532

Query: 510 VWDIA--ADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           +W +A    ++ + + S D SI +W L+S   + T  G
Sbjct: 533 LWGVAFCEYDWLLATCSGDRSINLWSLESFTVLKTLEG 570

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 4/73 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 537
           L +CS D +I LW +++   ++T  GH   V  ++    N +++S   DG +KIWD  +G
Sbjct: 545 LATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCSTG 604

Query: 538 KCMHTF--HGKRL 548
           +C+ T   H  R+
Sbjct: 605 ECVRTLDAHNNRI 617

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 52/110 (47%), Gaps = 11/110 (10%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAK-----LVTGSLDKTIRVW 318
           LL  G  D +V ++D+ +  +   L GH   + ++ ++ E       L +G  +  +++W
Sbjct: 115 LLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIW 174

Query: 319 NYKTGECISTYRGHTDSVMSVD-----AFKKIIVSGSADKTVKIWHVESR 363
           +     CI T + HT +V  +D       + +++SG  D  V + H + +
Sbjct: 175 DLVKRRCIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDMK 224

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 65/151 (43%), Gaps = 14/151 (9%)

Query: 256 VLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDK 313
            L L  + R L   S +  +  +DL + +  R +   +     L  DE+   L  G  D 
Sbjct: 65  ALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAY-VLDCDESSTLLAVGGTDG 123

Query: 314 TIRVWNYKTGECISTYRGHTDSVMSVDAFKKI------IVSGSADKTVKIWHVESRTC-Y 366
           ++ V++   G    + +GH  ++ SV  + ++      + SG  +  VKIW +  R C +
Sbjct: 124 SVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRRCIH 183

Query: 367 TLRGHTEWVNCVKLH----PKSFTCFSGSDD 393
           T++ HT  V  + +      +S     G DD
Sbjct: 184 TVQEHTAAVRGLDIRVQEGAESLLLSGGRDD 214

 Score = 36.2 bits (82), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 39/87 (44%), Gaps = 16/87 (18%)

Query: 474 IPYPTHLLSC----------SLDNTIKLWDVQTGQCIRTQFGH------VEGVWDIAADN 517
           I  P ++L C            D ++ ++D+  G    +  GH      V+   ++ +  
Sbjct: 100 ISSPAYVLDCDESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGM 159

Query: 518 FRIISGSHDGSIKIWDLQSGKCMHTFH 544
           + + SG  +G +KIWDL   +C+HT  
Sbjct: 160 WLLASGDTNGMVKIWDLVKRRCIHTVQ 186

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 37/83 (44%), Gaps = 11/83 (13%)

Query: 249 FKGHMDGVLTLQF------NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF- 301
            KGH   + +++F         LL +G  +  V IWDL   + I  +  HT  V+ L   
Sbjct: 139 LKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAVRGLDIR 198

Query: 302 ----DEAKLVTGSLDKTIRVWNY 320
                E+ L++G  D  + V ++
Sbjct: 199 VQEGAESLLLSGGRDDVVHVHHF 221

>ACR091W [1138] [Homologous to ScYDR267C - SH]
           complement(520609..521595) [987 bp, 328 aa]
          Length = 328

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 75/154 (48%), Gaps = 19/154 (12%)

Query: 265 LLFTGSYDSTVAIWDL------CSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIR 316
           +L  GS+D+TV+IW           +L+  + GH + VK++ +  D A L T S DK++ 
Sbjct: 70  VLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCSRDKSVW 129

Query: 317 VWNY----KTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVES---RTCYT 367
           +W      +  EC S  + H+  V  +   A + ++ S S D TV+IW  +         
Sbjct: 130 IWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWECAAV 189

Query: 368 LRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
           L GH  T W +  +         SGSDDTT+R+W
Sbjct: 190 LSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 85/192 (44%), Gaps = 21/192 (10%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRL--SGHTDGVKTLYFDE 303
           V+  K H D   ++  +  LL TGS D  + + D+ + KL+  L  + H   V+++ +  
Sbjct: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDDTAHKKAVRSVAWRP 66

Query: 304 A--KLVTGSLDKTIRVWNYK------TGECISTYRGHTDSVMSVDAFK---KIIVSGSAD 352
               L  GS D T+ +W           E ++   GH + V SV A+      + + S D
Sbjct: 67  HCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSV-AWSHDGAYLATCSRD 125

Query: 353 KTVKIWHV----ESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN--S 405
           K+V IW      E   C + L+ H++ V  +  H       S S D T+R+W  + +   
Sbjct: 126 KSVWIWEADELSEEFECNSVLQEHSQDVKHIVWHASRLLLASSSYDDTVRIWAEQDDDWE 185

Query: 406 CLKVFRGHVGQV 417
           C  V  GH G V
Sbjct: 186 CAAVLSGHGGTV 197

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 91/229 (39%), Gaps = 34/229 (14%)

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR-----GHTEWVNCVKL 380
           + + + H D   SVD  K ++ +GSAD+ +K+  V+ R    +       H + V  V  
Sbjct: 7   VRSLKLHGDRCWSVDISKGLLATGSADRKIKL--VDVRNFKLVEELDDTAHKKAVRSVAW 64

Query: 381 HPKSFTCFSGSDDTTIRMWDIRTN------SCLKVFRGHVGQVQKVIPLTIIDAENLVV- 433
            P      +GS DTT+ +W    +        L V  GH  +V+ V      D   L   
Sbjct: 65  RPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSH--DGAYLATC 122

Query: 434 --DNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLL--SCSLDNTI 489
             D      E D+                    E +Q +   + + + LL  S S D+T+
Sbjct: 123 SRDKSVWIWEADELSEEFECNSVLQ--------EHSQDVKHIVWHASRLLLASSSYDDTV 174

Query: 490 KLWDVQTG--QCIRTQFGHVEGVW----DIAADNFRIISGSHDGSIKIW 532
           ++W  Q    +C     GH   VW    + A    R+ SGS D +++IW
Sbjct: 175 RIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 65/154 (42%), Gaps = 19/154 (12%)

Query: 285 LIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIR---VWNYKTGECISTYRGHTDSVMSVDA 341
           L+R L  H D   ++   +  L TGS D+ I+   V N+K  E +     H  +V SV A
Sbjct: 6   LVRSLKLHGDRCWSVDISKGLLATGSADRKIKLVDVRNFKLVEELDD-TAHKKAVRSV-A 63

Query: 342 FK---KIIVSGSADKTVKIW-------HVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGS 391
           ++    ++ +GS D TV IW         E+     + GH   V  V          + S
Sbjct: 64  WRPHCNVLAAGSFDTTVSIWGRDDDDYSGETELLAVIEGHENEVKSVAWSHDGAYLATCS 123

Query: 392 DDTTIRMWDIRTNS----CLKVFRGHVGQVQKVI 421
            D ++ +W+    S    C  V + H   V+ ++
Sbjct: 124 RDKSVWIWEADELSEEFECNSVLQEHSQDVKHIV 157

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 70/167 (41%), Gaps = 33/167 (19%)

Query: 265 LLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKTLYFDEA----KLVTGSLDKTIRVW 318
           LL + SYD TV IW    +  +    LSGH   V    F+ A    +L +GS D T+R+W
Sbjct: 164 LLASSSYDDTVRIWAEQDDDWECAAVLSGHGGTVWCSDFERAETGIRLCSGSDDTTVRIW 223

Query: 319 NYKTGECISTYRG----------HTDSVMSVD-AFKKIIVSGSADKTVKI--------WH 359
              T +     +           HT +V SV  +   +I S  +D  + +        W 
Sbjct: 224 RCLTDDADVFDKEWIQETVLPAVHTRAVYSVSWSADGLIASVGSDGVLAVYKEVQAGRWE 283

Query: 360 VESRT-CYTLRGHTEW-VNCVKLHP--KSFTCFSGSDDTTIRMWDIR 402
           V +R  C     HT + +N VK           +G DD  + +W++R
Sbjct: 284 VVARVDC----AHTVYEINVVKWLALDGRVLLVTGGDDGCVNVWELR 326

>KLLA0E21263g 1892524..1893813 similar to sp|P40968 Saccharomyces
           cerevisiae YDR364c CDC40 cell division control protein
           singleton, start by similarity
          Length = 429

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 83/184 (45%), Gaps = 20/184 (10%)

Query: 245 QVQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSNK-LIRRLSGHTDGVKTLY 300
           ++ E+ GH +G  +L+F      LL +G  D+ + +WD    + L+R   GH+  +K L 
Sbjct: 127 KIAEYYGHKNGTTSLRFIPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLN 186

Query: 301 FDEA--KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF----KKIIVSGSADKT 354
           F +      + S DK +++WN + G  I   R   +SV +   F    K  +V G ++  
Sbjct: 187 FTDNGHSFASASFDKWVKIWNTEKG--IIDKRLRFNSVPNCITFHPKDKNQLVVGLSNSE 244

Query: 355 VKIWHVESR------TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
           ++  H + R             H   +  +K  P      S S+D T+R+W+ R N  +K
Sbjct: 245 IR--HYDLRLSENHGEVQKYDHHQGSILALKYFPDGKKLISSSEDKTVRIWENRINIPIK 302

Query: 409 VFRG 412
              G
Sbjct: 303 QISG 306

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 4/68 (5%)

Query: 474 IPYPTHLL-SCSLDNTIKLWDV-QTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSI 529
           IP   HLL S   DN IKLWD     + +RT  GH   + D+    +     S S D  +
Sbjct: 144 IPKTGHLLLSGGNDNIIKLWDFYHERELLRTYEGHSMTIKDLNFTDNGHSFASASFDKWV 203

Query: 530 KIWDLQSG 537
           KIW+ + G
Sbjct: 204 KIWNTEKG 211

>YOR272W (YTM1) [5058] chr15 (832810..834192) Microtubule-associated
           protein essential for the G1/S transition, member of WD
           (WD-40) repeat family [1383 bp, 460 aa]
          Length = 460

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 76/313 (24%), Positives = 125/313 (39%), Gaps = 51/313 (16%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKTIRVW------ 318
           + +GSYD  V  WDL  N + ++ SGH+  ++ + Y    +LV+   D+T+R+W      
Sbjct: 118 IISGSYDGIVRTWDLSGN-VQKQYSGHSGPIRAVKYISNTRLVSAGNDRTLRLWKTKNDD 176

Query: 319 -----------------NYKTGECISTYRGHTDSVMSVDAF-KKIIVSGSADKTVKIWHV 360
                            N + G+ ++   GH   V+S+D      I+S S D ++  W  
Sbjct: 177 LKLTSQQQAQEDDDDEVNIEDGKTLAILEGHKAPVVSIDVSDNSRILSASYDNSIGFWST 236

Query: 361 ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWD--IRTNSCLKVFRGHVGQVQ 418
             +   T+    E +N    +P +    +      + M D  IR  + L +   H   V+
Sbjct: 237 IYKEM-TVVDPLEDIN----NPNNKISTAARKRRKLTMKDGTIRRRAPLSLLESHTAPVE 291

Query: 419 KVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT 478
           +V    I D+     DN  G +   D                         L  +     
Sbjct: 292 QV----IFDS----TDNTVGYSVSQDHTIKTWDLVTARCIDTRTT--SYSLLSIAQLSTL 341

Query: 479 HLLSC-SLDNTIKLWDVQTGQCIRTQ----FGHVEGV--WDIAADNFRII-SGSHDGSIK 530
           +LL+C S    I L D + G   +       GH   V   D   +N  I+ SGSHDG++K
Sbjct: 342 NLLACGSSARHITLHDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVK 401

Query: 531 IWDLQSGKCMHTF 543
           +WD++S   M+T 
Sbjct: 402 VWDVRSTSPMYTI 414

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 66/142 (46%), Gaps = 12/142 (8%)

Query: 289 LSGHTDGVKTLYFDEAKLVTG---SLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK-- 343
           L  HT  V+ + FD      G   S D TI+ W+  T  CI T R  + S++S+      
Sbjct: 283 LESHTAPVEQVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDT-RTTSYSLLSIAQLSTL 341

Query: 344 KIIVSGSADKTV-----KIWHVESRTCYTLRGHTEWVNCVKLHPKS-FTCFSGSDDTTIR 397
            ++  GS+ + +     ++      T   L GH  +V+ +   P++ +   SGS D T++
Sbjct: 342 NLLACGSSARHITLHDPRVGASSKVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVK 401

Query: 398 MWDIRTNSCLKVFRGHVGQVQK 419
           +WD+R+ S +         VQK
Sbjct: 402 VWDVRSTSPMYTITREDKSVQK 423

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 84/228 (36%), Gaps = 29/228 (12%)

Query: 335 SVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDT 394
           S + V    K I+SGS D  V+ W +         GH+  +  VK +  +    S  +D 
Sbjct: 107 SSLDVGDGSKHIISGSYDGIVRTWDLSGNVQKQYSGHSGPIRAVK-YISNTRLVSAGNDR 165

Query: 395 TIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXX 454
           T+R+W  + N  LK+      Q      + I D + L +       EG   P        
Sbjct: 166 TLRLWKTK-NDDLKLTSQQQAQEDDDDEVNIEDGKTLAI------LEGHKAPVVSIDVSD 218

Query: 455 XXXXXXXXND----------EENQTLD--KSIPYPTHLLSCSLDNTIKLWDVQTGQCIR- 501
                    D          +E   +D  + I  P + +S +     KL  ++ G   R 
Sbjct: 219 NSRILSASYDNSIGFWSTIYKEMTVVDPLEDINNPNNKISTAARKRRKL-TMKDGTIRRR 277

Query: 502 -------TQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHT 542
                  +    VE V   + DN    S S D +IK WDL + +C+ T
Sbjct: 278 APLSLLESHTAPVEQVIFDSTDNTVGYSVSQDHTIKTWDLVTARCIDT 325

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 373 EWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           +WV+ + +   S    SGS D  +R WD+  N   K + GH G ++ V
Sbjct: 104 DWVSSLDVGDGSKHIISGSYDGIVRTWDLSGN-VQKQYSGHSGPIRAV 150

 Score = 30.4 bits (67), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 512 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           D+   +  IISGS+DG ++ WDL SG     + G
Sbjct: 110 DVGDGSKHIISGSYDGIVRTWDL-SGNVQKQYSG 142

>Kwal_56.24163
          Length = 729

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 62/120 (51%), Gaps = 10/120 (8%)

Query: 272 DSTVAIWDLCSNKLIRRLSGH-TDGVKTLYF----DEAKLVTGSLDKTIRVWNYKTGECI 326
           D TV IW L        L  H T GV  + +    D+  L+T S D+T+++W+Y+T  C+
Sbjct: 19  DHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCV 78

Query: 327 STYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHP 382
           +T  GH  +V S   F     II+SGS D T+K+W+  + +   TL    E   C+  HP
Sbjct: 79  ATLEGHMANV-SYAVFHPSLPIILSGSEDGTLKVWNSNTYKLEKTLNLGLERSWCIATHP 137

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGH-TDSVMSVDAF----KKIIVSGSADKTVK 356
           D +   +  LD T+++W+        T + H T  V  VD +    K  +++ S D+TVK
Sbjct: 9   DPSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVK 68

Query: 357 IWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           IW  ++++C  TL GH   V+    HP      SGS+D T+++W+  T
Sbjct: 69  IWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 50/104 (48%), Gaps = 16/104 (15%)

Query: 346 IVSGSADKTVKIWHVESRTC-YTLRGH-TEWVNCVKLHPKSFTCF--SGSDDTTIRMWDI 401
             S   D TVKIW +   T  +TL+ H T  VN V  +P     +  + SDD T+++WD 
Sbjct: 13  FASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDY 72

Query: 402 RTNSCLKVFRGHVGQVQKVI---PLTIIDAENLVVDNISGSNEG 442
           +T SC+    GH+  V   +    L II         +SGS +G
Sbjct: 73  QTKSCVATLEGHMANVSYAVFHPSLPII---------LSGSEDG 107

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV-WDIAADNFRII-SGSHDGSIKIWDLQS 536
           +L++ S D T+K+WD QT  C+ T  GH+  V + +   +  II SGS DG++K+W+  +
Sbjct: 57  YLITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

Query: 537 GKCMHTFH 544
            K   T +
Sbjct: 117 YKLEKTLN 124

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 5/74 (6%)

Query: 477 PTHLLSCSLDNTIKLWDV-QTGQCIRTQFGHVEGV----WDIAADNFRIISGSHDGSIKI 531
           P+   S  LD+T+K+W + Q       Q     GV    +    D   +I+ S D ++KI
Sbjct: 10  PSTFASACLDHTVKIWSLGQPTANFTLQAHETRGVNYVDYYPLQDKPYLITSSDDRTVKI 69

Query: 532 WDLQSGKCMHTFHG 545
           WD Q+  C+ T  G
Sbjct: 70  WDYQTKSCVATLEG 83

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKT 322
           L T S D TV IWD  +   +  L GH   V    F  +   +++GS D T++VWN  T
Sbjct: 58  LITSSDDRTVKIWDYQTKSCVATLEGHMANVSYAVFHPSLPIILSGSEDGTLKVWNSNT 116

>Scas_685.11
          Length = 384

 Score = 58.5 bits (140), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 66/156 (42%), Gaps = 28/156 (17%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVT 308
           F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F ++K   
Sbjct: 37  FQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKSKTEN 96

Query: 309 GSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCY-T 367
           G  + +   W                           ++S S D  + IW V+    + T
Sbjct: 97  GDGEGSNNKW---------------------------LLSASEDNKIIIWRVKDWENFGT 129

Query: 368 LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           L+GH   +N V +HP +    S S+D +IR+W++ T
Sbjct: 130 LKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMT 165

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 49/108 (45%), Gaps = 14/108 (12%)

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKLHPKS 384
           I  ++ H  SV  +D  K+ +VSGS D+ ++I+ ++ R    TL  H   +  +K   KS
Sbjct: 34  IFHFQAHALSVKCLDVSKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKF-SKS 92

Query: 385 FT------------CFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
            T              S S+D  I +W ++        +GH+ ++  V
Sbjct: 93  KTENGDGEGSNNKWLLSASEDNKIIIWRVKDWENFGTLKGHIARINDV 140

 Score = 38.1 bits (87), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 65/175 (37%), Gaps = 44/175 (25%)

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI 425
           +  + H   V C+ +  +     SGS+D  IR++D++    L     H G +   +  + 
Sbjct: 35  FHFQAHALSVKCLDVSKRYLV--SGSNDEHIRIYDLQKRKELGTLLAHQGSITN-LKFSK 91

Query: 426 IDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSL 485
              EN       G  EG +                                   LLS S 
Sbjct: 92  SKTEN-------GDGEGSNNKW--------------------------------LLSASE 112

Query: 486 DNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGK 538
           DN I +W V+  +   T  GH+  +   DI   N   IS S D SI++W+L + K
Sbjct: 113 DNKIIIWRVKDWENFGTLKGHIARINDVDIHPSNRVAISVSEDHSIRLWNLMTVK 167

>Scas_692.29
          Length = 456

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 127/310 (40%), Gaps = 45/310 (14%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVW---- 318
           + + T SYD  +  W+L S K+ ++ SGH+  ++ + F  + +LV+   D+T+R+W    
Sbjct: 116 KAIITASYDGVIRTWNL-SGKVQKQYSGHSGPIRAVKFISDTRLVSAGNDRTLRLWKTKN 174

Query: 319 ---------------NYKTGECISTYRGHTDSVMSVDAFKKI-IVSGSADKTVKIWHVES 362
                          N + G+ ++   GH   V+S+D      I+S S D ++ +W    
Sbjct: 175 NDSVVQHFDEEDEEANIEDGKTLAILEGHKAPVVSLDVSNTSRILSSSYDNSIGLWSTIY 234

Query: 363 RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP 422
           +    +    E  N      K  T        T++   IR  + L +   H   V++   
Sbjct: 235 KEMTVVDPMEEINNA---DNKISTAARKRRKLTLKDGTIRRRAPLSLLESHTAPVEQ--- 288

Query: 423 LTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT-HLL 481
                A   + D+  G +   D                        +L +    PT +LL
Sbjct: 289 -----ASFDINDDTVGYSVSQDHTIKTWDLVTARCIDTKTTSYSLLSLTQ---LPTLNLL 340

Query: 482 SC-SLDNTIKLWDVQTGQCIR-TQ---FGHVEGV--WDIAADNFRII-SGSHDGSIKIWD 533
           +C S    I L D + G   + TQ    GH   V   D   +N  I+ SGSHDG++K+WD
Sbjct: 341 ACGSSARHITLHDPRMGASSKVTQHQLIGHKNFVVSLDTCPENEYILCSGSHDGTVKVWD 400

Query: 534 LQSGKCMHTF 543
           ++S   M+T 
Sbjct: 401 VRSTAPMYTI 410

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 335 SVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDT 394
           S + V   KK I++ S D  ++ W++  +      GH+  +  VK    +    S  +D 
Sbjct: 107 SSIDVSQDKKAIITASYDGVIRTWNLSGKVQKQYSGHSGPIRAVKFISDT-RLVSAGNDR 165

Query: 395 TIRMWDIRTNSCL 407
           T+R+W  + N  +
Sbjct: 166 TLRLWKTKNNDSV 178

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 512 DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           D++ D   II+ S+DG I+ W+L SGK    + G
Sbjct: 110 DVSQDKKAIITASYDGVIRTWNL-SGKVQKQYSG 142

>Kwal_33.15136
          Length = 473

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 130/323 (40%), Gaps = 58/323 (17%)

Query: 251 GHMDGVLTLQFNYRLL---FTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF------ 301
           GH DGV T+  NY +L    T S D  V  W++ + + +     H   +  L        
Sbjct: 65  GHRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFKAHYGLIHGLCVTPQHLS 124

Query: 302 ---DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKII------------ 346
              +E  +++   D+T+++W+  T +  S+ RG  + + S +   K              
Sbjct: 125 QNKNENYMLSCGDDRTVKLWSVNTDD-FSSERGDEEVIKSGNGLIKTFHGEHAFLGIDHH 183

Query: 347 ------VSGSADKTVKIW-HVESRTCYTLRGHTEWVNCVKLHPKSFTCF-SGSDDTTIRM 398
                 V+G A+  + +W    SR    L    + V+ VK +      F S   D ++ +
Sbjct: 184 RSNSNFVTGGAE--INLWDSTRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVL 241

Query: 399 WDIRTNSCLKVFRGHVGQVQKVIPLTI----IDAENLVVDNISGSNEGDDEPXXXXXXXX 454
           +D+RTNS  + F      VQK+    +    ++A N VV N       +D          
Sbjct: 242 YDLRTNSPTQKF------VQKMRTNALCWNPMEAYNFVVAN-------EDHNAYYYDMRN 288

Query: 455 XXXXXXXXNDEENQTLDKSI-PYPTHLLSCSLDNTIKLWDVQTGQCIR----TQFGHVEG 509
                    D  +  +D    P    +++ S D TI+++ V+ G         +  HV  
Sbjct: 289 LSRALHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSREIYHTKRMQHVFQ 348

Query: 510 VWDIAADNFRIISGSHDGSIKIW 532
           V     D+  I+SGS DG++++W
Sbjct: 349 V-KYTMDSRYIVSGSDDGNVRMW 370

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK-----KIIVSGSADKTVKIWH 359
           ++VTGS DKTIR++  K G     Y  HT  +  V   K     + IVSGS D  V++W 
Sbjct: 314 EIVTGSYDKTIRIYQVKHGHSREIY--HTKRMQHVFQVKYTMDSRYIVSGSDDGNVRMWR 371

Query: 360 VES 362
            ++
Sbjct: 372 AKA 374

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 39/81 (48%), Gaps = 9/81 (11%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY-----F 301
           FK H+  V+ + F+     + TGSYD T+ I+ +       R   HT  ++ ++      
Sbjct: 296 FKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGH--SREIYHTKRMQHVFQVKYTM 353

Query: 302 DEAKLVTGSLDKTIRVWNYKT 322
           D   +V+GS D  +R+W  K 
Sbjct: 354 DSRYIVSGSDDGNVRMWRAKA 374

>CAGL0M06193g 643917..644867 similar to sp|P38123 Saccharomyces
           cerevisiae YBR175w, start by similarity
          Length = 316

 Score = 57.8 bits (138), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 88/191 (46%), Gaps = 25/191 (13%)

Query: 246 VQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-- 301
           +    GH   V++L +N +  LLFT S D ++ +WD+ +  +++ +S H++ V ++    
Sbjct: 89  LHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSD 148

Query: 302 -DEAKLVTGSLDKTIRVWNYKTGECIST------YRGHTDSV----MSVDAFKKIIVSGS 350
            D + L +GS D  IR+++  TG C+ T      ++  T  V    +   A  K ++  S
Sbjct: 149 NDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKS 208

Query: 351 ADKTVKIW-HVESRTCYTLRGHTEWVNCVK------LHPKSF---TCFSGSDDTTIRMWD 400
            D  VKIW  V      T +   +  N         ++P+S       SG +   I  WD
Sbjct: 209 YDGVVKIWDSVSGDVVRTFKPSNKKYNLTHCCGMDFMYPQSTQSPLILSGYEKGEIYCWD 268

Query: 401 IRTNSCLKVFR 411
             T + L+V +
Sbjct: 269 SNTKAELQVLK 279

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 70/141 (49%), Gaps = 14/141 (9%)

Query: 285 LIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF 342
           L+ RL GHT  V +L ++     L T S+D++I+VW+  TG  + T   H++ V+S+D  
Sbjct: 88  LLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLS 147

Query: 343 ---KKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSG-------- 390
                I+ SGS D  ++I+   +  C  TL    +W +   + P +   FS         
Sbjct: 148 DNDGSILSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVK 207

Query: 391 SDDTTIRMWDIRTNSCLKVFR 411
           S D  +++WD  +   ++ F+
Sbjct: 208 SYDGVVKIWDSVSGDVVRTFK 228

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 43/67 (64%), Gaps = 3/67 (4%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRII-SGSHDGSIKIWDLQS 536
           L + S+D +IK+WDV TG  ++T   H E V   D++ ++  I+ SGSHDG I+I+D  +
Sbjct: 111 LFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLIRIFDTAT 170

Query: 537 GKCMHTF 543
           G C+ T 
Sbjct: 171 GHCLKTL 177

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 81/210 (38%), Gaps = 60/210 (28%)

Query: 344 KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           K I S S D TV + H +    + L GHT  V  +  + K    F+ S D +I++WD+ T
Sbjct: 68  KCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISLCYNNKGNLLFTSSMDESIKVWDVLT 127

Query: 404 NSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXN 463
            + +K    H        P+  ID      DN                            
Sbjct: 128 GTVMKTMSAHSE------PVVSIDLS----DN---------------------------- 149

Query: 464 DEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRT-----QFGHVEGVWDIAADNF 518
                  D SI     L S S D  I+++D  TG C++T      +    GV  IA   F
Sbjct: 150 -------DGSI-----LSSGSHDGLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKF 197

Query: 519 R-----IISGSHDGSIKIWDLQSGKCMHTF 543
                 ++  S+DG +KIWD  SG  + TF
Sbjct: 198 SANTKYLLVKSYDGVVKIWDSVSGDVVRTF 227

>KLLA0E07073g 645766..647124 similar to sp|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I subunit
           2 required for mRNA 3 -end processing, bridges two mRNA
           3 -end processing factors singleton, start by similarity
          Length = 452

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 67/166 (40%), Gaps = 5/166 (3%)

Query: 252 HMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTG 309
           H+   LT     R L   +Y+   ++W   S      +  H   V  + +      +V+G
Sbjct: 82  HVIPALTWTPEGRRLVVATYNGEFSLWSGSSFNFESIMQAHDSAVTVMTYSHTGDWMVSG 141

Query: 310 SLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES-RTCY 366
           S D  +++W           + H + V  +S     +  VS S D  +KIW+  + +   
Sbjct: 142 SADGELKIWQPNFNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQER 201

Query: 367 TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
            L GH   V     HPK     SGS D  I+ WD R+ SC+    G
Sbjct: 202 VLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKFWDPRSGSCVSTMLG 247

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 86/162 (53%), Gaps = 11/162 (6%)

Query: 250 KGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT--LYFDEAK 305
           + HM+ V  + F+   +   + S D+ + IW+  + +  R LSGH   VK+   +     
Sbjct: 162 QAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGL 221

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK---IIVSGSADKTVKIWHV-- 360
           +V+GS D  I+ W+ ++G C+ST  G   +++S     K   ++   S DKT K++ +  
Sbjct: 222 IVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQ 281

Query: 361 ESRTCYTLRGHTEWVNCVKLHPKSFTCFS-GSDDTTIRMWDI 401
           +++  +++R   +++  ++ HP   T F+ G  D +I+ +D+
Sbjct: 282 QAKELFSVRDDVDYM-TLQWHPIDETVFTVGCYDGSIKHFDL 322

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 40/76 (52%), Gaps = 8/76 (10%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSI 529
           P     +SCS DN +K+W+   GQ  R   GH    WD+ + ++      I+SGS D  I
Sbjct: 175 PTDQKFVSCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLI 231

Query: 530 KIWDLQSGKCMHTFHG 545
           K WD +SG C+ T  G
Sbjct: 232 KFWDPRSGSCVSTMLG 247

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 49/113 (43%), Gaps = 5/113 (4%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI---IVSGSADKTVKIWHVE 361
           +LV  + +    +W+  +    S  + H DS ++V  +      +VSGSAD  +KIW   
Sbjct: 95  RLVVATYNGEFSLWSGSSFNFESIMQAH-DSAVTVMTYSHTGDWMVSGSADGELKIWQPN 153

Query: 362 SRTCYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
                 + + H E V  +   P      S SDD  +++W+       +V  GH
Sbjct: 154 FNMVKVMDQAHMECVREISFSPTDQKFVSCSDDNVLKIWNFSNGQQERVLSGH 206

>KLLA0B14410g 1264616..1266736 similar to sp|P36037 Saccharomyces
           cerevisiae YKL213c DOA1 involved in ubiquitin-dependent
           proteolysis, start by similarity
          Length = 706

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 51/190 (26%), Positives = 89/190 (46%), Gaps = 23/190 (12%)

Query: 242 GNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIR-RLSGHTDGV-KTL 299
           G   V    GH   + +L  ++  L + S+D T  +W   +N +++  L GH+  V    
Sbjct: 89  GQEPVYTLVGHEGNICSLSGDFESLVSSSWDKTAKVW---TNGIVKWELKGHSASVWDAK 145

Query: 300 YFDEAKLVTGSLDKTIRVWNYKTGECISTY-RGHTDSVMSVDAFK--KIIVSGSADKTVK 356
             ++  ++T S D T+++W  K G    T+ + H+D V ++      K  VS S D T+K
Sbjct: 146 LLNDGSVLTASADTTVKLW--KNGTLAKTFDKLHSDVVRNICILDDGKHFVSCSNDGTLK 203

Query: 357 IWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQ 416
           + ++E    +   GH  +V  VK  P S    S  +D T+R+W++             G 
Sbjct: 204 LSNLEGGILHEFIGHESFVYAVKQLP-SGDIVSCGEDRTVRIWNMD------------GT 250

Query: 417 VQKVIPLTII 426
           +++VI L  I
Sbjct: 251 IKQVITLPAI 260

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/194 (26%), Positives = 89/194 (45%), Gaps = 15/194 (7%)

Query: 248 EFKGHMDGVLTLQF-NYRLLFTGSYDSTVAIWDLCS-NKLIRRLSGHTDGVKTL-YFDEA 304
           E KGH   V   +  N   + T S D+TV +W   +  K   +L  H+D V+ +   D+ 
Sbjct: 133 ELKGHSASVWDAKLLNDGSVLTASADTTVKLWKNGTLAKTFDKL--HSDVVRNICILDDG 190

Query: 305 K-LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI-IVSGSADKTVKIWHVES 362
           K  V+ S D T+++ N + G  +  + GH   V +V       IVS   D+TV+IW+++ 
Sbjct: 191 KHFVSCSNDGTLKLSNLEGG-ILHEFIGHESFVYAVKQLPSGDIVSCGEDRTVRIWNMDG 249

Query: 363 --RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
             +   TL   + W   V + P       GS D  IR++    N      +  +  +QK 
Sbjct: 250 TIKQVITLPAISIW--TVDVLPNG-DIVVGSSDKIIRIF--TENEQRLASQEEITSLQKQ 304

Query: 421 IPLTIIDAENLVVD 434
           +  + ++A+ +  D
Sbjct: 305 VEESAVNAQTMGFD 318

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 76/328 (23%), Positives = 133/328 (40%), Gaps = 40/328 (12%)

Query: 248 EFKGHMDGVLTL-QFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDG---------VK 297
           + +GH   V ++   +   + + S D TV IW+L ++       G+ +G         V 
Sbjct: 7   QLRGHTQDVRSVVSLSTTQVASASRDGTVRIWNLDAD-------GNWEGSIAFSSEKFVN 59

Query: 298 TLYFDEAK--LVTGSLDKTIRVWNYKTG---ECISTYRGHTDSVMSVDAFKKIIVSGSAD 352
           +L +D  +  L  G  +K I   +       E + T  GH  ++ S+    + +VS S D
Sbjct: 60  SLTYDAKQCVLFCGGQEKIIYGVSPLLALGQEPVYTLVGHEGNICSLSGDFESLVSSSWD 119

Query: 353 KTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF-R 411
           KT K+W       + L+GH+  V   KL     +  + S DTT+++W  +  +  K F +
Sbjct: 120 KTAKVW-TNGIVKWELKGHSASVWDAKLLNDG-SVLTASADTTVKLW--KNGTLAKTFDK 175

Query: 412 GHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLD 471
            H   V+ +  L   D ++ V    S SN+G                      E      
Sbjct: 176 LHSDVVRNICILD--DGKHFV----SCSNDG----TLKLSNLEGGILHEFIGHESFVYAV 225

Query: 472 KSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI-AADNFRIISGSHDGSIK 530
           K +P    ++SC  D T+++W++  G   +        +W +    N  I+ GS D  I+
Sbjct: 226 KQLP-SGDIVSCGEDRTVRIWNMD-GTIKQVITLPAISIWTVDVLPNGDIVVGSSDKIIR 283

Query: 531 IWDLQSGKCMHTFHGKRLQPQDEEGSTH 558
           I+     +         LQ Q EE + +
Sbjct: 284 IFTENEQRLASQEEITSLQKQVEESAVN 311

>CAGL0M08646g 861488..862501 similar to tr|Q05583 Saccharomyces
           cerevisiae YDR267c, start by similarity
          Length = 337

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 75/158 (47%), Gaps = 23/158 (14%)

Query: 265 LLFTGSYDSTVAIW---DL-------CSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLD 312
           LL  GS+DST++IW   DL          +L+  + GH + VK + +  D   L T S D
Sbjct: 73  LLAAGSFDSTISIWTQSDLDLEEGAKLEMELLAIIEGHENEVKGISWSQDGCLLATCSRD 132

Query: 313 KTIRVWNYKTG----ECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIW--HVESRT 364
           K++ +W         ECIS  + H+  V  V    K  ++ S S D TV+IW  + +   
Sbjct: 133 KSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWKDYDDDWE 192

Query: 365 CYT-LRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
           C   L GH  T W +            SGSDD+T+R+W
Sbjct: 193 CAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 94/225 (41%), Gaps = 30/225 (13%)

Query: 332 HTDSVMSVD--AFKKIIVSGSADKTVKIWHVESRTCYTL-----RGHTEWVNCVKLHPKS 384
           H D V S+D    + ++ +GS D+ +K+  +++     L       H + V  V   P S
Sbjct: 12  HNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNGKENLLDVLDDTVHKKAVRSVAWRPHS 71

Query: 385 FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEG-- 442
               +GS D+TI +W   T S L +  G   +++    L II+     V  IS S +G  
Sbjct: 72  DLLAAGSFDSTISIW---TQSDLDLEEGAKLEME---LLAIIEGHENEVKGISWSQDGCL 125

Query: 443 -----DDEPXXXXXXXXXXXXXXXXN--DEENQTLDKSIPYPTH--LLSCSLDNTIKLWD 493
                 D+                 +   E +Q +   + +  H  L S S D+T+++W 
Sbjct: 126 LATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHVVWHTKHNLLASSSYDDTVRIWK 185

Query: 494 --VQTGQCIRTQFGHVEGVW--DIA--ADNFRIISGSHDGSIKIW 532
                 +C     GH   +W  D +   D  R+ SGS D ++++W
Sbjct: 186 DYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVRVW 230

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 263 YRLLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKTLYF----DEAKLVTGSLDKTIR 316
           + LL + SYD TV IW    +  +    L+GH   +    F    D  +L +GS D T+R
Sbjct: 169 HNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGSDDSTVR 228

Query: 317 VWNY 320
           VW Y
Sbjct: 229 VWKY 232

>KLLA0E21879g complement(1944865..1945866) similar to sgd|S0002675
           Saccharomyces cerevisiae YDR267c, start by similarity
          Length = 333

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 76/159 (47%), Gaps = 25/159 (15%)

Query: 265 LLFTGSYDSTVAIW-----------DLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSL 311
           +L  GS+DSTV+IW           DL   +L+  + GH + +K + +  D   L T S 
Sbjct: 71  ILAAGSFDSTVSIWGKDDDGYNDENDL-ETELLAIIEGHENEIKCVAWSHDGELLATCSR 129

Query: 312 DKTIRVWNY----KTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWH---VES 362
           DK++ +W      +  ECIS  + H+  V  V   +   ++ S S D TV+IW     + 
Sbjct: 130 DKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWHQSLPLLASSSYDDTVRIWKDCDDDW 189

Query: 363 RTCYTLRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
             C  L GH  T W +  +    +    SGSDD T+R+W
Sbjct: 190 ECCAVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIW 228

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 76/169 (44%), Gaps = 26/169 (15%)

Query: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSN----KLIRRLSGHTDGVKTLYFD 302
            +GH + +  + +++   LL T S D +V IW+        + I  L  H+  VK + + 
Sbjct: 105 IEGHENEIKCVAWSHDGELLATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVIWH 164

Query: 303 EAK--LVTGSLDKTIRVWNY--KTGECISTYRGHTDSVMSVDAFKKI-----IVSGSADK 353
           ++   L + S D T+R+W       EC +   GH  +V S D F+K      + SGS D 
Sbjct: 165 QSLPLLASSSYDDTVRIWKDCDDDWECCAVLNGHEGTVWSSD-FEKSNSNVRLCSGSDDG 223

Query: 354 TVKIWHVES----------RTCYTLRGHTEWVNCVKLHPKSFTCFSGSD 392
           TV+IW +E           +     + HT  V  V   PK +   +GSD
Sbjct: 224 TVRIWCLEDDNGEYEQEWIQESILPKAHTRAVYSVNWSPKGYIASTGSD 272

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/279 (21%), Positives = 107/279 (38%), Gaps = 79/279 (28%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAKLV-TGSLDKTIRVWNYKTGECISTY--RGHTDSVMSVD 340
           KL++ L+ H D   ++  +   ++ TGS D+ I++ + ++ + I       H  +V SV 
Sbjct: 5   KLLKSLALHDDKCWSVDVNNGGIMATGSTDRKIKLVDIRSFQIIEELDDTAHKKTVRSV- 63

Query: 341 AFK---KIIVSGSADKTVKIW-----------HVESRTCYTLRGHTEWVNCVKLHPKSFT 386
           A++    I+ +GS D TV IW            +E+     + GH   + CV        
Sbjct: 64  AWRPHSNILAAGSFDSTVSIWGKDDDGYNDENDLETELLAIIEGHENEIKCVAWSHDGEL 123

Query: 387 CFSGSDDTTIRMWDI----RTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEG 442
             + S D ++ +W+         C+ V + H   V+ VI                     
Sbjct: 124 LATCSRDKSVWIWEADEMGEEFECISVLQEHSQDVKHVI--------------------- 162

Query: 443 DDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDV--QTGQCI 500
                                        +S+P    L S S D+T+++W       +C 
Sbjct: 163 ---------------------------WHQSLPL---LASSSYDDTVRIWKDCDDDWECC 192

Query: 501 RTQFGHVEGVW----DIAADNFRIISGSHDGSIKIWDLQ 535
               GH   VW    + +  N R+ SGS DG+++IW L+
Sbjct: 193 AVLNGHEGTVWSSDFEKSNSNVRLCSGSDDGTVRIWCLE 231

>YDR267C (YDR267C) [1100] chr4 complement(1002502..1003494) Protein
           containing seven WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to WD40 protein Ciao1 (human CIAO1), which
           binds and inhibits Wilms tumor suppressor protein (human
           WT1) transactivation activity [993 bp, 330 aa]
          Length = 330

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 74/155 (47%), Gaps = 20/155 (12%)

Query: 265 LLFTGSYDSTVAIWDLCSNK-------LIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTI 315
           LL  GS+DSTV+IW    +        L+  + GH + VK + +  D   L T S DK++
Sbjct: 72  LLAAGSFDSTVSIWAKEESADRTFEMDLLAIIEGHENEVKGVAWSNDGYYLATCSRDKSV 131

Query: 316 RVWNYKTG----ECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIW--HVESRTCYT 367
            +W         ECIS  + H+  V  V     + ++ S S D TV+IW  + +   C  
Sbjct: 132 WIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDTVRIWKDYDDDWECVA 191

Query: 368 -LRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
            L GH  T W +        F   SGSDD+T+R+W
Sbjct: 192 VLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 94/230 (40%), Gaps = 33/230 (14%)

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTL------RGHTEWVNCVK 379
           I + + + + + S D  + I+ +GS D+ +K+  V+    +TL        H + +  V 
Sbjct: 7   IKSLKLYKEKIWSFDFSQGILATGSTDRKIKLVSVKYDD-FTLIDVLDETAHKKAIRSVA 65

Query: 380 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS 439
             P +    +GS D+T+ +W  +  S  + F   +        L II+     V  ++ S
Sbjct: 66  WRPHTSLLAAGSFDSTVSIW-AKEESADRTFEMDL--------LAIIEGHENEVKGVAWS 116

Query: 440 NEGDDEPXXXXXXXXXXXXXXXXNDE---------ENQTLDKSIPYPTHLL--SCSLDNT 488
           N+G                     +E          +Q +   I +P+  L  S S D+T
Sbjct: 117 NDGYYLATCSRDKSVWIWETDESGEEYECISVLQEHSQDVKHVIWHPSEALLASSSYDDT 176

Query: 489 IKLWDV--QTGQCIRTQFGHVEGVWDIAADN----FRIISGSHDGSIKIW 532
           +++W       +C+    GH   VW    D     FR+ SGS D ++++W
Sbjct: 177 VRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 6/62 (9%)

Query: 265 LLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKTLYFDEA----KLVTGSLDKTIRVW 318
           LL + SYD TV IW    +  + +  L+GH   V +  FD+     +L +GS D T+RVW
Sbjct: 167 LLASSSYDDTVRIWKDYDDDWECVAVLNGHEGTVWSSDFDKTEGVFRLCSGSDDSTVRVW 226

Query: 319 NY 320
            Y
Sbjct: 227 KY 228

>Kwal_27.12239
          Length = 316

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 15/129 (11%)

Query: 245 QVQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL--- 299
           ++    GH   V ++++  +  LL + S D ++ IWD+ S  L+R LS H++ V ++   
Sbjct: 91  ELHRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLP 150

Query: 300 YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTD-----SVMSVDAFK-----KIIVSG 349
            FD + L +GS D  IR+++  TG C+ T     D      V+ +   K     K ++  
Sbjct: 151 PFDPSILSSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVK 210

Query: 350 SADKTVKIW 358
           S D  +KIW
Sbjct: 211 SLDGILKIW 219

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 40/67 (59%), Gaps = 3/67 (4%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR---IISGSHDGSIKIWDLQS 536
           L SCS+D +IK+WD+ +G  +RT   H E V  I    F    + SGS+DG I+I+D  +
Sbjct: 114 LCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTAT 173

Query: 537 GKCMHTF 543
           G C+ T 
Sbjct: 174 GHCLKTL 180

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 92/253 (36%), Gaps = 64/253 (25%)

Query: 304 AKLVTGSLDKTIRVWNY--KTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVE 361
            K V   +D  I V+N   ++    ST      S +      + I + S D T+ I H+ 
Sbjct: 29  GKYVAICVDVDIVVFNLEDQSSTTFSTLHSRPLSDLCWSPDSQCIATASDDFTIIITHIV 88

Query: 362 SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVI 421
               + L GHT  V  VK   K     S S D +I++WDI + + L+    H   V  + 
Sbjct: 89  FGELHRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWDILSGTLLRTLSAHSEPVVSI- 147

Query: 422 PLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPY-PTHL 480
                                 D P                            P+ P+ L
Sbjct: 148 ----------------------DLP----------------------------PFDPSIL 157

Query: 481 LSCSLDNTIKLWDVQTGQCIRT-----QFGHVEGVWDIAADNFR-----IISGSHDGSIK 530
            S S D  I+++D  TG C++T      +    GV  I+   F      ++  S DG +K
Sbjct: 158 SSGSYDGLIRIFDTATGHCLKTLTYDKDWQSENGVVPISQVKFSRNGKYLLVKSLDGILK 217

Query: 531 IWDLQSGKCMHTF 543
           IWD   GK + TF
Sbjct: 218 IWDFVRGKVVRTF 230

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 56/113 (49%), Gaps = 5/113 (4%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWH 359
           D   + T S D TI + +   GE +    GHT  V SV    K  ++ S S D+++KIW 
Sbjct: 69  DSQCIATASDDFTIIITHIVFGE-LHRLVGHTAPVTSVKYTMKGNLLCSCSMDESIKIWD 127

Query: 360 VESRTCY-TLRGHTEWVNCVKLHPKSFTCFS-GSDDTTIRMWDIRTNSCLKVF 410
           + S T   TL  H+E V  + L P   +  S GS D  IR++D  T  CLK  
Sbjct: 128 ILSGTLLRTLSAHSEPVVSIDLPPFDPSILSSGSYDGLIRIFDTATGHCLKTL 180

>ADL184W [1557] [Homologous to ScYNL317W (PFS2) - SH]
           complement(375532..376881) [1350 bp, 449 aa]
          Length = 449

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 68/166 (40%), Gaps = 5/166 (3%)

Query: 252 HMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTG 309
           H+   +T     R L   +Y    ++W+  S      +  H   V  + +  A   L++G
Sbjct: 80  HVIPAITWTPEGRRLVVATYSGEFSLWNGSSFNFESIMQAHDSAVTVMQYSHAGDWLISG 139

Query: 310 SLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES-RTCY 366
             D TI++W           R HT+ +  +S     +  V+ S D  +KIW+  + +   
Sbjct: 140 DADGTIKIWQPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQER 199

Query: 367 TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
            L GH   V     HPK     SGS D  I++WD RT   +    G
Sbjct: 200 VLSGHHWDVKSCDWHPKMGLIVSGSKDNLIKLWDPRTGRNVSTILG 245

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 81/162 (50%), Gaps = 11/162 (6%)

Query: 250 KGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT--LYFDEAK 305
           + H + +  + F+Y  +   T S D+ + IW+  + +  R LSGH   VK+   +     
Sbjct: 160 RAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGHHWDVKSCDWHPKMGL 219

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV---DAFKKIIVSGSADKTVKIWHVES 362
           +V+GS D  I++W+ +TG  +ST  G   +V+          ++   S DK++KI+ +  
Sbjct: 220 IVSGSKDNLIKLWDPRTGRNVSTILGLKHTVIKTKFQPTQGNLLAVVSKDKSIKIYDMRQ 279

Query: 363 --RTCYTLRGHTEWVNCVKLHPKSFTCFS-GSDDTTIRMWDI 401
             R   T+R   +++  +  HP + T FS G  +  I+ +D+
Sbjct: 280 HMRELQTIRDDMDYM-SLSWHPINETIFSVGCYNGAIKHFDL 320

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDL 534
            ++CS DN +K+W+   GQ  R   GH    WD+ + ++      I+SGS D  IK+WD 
Sbjct: 178 FVTCSDDNVLKIWNFSNGQQERVLSGHH---WDVKSCDWHPKMGLIVSGSKDNLIKLWDP 234

Query: 535 QSGKCMHTFHG 545
           ++G+ + T  G
Sbjct: 235 RTGRNVSTILG 245

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 5/113 (4%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI---IVSGSADKTVKIWHVE 361
           +LV  +      +WN  +    S  + H DS ++V  +      ++SG AD T+KIW   
Sbjct: 93  RLVVATYSGEFSLWNGSSFNFESIMQAH-DSAVTVMQYSHAGDWLISGDADGTIKIWQPN 151

Query: 362 SRTCYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
                 L R HTE +  +          + SDD  +++W+       +V  GH
Sbjct: 152 FNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSGH 204

 Score = 33.1 bits (74), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 9/62 (14%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISG------SHDGSIKIWD 533
           ++S S DN IKLWD +TG+ + T  G    V       F+   G      S D SIKI+D
Sbjct: 220 IVSGSKDNLIKLWDPRTGRNVSTILGLKHTV---IKTKFQPTQGNLLAVVSKDKSIKIYD 276

Query: 534 LQ 535
           ++
Sbjct: 277 MR 278

>Scas_720.45
          Length = 755

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 62/124 (50%), Gaps = 10/124 (8%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRL-SGHTDGVKTLYF----DEAKLVTGSLDKTIRVWNYKT 322
           +G  D TV +W L        L SG   GV  + +    D+  L+T S D T +VW+Y+T
Sbjct: 15  SGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLTCKVWDYQT 74

Query: 323 GECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCV 378
             C++T  GH  +V S   F     II+SGS D T+KIW+  + +   TL    E   C+
Sbjct: 75  KSCVATLEGHMANV-SFAVFHPTLPIIISGSEDGTLKIWNSATYKVEKTLSLGLERSWCI 133

Query: 379 KLHP 382
             HP
Sbjct: 134 ATHP 137

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 10/110 (9%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTY---RGHTDSVMSVDAF----KKIIVSGSADKT 354
           D     +G LD+T++VW+   G+    +    G    V  VD +    K  +++ S D T
Sbjct: 9   DPNTFASGCLDRTVKVWS--LGQATPNFTLNSGQEKGVNYVDYYPLPDKPYLITSSDDLT 66

Query: 355 VKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
            K+W  ++++C  TL GH   V+    HP      SGS+D T+++W+  T
Sbjct: 67  CKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (48%), Gaps = 18/105 (17%)

Query: 346 IVSGSADKTVKIWHVESRTC-YTLR-GHTEWVNCVKLHP---KSFTCFSGSDDTTIRMWD 400
             SG  D+TVK+W +   T  +TL  G  + VN V  +P   K +   + SDD T ++WD
Sbjct: 13  FASGCLDRTVKVWSLGQATPNFTLNSGQEKGVNYVDYYPLPDKPY-LITSSDDLTCKVWD 71

Query: 401 IRTNSCLKVFRGHVGQVQKVI---PLTIIDAENLVVDNISGSNEG 442
            +T SC+    GH+  V   +    L II         ISGS +G
Sbjct: 72  YQTKSCVATLEGHMANVSFAVFHPTLPII---------ISGSEDG 107

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 474 IPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV-WDIAADNFR-IISGSHDGSIKI 531
           +P   +L++ S D T K+WD QT  C+ T  GH+  V + +       IISGS DG++KI
Sbjct: 52  LPDKPYLITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKI 111

Query: 532 WDLQSGKCMHTF 543
           W+  + K   T 
Sbjct: 112 WNSATYKVEKTL 123

 Score = 34.3 bits (77), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKT 322
           L T S D T  +WD  +   +  L GH   V    F      +++GS D T+++WN  T
Sbjct: 58  LITSSDDLTCKVWDYQTKSCVATLEGHMANVSFAVFHPTLPIIISGSEDGTLKIWNSAT 116

>Kwal_14.884
          Length = 395

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 72/157 (45%), Gaps = 22/157 (14%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEA-KLV 307
           F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F +  K+ 
Sbjct: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGTKIE 96

Query: 308 TGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCY- 366
             + D T           ++T RG++          K ++S S D  + IW V+    + 
Sbjct: 97  DKNEDDT----------GLTTGRGNS----------KWLISASDDHNLVIWRVKDWENFG 136

Query: 367 TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           TL+GH   +N   +HP +    S S+D +IR+W++ T
Sbjct: 137 TLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMT 173

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 69/175 (39%), Gaps = 36/175 (20%)

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI 425
           +  + H+  V C+ +  +     SGS+D  IR++D++    L     H G +  +     
Sbjct: 35  FHFQAHSLSVKCLDISKRYLV--SGSNDEHIRIYDLQKRKELGTLLSHQGSITAL----- 87

Query: 426 IDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSL 485
                      S   + +D+                  +E++  L         L+S S 
Sbjct: 88  ---------KFSKGTKIEDK------------------NEDDTGLTTGRGNSKWLISASD 120

Query: 486 DNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQSGK 538
           D+ + +W V+  +   T  GH   +  +DI   N   IS S D SI++W+L + K
Sbjct: 121 DHNLVIWRVKDWENFGTLKGHASRINDFDIHPSNRIAISVSEDHSIRLWNLMTVK 175

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/132 (20%), Positives = 54/132 (40%), Gaps = 20/132 (15%)

Query: 286 IRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI 345
           I     H+  VK L   +  LV+GS D+ IR+++ +  + + T   H  S+ ++   K  
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALKFSKGT 93

Query: 346 IVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
            +    +        +     T RG+++W+             S SDD  + +W ++   
Sbjct: 94  KIEDKNE--------DDTGLTTGRGNSKWL------------ISASDDHNLVIWRVKDWE 133

Query: 406 CLKVFRGHVGQV 417
                +GH  ++
Sbjct: 134 NFGTLKGHASRI 145

>CAGL0F06853g 671942..673108 highly similar to sp|P20484
           Saccharomyces cerevisiae YKL021c MAK11 involved in cell
           growth and replication of M1 dsRNA virus, hypothetical
           start
          Length = 388

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 67/131 (51%), Gaps = 14/131 (10%)

Query: 286 IRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI 345
           I     H+  VK L   +  LV+GS D+ IR+++ +  + + T   H  S+ ++  F K+
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNL-KFSKV 92

Query: 346 ------------IVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSD 392
                       ++S S D  + +W V+    + TL+GHT  +N + +HP +    S S+
Sbjct: 93  SDQEPKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSE 152

Query: 393 DTTIRMWDIRT 403
           D +IR+W++ T
Sbjct: 153 DHSIRLWNLMT 163

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 13/125 (10%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--- 305
           F+ H   V  L  + R L +GS D  + I+DL   K +  L  H   +  L F +     
Sbjct: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQE 96

Query: 306 --------LVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTV 355
                   L++ S D  I VW  K  E   T +GHT  +  M +    +++ S S D ++
Sbjct: 97  PKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSI 156

Query: 356 KIWHV 360
           ++W++
Sbjct: 157 RLWNL 161

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 48/99 (48%), Gaps = 10/99 (10%)

Query: 329 YRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKL------H 381
           ++ H+ SV  +D  K+ +VSGS D+ ++I+ ++ R    TL  H   +  +K        
Sbjct: 37  FQAHSLSVKCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQE 96

Query: 382 PKSFT---CFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
           PKS +     S S+D  I +W ++        +GH  ++
Sbjct: 97  PKSTSGKWLLSASEDNKIIVWRVKDWENFGTLKGHTARI 135

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 62/174 (35%), Gaps = 46/174 (26%)

Query: 365 CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLT 424
            +  + H+  V C+ +  +     SGS+D  IR++D++    L     H G +       
Sbjct: 34  IFHFQAHSLSVKCLDISKRYLV--SGSNDEHIRIYDLQKRKELGTLLAHQGSIT------ 85

Query: 425 IIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCS 484
                     N+  S   D EP                                 LLS S
Sbjct: 86  ----------NLKFSKVSDQEPKSTS--------------------------GKWLLSAS 109

Query: 485 LDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 536
            DN I +W V+  +   T  GH   +   DI   N  + S S D SI++W+L +
Sbjct: 110 EDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWNLMT 163

>Scas_692.25
          Length = 488

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 106/266 (39%), Gaps = 57/266 (21%)

Query: 304 AKLVTGSLDKTIRVWNYKTGE----CISTYRGHTDSVMSVDAFKKI----IVSGSADKTV 355
           A + T S D +I+++ +   E           H   V  V  F+K+    + S S D ++
Sbjct: 202 AIIATSSKDLSIKLFRWSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSI 261

Query: 356 KIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH- 413
           +IW  E      +   H EWV C+ +        SGS D ++R+    + + L +  GH 
Sbjct: 262 RIWTAEDGMILNSFHPHNEWVRCLDV--SGDFVLSGSQDASLRLTHWPSGNGLSIGIGHE 319

Query: 414 --VGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLD 471
             +  V+ ++PL+  +  +  ++ +    E D                   +D E  +  
Sbjct: 320 FPIESVKFILPLSTNEKASPTINYLRKPLEID-------------------SDYEKMSF- 359

Query: 472 KSIPYPTHLLSCSLDNTIKLWDVQTG-----------------QCIRTQFGHVEGVWDIA 514
                  +  S S D  IK+W++ T                  +CI T  GH   V D+ 
Sbjct: 360 ------KYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLR 413

Query: 515 ADNFRIISGSHDGSIKIWDLQSGKCM 540
                + S S D +I+ W+L++G+C+
Sbjct: 414 IRGNYLFSCSDDKTIRCWNLENGECV 439

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 76/197 (38%), Gaps = 50/197 (25%)

Query: 260 QFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWN 319
           + N   L + S D+++ IW      ++     H + V+ L      +++GS D ++R+ +
Sbjct: 246 KLNNIYLASCSRDTSIRIWTAEDGMILNSFHPHNEWVRCLDVSGDFVLSGSQDASLRLTH 305

Query: 320 YKTGECISTYRGHTDSVMSVDAFK------------------------------KIIVSG 349
           + +G  +S   GH   + SV                                  K   S 
Sbjct: 306 WPSGNGLSIGIGHEFPIESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASA 365

Query: 350 SADKTVKIWHVES------------------RTCYTLRGHTEWVNCVKLHPKSFTCFSGS 391
           S D+ +KIW + +                  +   TL+GH  WV  +++  +    FS S
Sbjct: 366 SRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRI--RGNYLFSCS 423

Query: 392 DDTTIRMWDIRTNSCLK 408
           DD TIR W++    C+K
Sbjct: 424 DDKTIRCWNLENGECVK 440

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 80/210 (38%), Gaps = 54/210 (25%)

Query: 265 LLFTGSYDSTVAI--WDLCSNK--LIRRLSGHTDGVKTLYF----DEAKLVTGSLDKTIR 316
           ++ T S D ++ +  W    NK  L R L  H   V  +      +   L + S D +IR
Sbjct: 203 IIATSSKDLSIKLFRWSAKENKFLLFRVLMNHEHIVSEVKLFRKLNNIYLASCSRDTSIR 262

Query: 317 VWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR-GHTEWV 375
           +W  + G  ++++  H + V  +D     ++SGS D ++++ H  S    ++  GH   +
Sbjct: 263 IWTAEDGMILNSFHPHNEWVRCLDVSGDFVLSGSQDASLRLTHWPSGNGLSIGIGHEFPI 322

Query: 376 NCVKL---------------------------HPKSFT-CFSGSDDTTIRMWDIRT---- 403
             VK                               SF  C S S D  I++W+I T    
Sbjct: 323 ESVKFILPLSTNEKASPTINYLRKPLEIDSDYEKMSFKYCASASRDRLIKIWEIPTPRFV 382

Query: 404 -------NS------CLKVFRGHVGQVQKV 420
                  NS      C+   +GH   V+ +
Sbjct: 383 MHRPPVPNSSNSNFKCIMTLKGHASWVKDL 412

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 37/87 (42%), Gaps = 17/87 (19%)

Query: 260 QFNYRLLFTGSYDSTVAIWDLCSNKL-----------------IRRLSGHTDGVKTLYFD 302
           + +++   + S D  + IW++ + +                  I  L GH   VK L   
Sbjct: 356 KMSFKYCASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIR 415

Query: 303 EAKLVTGSLDKTIRVWNYKTGECISTY 329
              L + S DKTIR WN + GEC+  +
Sbjct: 416 GNYLFSCSDDKTIRCWNLENGECVKQW 442

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 43/103 (41%), Gaps = 19/103 (18%)

Query: 307 VTGSLDKTIRVWNYKTG-----------------ECISTYRGHTDSVMSVDAFKKIIVSG 349
            + S D+ I++W   T                  +CI T +GH   V  +      + S 
Sbjct: 363 ASASRDRLIKIWEIPTPRFVMHRPPVPNSSNSNFKCIMTLKGHASWVKDLRIRGNYLFSC 422

Query: 350 SADKTVKIWHVESRTCYT--LRGHTEWVNCVKLHPKSFTCFSG 390
           S DKT++ W++E+  C       H+ +V C+ + P   T  +G
Sbjct: 423 SDDKTIRCWNLENGECVKQWTDLHSGFVTCLDMDPDGGTNDTG 465

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 10/23 (43%), Positives = 18/23 (78%)

Query: 479 HLLSCSLDNTIKLWDVQTGQCIR 501
           +L SCS D TI+ W+++ G+C++
Sbjct: 418 YLFSCSDDKTIRCWNLENGECVK 440

>KLLA0E18986g 1680775..1683747 similar to sgd|S0006104 Saccharomyces
           cerevisiae YPL183c, start by similarity
          Length = 990

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 11/132 (8%)

Query: 245 QVQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF- 301
           ++   +GH   +  +T   N +LL + S D ++ IWD+ S KL+ R  GHT  +  L F 
Sbjct: 173 KIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFF 232

Query: 302 -DEAKLVTGSLDKTIRVWNYKTGECI--STYRGH-TDSVMSVDAFKK--IIVSGSADKTV 355
            D+ +L++ S D T RVWNYK  E      +  H T +V  VD  +   I +SG  D  +
Sbjct: 233 NDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTKNVWGVDVEETNLIAISGGNDGRL 292

Query: 356 KIWHV--ESRTC 365
           K+  +   +R+C
Sbjct: 293 KVTELVPHNRSC 304

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 62/140 (44%), Gaps = 10/140 (7%)

Query: 308 TGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIW-HVESRT 364
            G++   I VW   + + I T RGH  S+  V      K++ S S D+++ IW  V  + 
Sbjct: 156 AGTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKL 215

Query: 365 CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCL--KVFRGHVGQVQKVIP 422
                GHT  +  +K         S S+D T R+W+ + +      +F  H+ +      
Sbjct: 216 LSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKNDELTIKDIFESHLTK-----N 270

Query: 423 LTIIDAENLVVDNISGSNEG 442
           +  +D E   +  ISG N+G
Sbjct: 271 VWGVDVEETNLIAISGGNDG 290

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 37/59 (62%), Gaps = 2/59 (3%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQS 536
           L SCS D +I +WD+ +G+ +   +GH   +W++    D+ ++IS S D + ++W+ ++
Sbjct: 196 LASCSDDRSIIIWDMVSGKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWNYKN 254

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV--KTLYFDEAKLVTGSLDKTIRVWNYKT 322
           L+  G+  + + +W+L S K I  L GH   +   T   +   L + S D++I +W+  +
Sbjct: 153 LVNAGTIMNGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVS 212

Query: 323 GECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWH 359
           G+ +S   GHT  + ++  F     ++S S D T ++W+
Sbjct: 213 GKLLSRAWGHTARIWNLKFFNDDTQLISVSEDCTCRVWN 251

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 5/105 (4%)

Query: 314 TIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRT-CYTLRGHT 372
           T++  ++  GE    Y G     + V   K ++ +G+    + +W ++S+   +TLRGH 
Sbjct: 126 TVKSTHFVEGERSILYSGS----IKVLRHKVLVNAGTIMNGIIVWELDSKKKIHTLRGHE 181

Query: 373 EWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
             +  V          S SDD +I +WD+ +   L    GH  ++
Sbjct: 182 GSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLLSRAWGHTARI 226

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 487 NTIKLWDVQTGQCIRTQFGHVEGVWDIAADNF--RIISGSHDGSIKIWDLQSGKCM 540
           N I +W++ + + I T  GH   ++ +   N    + S S D SI IWD+ SGK +
Sbjct: 161 NGIIVWELDSKKKIHTLRGHEGSIFYVTTSNNGKLLASCSDDRSIIIWDMVSGKLL 216

>Kwal_26.8953
          Length = 458

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 128/308 (41%), Gaps = 63/308 (20%)

Query: 265 LLFTGSYDSTVAIWDLCSNKL-IRRLSGHTDGVKTL--YFDEAK---LVTGSLDKTIRVW 318
           L+F  +    +  +DL +  + +  +  H  G+ ++  + D+     + T S D   +V+
Sbjct: 142 LVFAATDSGKLLCYDLMNYTMPVASVQAHMRGITSIDVHIDDDSQCFVATASKDLHCKVF 201

Query: 319 NYKTGEC--ISTYRGHTDSVMSVDAFKK----IIVSGSADKTVKIWHVESRT-CYTLRGH 371
                E   + T+ GH   V  +  +K     ++ S S D T KI  V +     + + H
Sbjct: 202 RLINSELQLVRTFSGHEHIVSHIKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQPH 261

Query: 372 TEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQ--KVIPLTIIDAE 429
            EWV  + +  +     +GS+D T+R+    T   L    GH   V+  K+IP+ + +++
Sbjct: 262 AEWVRSLDIMGEYI--ITGSNDCTVRVSHWPTGRALSFGIGHDFPVEQVKIIPMELSESD 319

Query: 430 NLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTI 489
           +   +  S  N+ D  P                               +H++SCS DNT+
Sbjct: 320 DPQNNTYSAFNK-DYLPLGF----------------------------SHVVSCSRDNTL 350

Query: 490 KLWDVQTGQCI----------RTQF-------GHVEGVWDIAADNFRIISGSHDGSIKIW 532
           ++W V   + I          R  F       GH   V DI      IIS S D S+++W
Sbjct: 351 RIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRVRGNFIISCSDDRSVRVW 410

Query: 533 DLQSGKCM 540
           DL++G+ +
Sbjct: 411 DLETGETV 418

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/219 (25%), Positives = 92/219 (42%), Gaps = 51/219 (23%)

Query: 246 VQEFKGHMDGVLTLQF----NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF 301
           V+ F GH   V  ++        L+ + S D T  I D+ +   ++    H + V++L  
Sbjct: 211 VRTFSGHEHIVSHIKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDI 270

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV------------------DAFK 343
               ++TGS D T+RV ++ TG  +S   GH   V  V                   AF 
Sbjct: 271 MGEYIITGSNDCTVRVSHWPTGRALSFGIGHDFPVEQVKIIPMELSESDDPQNNTYSAFN 330

Query: 344 KI--------IVSGSADKTVKIWHV--------------ESRTCY----TLRGHTEWVNC 377
           K         +VS S D T++IW V               +R  +    TL+GH+ WV  
Sbjct: 331 KDYLPLGFSHVVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRD 390

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK-VFRGHVG 415
           +++  +     S SDD ++R+WD+ T   ++ +   H G
Sbjct: 391 IRV--RGNFIISCSDDRSVRVWDLETGETVREITDSHTG 427

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/270 (20%), Positives = 104/270 (38%), Gaps = 28/270 (10%)

Query: 246 VQEFKGHMDGVLTLQFNYR-----LLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKT 298
           V   + HM G+ ++  +        + T S D    ++ L ++  +L+R  SGH   V  
Sbjct: 164 VASVQAHMRGITSIDVHIDDDSQCFVATASKDLHCKVFRLINSELQLVRTFSGHEHIVSH 223

Query: 299 LYF----DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKT 354
           +       +  + + S D T ++ +   G  + +++ H + V S+D   + I++GS D T
Sbjct: 224 IKIWKNATDTLVASCSRDLTCKIGDVSNGYFLKSFQPHAEWVRSLDIMGEYIITGSNDCT 283

Query: 355 VKIWHVESRTCYTLR-GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
           V++ H  +    +   GH   V  VK+ P      S SDD     +       L +   H
Sbjct: 284 VRVSHWPTGRALSFGIGHDFPVEQVKIIPMEL---SESDDPQNNTYSAFNKDYLPLGFSH 340

Query: 414 VGQVQKVIPLTI--IDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLD 471
           V    +   L I  +    L+       N                          N    
Sbjct: 341 VVSCSRDNTLRIWQVPIPRLIAHRAPQPNPARAHFTLVKTLKGHSSWVRDIRVRGN---- 396

Query: 472 KSIPYPTHLLSCSLDNTIKLWDVQTGQCIR 501
                   ++SCS D ++++WD++TG+ +R
Sbjct: 397 -------FIISCSDDRSVRVWDLETGETVR 419

>YPR178W (PRP4) [5592] chr16 (892326..893723) U4/U6 snRNA-associated
           splicing factor, member of WD (WD-40) repeat family
           [1398 bp, 465 aa]
          Length = 465

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 104/258 (40%), Gaps = 56/258 (21%)

Query: 284 KLIRRLSGHTDGVKTL-YFDEAKLV-TGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDA 341
           +L+  L GH   +  + Y    K + + S D T R+W+  T + +    GH   V S+ +
Sbjct: 256 RLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSL-S 314

Query: 342 FK---KIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIR 397
           F+    ++ SG  D    +W + S +   TL GH++ +  V   P  +   +G  D  I 
Sbjct: 315 FQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIIN 374

Query: 398 MWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXX 457
           +WDIR            GQ+ +++      A   +V  +  S E   +            
Sbjct: 375 VWDIRKRD--------EGQLNQIL------AHRNIVTQVRFSKEDGGKK----------- 409

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAA 515
                                 L+SC  DN I ++   T   + +  GH + +   DI+ 
Sbjct: 410 ----------------------LVSCGYDNLINVYSSDTWLKMGSLAGHTDKIISLDISN 447

Query: 516 DNFRIISGSHDGSIKIWD 533
           ++  ++SG  D SIK+W+
Sbjct: 448 NSHFLVSGGWDRSIKLWN 465

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 79/163 (48%), Gaps = 13/163 (7%)

Query: 250 KGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAK 305
           +GH  GV +L F  +  L+ +G  DS   +WD+ S   +  L+GH+  + T+ +  +  +
Sbjct: 304 EGHDKGVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQ 363

Query: 306 LVTGSLDKTIRVWNYKTGE--CISTYRGHTDSVMSV-----DAFKKIIVSGSADKTVKIW 358
           + TG  D  I VW+ +  +   ++    H + V  V     D  KK++  G  D  + ++
Sbjct: 364 VATGGGDGIINVWDIRKRDEGQLNQILAHRNIVTQVRFSKEDGGKKLVSCG-YDNLINVY 422

Query: 359 HVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWD 400
             ++     +L GHT+ +  + +   S    SG  D +I++W+
Sbjct: 423 SSDTWLKMGSLAGHTDKIISLDISNNSHFLVSGGWDRSIKLWN 465

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 65/135 (48%), Gaps = 10/135 (7%)

Query: 237 SNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGS--YDSTVAIWDLCSNKLIRRLSGHTD 294
           SN   G   + +  GH   +  ++++    F GS  +D T  +WD  +++ +    GH  
Sbjct: 249 SNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHDMTWRLWDASTHQELLLQEGHDK 308

Query: 295 GVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV----DAFKKIIVS 348
           GV +L F  D + + +G +D    +W+ ++G  + T  GH+  + +V    + ++  + +
Sbjct: 309 GVFSLSFQCDGSLVCSGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQ--VAT 366

Query: 349 GSADKTVKIWHVESR 363
           G  D  + +W +  R
Sbjct: 367 GGGDGIINVWDIRKR 381

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 532
           P    + S S D T +LWD  T Q +  Q GH +GV+ ++   D   + SG  D    +W
Sbjct: 275 PSGKFIGSASHDMTWRLWDASTHQELLLQEGHDKGVFSLSFQCDGSLVCSGGMDSLSMLW 334

Query: 533 DLQSGKCMHTFHG 545
           D++SG  + T  G
Sbjct: 335 DIRSGSKVMTLAG 347

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 482 SCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQ 535
           S  +D+   LWD+++G  + T  GH + ++ +A   + +++ +G  DG I +WD++
Sbjct: 324 SGGMDSLSMLWDIRSGSKVMTLAGHSKPIYTVAWSPNGYQVATGGGDGIINVWDIR 379

 Score = 38.1 bits (87), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 86/200 (43%), Gaps = 21/200 (10%)

Query: 226 KVIYRERFKVESNWRKGNCQVQ-EFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCS 282
           ++I+  RF +  +  +   ++Q E + H       +FN R  LL   +    +A  +L  
Sbjct: 116 ELIFARRFLINYSLERSRKRLQKEMERHQ------KFNTRQELLSRRTELQRMANLELAG 169

Query: 283 NKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECIST-YRGHTDSVMSVDA 341
           ++L+   S       +L  D+  + TGS    ++V N +T + ++     H   + ++D 
Sbjct: 170 SQLV---STKPISAVSLSTDDMVVATGSWAGDLQVLNSQTLQPLTQKLDSHVGKIGAIDW 226

Query: 342 F---KKIIVSGSADKTVKIWHVES-----RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDD 393
                  ++S + D  +K +   +     R    L GH   ++ VK HP      S S D
Sbjct: 227 HPDSNNQMISCAEDGLIKNFQYSNEEGGLRLLGDLVGHERRISDVKYHPSGKFIGSASHD 286

Query: 394 TTIRMWDIRTNSCLKVFRGH 413
            T R+WD  T+  L +  GH
Sbjct: 287 MTWRLWDASTHQELLLQEGH 306

>YLR429W (CRN1) [3804] chr12 (990773..992728) Coronin, actin-binding
           protein, inhibits ARP2/3-stimulated actin nucleation,
           contains WD (WD-40) repeats [1956 bp, 651 aa]
          Length = 651

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 91/208 (43%), Gaps = 42/208 (20%)

Query: 241 KGNCQVQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSN-------------- 283
           K   QV  F+GH   VL   F   N   + +GS DS + IWD+  N              
Sbjct: 69  KAPDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDHVDEDGEPI 128

Query: 284 --KLIRRLSGHTDGV-KTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSV-- 336
             K ++ L+GH   V   LY   A+  L + S D T+++WN +TG+ + T + H D V  
Sbjct: 129 DIKPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLK-HPDMVTS 187

Query: 337 MSVDAFKKIIVSGSADKTVKIWHV-ESRTCYTLRGHTE-------WV-NCVKLHPKSFTC 387
           MS       + + + DK +++W++ E +       HT        W+ N  +L   + T 
Sbjct: 188 MSFSYDGNYLATVARDKKLRVWNIREEKIVSEGPAHTGAKNQRVVWLGNSDRL---ATTG 244

Query: 388 FSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           FS   D  I +WD        + +G +G
Sbjct: 245 FSKLSDRQIGIWD-----AFNIEKGDLG 267

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 69/182 (37%), Gaps = 50/182 (27%)

Query: 368 LRGHTEWVNCVKLHP-KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHV---GQVQKVIPL 423
            RGHT  V      P       SGSDD+ I +WDI  N     F  HV   G+   + P+
Sbjct: 77  FRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYK---FHDHVDEDGEPIDIKPV 133

Query: 424 TIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTH---L 480
             +      V ++                                     + +P     L
Sbjct: 134 KFLTGHARKVGHV-------------------------------------LYHPVAENVL 156

Query: 481 LSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGK 538
            S S D T+KLW+V+TG+ + T   H + V  +  + D   + + + D  +++W+++  K
Sbjct: 157 ASSSGDYTVKLWNVETGKDMIT-LKHPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEK 215

Query: 539 CM 540
            +
Sbjct: 216 IV 217

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 18/40 (45%), Gaps = 3/40 (7%)

Query: 505 GHVEGVWDIAADNF---RIISGSHDGSIKIWDLQSGKCMH 541
           GH   V D   D F   RI SGS D  I IWD+      H
Sbjct: 79  GHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFH 118

>Scas_717.68
          Length = 908

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 2/82 (2%)

Query: 325 CISTYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPK 383
           C   ++ HT  V+ +D  K   +++ S D+TVK+WH+E +T      H ++V CV+ HP 
Sbjct: 320 CFKIFKEHTADVLDLDWSKNNFLITSSMDRTVKLWHLERQTSLKTFQHQDFVTCVRFHPT 379

Query: 384 SFTCF-SGSDDTTIRMWDIRTN 404
               F SG  D  +R+W I  N
Sbjct: 380 DDRFFISGCLDHKVRLWSILEN 401

 Score = 30.0 bits (66), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 4/67 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI---AADNFRIISGSHDGSIKIWDLQS 536
           L++ S+D T+KLW ++    ++T F H + V  +     D+   ISG  D  +++W +  
Sbjct: 342 LITSSMDRTVKLWHLERQTSLKT-FQHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILE 400

Query: 537 GKCMHTF 543
            +    F
Sbjct: 401 NEITFEF 407

>Sklu_2318.1 YKL213C, Contig c2318 605-2740 reverse complement
          Length = 711

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 77/163 (47%), Gaps = 10/163 (6%)

Query: 264 RLLFTGSYDSTVA-IWDLCSNK--LIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNY 320
           +LLF G  D+ V  I  L +     +  L GH   V +L      +++ S DKT +VW+ 
Sbjct: 67  QLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKGNVCSLSSKNNFVISSSWDKTAKVWH- 125

Query: 321 KTGECISTYRGHTDSVMSVDAF--KKIIVSGSADKTVKIWHVESRTCYTLRG-HTEWVNC 377
             G  I    GH+ SV        K   ++ SAD T+K+WH  ++   T  G H + +  
Sbjct: 126 -NGSAIYDLVGHSASVWDAKFLPEKDFFLTASADCTIKLWH-GNKLIKTFSGIHKDVIRH 183

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           + + P   T  S S+D T+++ D+  N  LK F GH   V  V
Sbjct: 184 LDISPDGETFASCSNDGTVKINDMDGN-ILKTFTGHESFVYSV 225

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 74/166 (44%), Gaps = 11/166 (6%)

Query: 251 GHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVT 308
           GH   V +L      + + S+D T  +W   +   I  L GH+  V    F   K   +T
Sbjct: 97  GHKGNVCSLSSKNNFVISSSWDKTAKVWH--NGSAIYDLVGHSASVWDAKFLPEKDFFLT 154

Query: 309 GSLDKTIRVWNYKTGECISTYRG-HTDSVMSVDAFK--KIIVSGSADKTVKIWHVESRTC 365
            S D TI++W+    + I T+ G H D +  +D     +   S S D TVKI  ++    
Sbjct: 155 ASADCTIKLWH--GNKLIKTFSGIHKDVIRHLDISPDGETFASCSNDGTVKINDMDGNIL 212

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFR 411
            T  GH  +V  VK  P      S  +D ++R+W  +T +  +V R
Sbjct: 213 KTFTGHESFVYSVKFLPNG-DLVSCGEDRSVRVWS-KTGAVKQVLR 256

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 63/273 (23%), Positives = 100/273 (36%), Gaps = 69/273 (25%)

Query: 284 KLIRRLSGHTDGVKTLY-FDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS---V 339
           KL   L GH   VK++   +++++ + S D T+RVW+   G        +++  ++    
Sbjct: 3   KLSADLKGHEQDVKSVVAINDSQVASCSRDGTVRVWSNNDGVWNGVIAHNSEKFINSLCY 62

Query: 340 DAFKKIIVSGSADKTV----KIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTT 395
           D   +++  G  D  V     +   +    Y L GH    N   L  K+    S S D T
Sbjct: 63  DKSSQLLFYGGQDTLVGGISPLATTDEDPVYMLIGHKG--NVCSLSSKNNFVISSSWDKT 120

Query: 396 IRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXX 455
            ++W     S +    GH          ++ DA                           
Sbjct: 121 AKVW--HNGSAIYDLVGHSA--------SVWDA--------------------------- 143

Query: 456 XXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV---WD 512
                           K +P     L+ S D TIKLW     + I+T  G  + V    D
Sbjct: 144 ----------------KFLPEKDFFLTASADCTIKLW--HGNKLIKTFSGIHKDVIRHLD 185

Query: 513 IAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           I+ D     S S+DG++KI D+  G  + TF G
Sbjct: 186 ISPDGETFASCSNDGTVKINDMD-GNILKTFTG 217

>KLLA0C07513g complement(656060..657379) similar to sp|P39946
           Saccharomyces cerevisiae YOR269w PAC1 singleton, start
           by similarity
          Length = 439

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 122/312 (39%), Gaps = 73/312 (23%)

Query: 256 VLTLQFNYRLLFTGSYDSTVAIWDLCSNKL-IRRLSGHTDGVKTLYFD-------EAKLV 307
            L L  +  ++F G     +  +D+ + +L ++    H DG+ ++           A L 
Sbjct: 113 ALCLHPSLPIIFIGLDSGKLLRYDILNVELPLQSTMAHMDGITSISISLPNENGRPAYLA 172

Query: 308 TGSLDKTIRVWNYKTGECIS---TYRGHTDSVMSVDAFKK----IIVSGSADKTVKIWHV 360
           T S D   ++W  +    +S   T  GH  +V     F++    ++ + S D  +KIW +
Sbjct: 173 TTSKDLNTKIWELELDSTLSHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIWDI 232

Query: 361 ESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 419
            +  C  + + HT+W+  + +H +     +GS+D+ IR+    + + L +  GH   V+K
Sbjct: 233 SNGWCIKSFQPHTQWIRSLHVHGE--FVLTGSNDSAIRLTHWPSGNGLSMGIGHDFPVEK 290

Query: 420 VIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTH 479
           V+ L I D ++L                                  + Q L        H
Sbjct: 291 VLIL-IPDPQHL--------------------------------QPQYQPLGFQ-----H 312

Query: 480 LLSCSLDNTIKLWDVQ-----------------TGQCIRTQFGHVEGVWDIAADNFRIIS 522
           + S S D TI+LW V                  T + I     H   V D+   N  + S
Sbjct: 313 VASASRDGTIRLWKVSLPKFIPHRPPRPNPLDTTFKVIAVLTDHNSWVRDLRQFNDMLFS 372

Query: 523 GSHDGSIKIWDL 534
            S DGS+K W L
Sbjct: 373 CSDDGSVKCWSL 384

 Score = 52.0 bits (123), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 95/242 (39%), Gaps = 46/242 (19%)

Query: 245 QVQEFKGHMDGVLTLQFNYR----LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY 300
            ++   GH   V   QF  R    LL T S D  + IWD+ +   I+    HT  +++L+
Sbjct: 193 HIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLH 252

Query: 301 FDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV-----------DAFKKI---- 345
                ++TGS D  IR+ ++ +G  +S   GH   V  V             ++ +    
Sbjct: 253 VHGEFVLTGSNDSAIRLTHWPSGNGLSMGIGHDFPVEKVLILIPDPQHLQPQYQPLGFQH 312

Query: 346 IVSGSADKTVKIWHVES------------------RTCYTLRGHTEWVNCVKLHPKSFTC 387
           + S S D T+++W V                    +    L  H  WV    L   +   
Sbjct: 313 VASASRDGTIRLWKVSLPKFIPHRPPRPNPLDTTFKVIAVLTDHNSWVR--DLRQFNDML 370

Query: 388 FSGSDDTTIRMW-----DIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNI--SGSN 440
           FS SDD +++ W     ++ T +C K +       Q  + L  I    L    +  SGS+
Sbjct: 371 FSCSDDGSVKCWSLDWTNLSTTTCKKSWDLSNKGFQNCLTLDNIAFTGLPSRKLLFSGSS 430

Query: 441 EG 442
           EG
Sbjct: 431 EG 432

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 36/67 (53%), Gaps = 2/67 (2%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKI--WDLQSG 537
           L +CS D  +K+WD+  G CI++   H + +  +      +++GS+D +I++  W   +G
Sbjct: 218 LATCSRDLYLKIWDISNGWCIKSFQPHTQWIRSLHVHGEFVLTGSNDSAIRLTHWPSGNG 277

Query: 538 KCMHTFH 544
             M   H
Sbjct: 278 LSMGIGH 284

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 7/75 (9%)

Query: 477 PTHLLSCSLDNTIKLWDVQ---TGQCIRTQFGHVEGVWDIA----ADNFRIISGSHDGSI 529
           P +L + S D   K+W+++   T   I+T  GH   V D        +  + + S D  +
Sbjct: 168 PAYLATTSKDLNTKIWELELDSTLSHIKTLAGHEHTVSDCQFFERGADLLLATCSRDLYL 227

Query: 530 KIWDLQSGKCMHTFH 544
           KIWD+ +G C+ +F 
Sbjct: 228 KIWDISNGWCIKSFQ 242

>YNL317W (PFS2) [4296] chr14 (40618..42015) Polyadenylation factor I
           subunit 2 required for mRNA 3'-end processing, bridges
           two mRNA 3'-end processing factors, has WD (WD-40)
           repeats [1398 bp, 465 aa]
          Length = 465

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 5/149 (3%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           R L   +Y    ++W+  S      +  H   V T+ +  D   +++G  D  I++W   
Sbjct: 106 RRLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPN 165

Query: 322 TGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCV 378
                     HT+S+  M+  +     V+ S D  +KIW+  + +    L GH   V   
Sbjct: 166 FSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSC 225

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCL 407
             HP+     S S D  +++WD R+ +C+
Sbjct: 226 DWHPEMGLIASASKDNLVKLWDPRSGNCI 254

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 75/162 (46%), Gaps = 8/162 (4%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEA 304
            + H   V T+++++    + +G  D  + IW    + +    + HT+ ++ + F  +++
Sbjct: 131 MQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDS 190

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVES 362
           K VT S D  +++WN+  G+      GH   V S D   +  +I S S D  VK+W   S
Sbjct: 191 KFVTCSDDNILKIWNFSNGKQERVLSGHHWDVKSCDWHPEMGLIASASKDNLVKLWDPRS 250

Query: 363 RTCY-TLRGHTEWVNCVKLHP-KSFTCFSGSDDTTIRMWDIR 402
             C  ++      V   +  P K     + S D + R++DIR
Sbjct: 251 GNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIR 292

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 15/83 (18%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDL 534
            ++CS DN +K+W+   G+  R   GH    WD+ + ++      I S S D  +K+WD 
Sbjct: 192 FVTCSDDNILKIWNFSNGKQERVLSGHH---WDVKSCDWHPEMGLIASASKDNLVKLWDP 248

Query: 535 QSGKCM-------HTFHGKRLQP 550
           +SG C+       HT    R QP
Sbjct: 249 RSGNCISSILKFKHTVLKTRFQP 271

 Score = 35.4 bits (80), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 43/112 (38%), Gaps = 3/112 (2%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES 362
           +LV  +      +WN  +    +  + H  +V  M        ++SG AD  +KIW    
Sbjct: 107 RLVVATYSGEFSLWNASSFTFETLMQAHDSAVTTMKYSHDSDWMISGDADGMIKIWQPNF 166

Query: 363 RTCYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
                +   HTE +  +          + SDD  +++W+       +V  GH
Sbjct: 167 SMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNGKQERVLSGH 218

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSG 537
           ++S   D  IK+W             H E + D+A  +++ + ++ S D  +KIW+  +G
Sbjct: 150 MISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSSNDSKFVTCSDDNILKIWNFSNG 209

Query: 538 KCMHTFHG 545
           K      G
Sbjct: 210 KQERVLSG 217

>Kwal_55.21559
          Length = 351

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 81/174 (46%), Gaps = 25/174 (14%)

Query: 252 HMDGVLTLQF--NYRLLFTGSYDSTVAIW----------DLCSNKLIRRLSGHTDGVKTL 299
           H   V ++ F  +  +L  GS+DST++IW          D    +L+  + GH + VK +
Sbjct: 76  HKKSVRSVSFRPHSSILAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135

Query: 300 YFDEAK--LVTGSLDKTIRVWNY----KTGECISTYRGHTDSVMSV--DAFKKIIVSGSA 351
            +  +   L + S DK++ +W      +  EC+S  + H   V  V   +   ++ S S 
Sbjct: 136 SWSHSGYYLASCSRDKSVWIWEADELGEEYECLSVLQEHAQDVKHVVWHSEMHLLASSSY 195

Query: 352 DKTVKIWHVES---RTCYTLRGH--TEWVNCVKLHPKSFTCFSGSDDTTIRMWD 400
           D T+++W  ++        L GH  T W +  +    S    S SDD+T+R+W+
Sbjct: 196 DDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRVWN 249

 Score = 37.4 bits (85), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 47/104 (45%), Gaps = 15/104 (14%)

Query: 332 HTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR-----GHTEWVNCVKLHPKSFT 386
           HTD + S+D  K ++ + S+D+ +K+ ++++     +       H + V  V   P S  
Sbjct: 32  HTDKLWSIDCSKGLMATSSSDRKIKLVNLKNMDFQLVEELDDSTHKKSVRSVSFRPHSSI 91

Query: 387 CFSGSDDTTIRMW----------DIRTNSCLKVFRGHVGQVQKV 420
             +GS D+TI +W          D      L +  GH  +V+ V
Sbjct: 92  LAAGSFDSTISIWGKEEDADPQDDFPETELLAIIEGHENEVKAV 135

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 34/67 (50%), Gaps = 6/67 (8%)

Query: 264 RLLFTGSYDSTVAIW--DLCSNKLIRRLSGHTDGVKTLYFDEA----KLVTGSLDKTIRV 317
            LL + SYD T+ +W  D    +    L+GH   V    F+++    +L + S D T+RV
Sbjct: 188 HLLASSSYDDTIRLWKEDADDWECAAVLNGHKGTVWCSDFEKSESSLRLASCSDDSTVRV 247

Query: 318 WNYKTGE 324
           WNY   E
Sbjct: 248 WNYVEEE 254

>Scas_585.8
          Length = 460

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 239 WRKGNCQVQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV 296
           W   +      + H   V  +Q+++    + +G  D  + IW    N +    + HT+ +
Sbjct: 117 WNGTSFNESLMQAHDSAVSCIQYSHAGDWMCSGDADGGIKIWQPNFNMVKEFENAHTECI 176

Query: 297 KTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSAD 352
           + + F  +++K VT S D  +++WN+  G+   T  GH   + S D   +  +IVS S D
Sbjct: 177 RDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGHHWDIKSCDWHPEMGLIVSASKD 236

Query: 353 KTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSG-SDDTTIRMWDIR 402
             VK+W   S  C  T+      V   +  P      +  S D + R++DIR
Sbjct: 237 NLVKLWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIR 288

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 15/83 (18%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDL 534
            ++CS DN +K+W+   GQ  RT  GH    WDI + ++      I+S S D  +K+WD 
Sbjct: 188 FVTCSDDNVLKIWNFSNGQVERTLSGH---HWDIKSCDWHPEMGLIVSASKDNLVKLWDP 244

Query: 535 QSGKCM-------HTFHGKRLQP 550
           +SG+C+       HT    R QP
Sbjct: 245 RSGQCISTIIKFKHTVLKTRFQP 267

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 68/162 (41%), Gaps = 8/162 (4%)

Query: 252 HMDGVLTLQFNYRLLFTGSYDSTVAIWDLCS-NKLIRRLSGHTDGVKTLYFDEAK--LVT 308
           H+   +T     R L   +Y+   ++W+  S N+ +  +  H   V  + +  A   + +
Sbjct: 91  HVIPAITWTPEGRRLVVATYNGEFSLWNGTSFNESL--MQAHDSAVSCIQYSHAGDWMCS 148

Query: 309 GSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES-RTC 365
           G  D  I++W             HT+ +  +S        V+ S D  +KIW+  + +  
Sbjct: 149 GDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVE 208

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCL 407
            TL GH   +     HP+     S S D  +++WD R+  C+
Sbjct: 209 RTLSGHHWDIKSCDWHPEMGLIVSASKDNLVKLWDPRSGQCI 250

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 2/68 (2%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDLQSG 537
           + S   D  IK+W          +  H E + DI+  N   + ++ S D  +KIW+  +G
Sbjct: 146 MCSGDADGGIKIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNG 205

Query: 538 KCMHTFHG 545
           +   T  G
Sbjct: 206 QVERTLSG 213

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 43/113 (38%), Gaps = 6/113 (5%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI---IVSGSADKTVKIWHVE 361
           +LV  + +    +WN  T    S  + H DS +S   +      + SG AD  +KIW   
Sbjct: 104 RLVVATYNGEFSLWN-GTSFNESLMQAH-DSAVSCIQYSHAGDWMCSGDADGGIKIWQPN 161

Query: 362 SRTCYTLR-GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
                     HTE +  +          + SDD  +++W+       +   GH
Sbjct: 162 FNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVERTLSGH 214

>Scas_719.52
          Length = 628

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 92/220 (41%), Gaps = 40/220 (18%)

Query: 217 SNGKLMR-PWKVIYRERFKVESNWRKGNC--QVQEFKGHMDGVLTLQF---NYRLLFTGS 270
           +NGK +   W       F V      G C  QV  F+GH   VL   F   N  ++ + S
Sbjct: 42  TNGKFISVNWNASGGGAFAVIPVAEVGKCPDQVPLFRGHTAQVLDTDFDPFNDHIIASSS 101

Query: 271 YDSTVAIWDLCSN----------------KLIRRLSGHTDGVKTLYF---DEAKLVTGSL 311
            DS + IW +  +                K ++ LSGH+  V  + F    E  L + SL
Sbjct: 102 DDSKIGIWKIPEDYSFQHYLDPDGEPKNIKPVKFLSGHSRKVGHVLFHPVAENVLASSSL 161

Query: 312 DKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHV-ESRTCYTL 368
           D T+++WN +TGE + T + H D V  MS       + +   DK +++W + E +     
Sbjct: 162 DYTVKLWNIETGEAVITLK-HPDMVTSMSFSYGGNHLATVCRDKKLRVWDIREGKIVSEG 220

Query: 369 RGHTE-------WV-NCVKLHPKSFTCFSGSDDTTIRMWD 400
             H         W+ N  +L   + T FS   D  I +WD
Sbjct: 221 PAHAGAKNQRVVWLGNSDRL---ATTGFSRLSDRQIGIWD 257

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 11/67 (16%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSH------DGSIKIWD 533
           L S SLD T+KLW+++TG+ + T   H + V  ++        G+H      D  +++WD
Sbjct: 156 LASSSLDYTVKLWNIETGEAVIT-LKHPDMVTSMSFS----YGGNHLATVCRDKKLRVWD 210

Query: 534 LQSGKCM 540
           ++ GK +
Sbjct: 211 IREGKIV 217

>YGL004C (RPN14) [1968] chr7 complement(490705..491958) Protein
           containing three WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has a region of
           weak similarity to a region of S. pombe Cwf1p, which is
           a putative spliceosomal subunit and component of a 40S
           snRNP-containing complex [1254 bp, 417 aa]
          Length = 417

 Score = 55.1 bits (131), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 48/90 (53%), Gaps = 3/90 (3%)

Query: 472 KSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-ADNFR-IISGSHDGSI 529
           K  P    L+S S D  +K+W V+ G   RT  GH   V DIA  D  R ++S S DG+I
Sbjct: 143 KFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSASLDGTI 202

Query: 530 KIWDLQSGKCMHTFHGKRLQPQDEEGSTHL 559
           ++W+  +G  +HTF+ K   P D   S  L
Sbjct: 203 RLWECGTGTTIHTFNRKE-NPHDGVNSIAL 231

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 56/140 (40%), Gaps = 8/140 (5%)

Query: 279 DLCSNKLIRRLSGHTDGVKTLYFDEAKL-----VTGSLDKTIRVWNYKTGECISTYRGHT 333
           D   N +IR  S           D AKL     + G+ +  I+V +          + H 
Sbjct: 77  DFLFNTIIRDGSKMLKRADYTAVDTAKLQMRRFILGTTEGDIKVLDSNFNLQREIDQAHV 136

Query: 334 DSVMSVDAFK--KIIVSGSADKTVKIWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCFSG 390
             +  +  F   + ++S S D  +KIW V +     TL GH   V  + +  +     S 
Sbjct: 137 SEITKLKFFPSGEALISSSQDMQLKIWSVKDGSNPRTLIGHRATVTDIAIIDRGRNVLSA 196

Query: 391 SDDTTIRMWDIRTNSCLKVF 410
           S D TIR+W+  T + +  F
Sbjct: 197 SLDGTIRLWECGTGTTIHTF 216

>Kwal_55.22067
          Length = 451

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 61/154 (39%), Gaps = 5/154 (3%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYK 321
           R L   +Y    ++W+  +      +  H   V  + +  A   L++G  D TI++W   
Sbjct: 96  RRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVAVMKYSHAGDWLISGDSDGTIKIWQPN 155

Query: 322 TGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCV 378
                     HT  +  +S        V+ S D  +KIW+  + +   TL GH   V   
Sbjct: 156 FNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSC 215

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
             HP      SGS D  +++WD R   C+    G
Sbjct: 216 DWHPTMGLIASGSKDNLVKLWDPRAGQCISTILG 249

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDL 534
            ++CS DN +K+W+   GQ   T  GH    WD+ + ++      I SGS D  +K+WD 
Sbjct: 182 FVTCSDDNILKIWNFSNGQQESTLSGHH---WDVRSCDWHPTMGLIASGSKDNLVKLWDP 238

Query: 535 QSGKCMHTFHG 545
           ++G+C+ T  G
Sbjct: 239 RAGQCISTILG 249

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 72/144 (50%), Gaps = 9/144 (6%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTG 323
             T S D+ + IW+  + +    LSGH   V++  +      + +GS D  +++W+ + G
Sbjct: 182 FVTCSDDNILKIWNFSNGQQESTLSGHHWDVRSCDWHPTMGLIASGSKDNLVKLWDPRAG 241

Query: 324 ECISTYRGHTDSVMSV---DAFKKIIVSGSADKTVKIWHVES--RTCYTLRGHTEWVNCV 378
           +CIST  G   +++S         ++   S DK+ +I+ +    +     R  +++++ +
Sbjct: 242 QCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQNMKELAVYRDESDYMS-L 300

Query: 379 KLHPKSFTCFS-GSDDTTIRMWDI 401
             HP + + F+ G  D +++ +D+
Sbjct: 301 TWHPINESMFTVGCYDGSMKHFDL 324

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 45/113 (39%), Gaps = 5/113 (4%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI---IVSGSADKTVKIWHVE 361
           +LV  +      +WN  T    S  + H DS ++V  +      ++SG +D T+KIW   
Sbjct: 97  RLVVATYSGEFSLWNGSTFNFESIMQAH-DSAVAVMKYSHAGDWLISGDSDGTIKIWQPN 155

Query: 362 SRTCYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
                 L   HT+ +  +          + SDD  +++W+           GH
Sbjct: 156 FNMVKVLDEAHTQCIRGISFSGTDSKFVTCSDDNILKIWNFSNGQQESTLSGH 208

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 64/149 (42%), Gaps = 14/149 (9%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK---LVTGSLDKTIRVWNYK 321
           L+ +GS D+ V +WD  + + I  + G    + +  F   K   L   S DK+ R+++ +
Sbjct: 223 LIASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIR 282

Query: 322 TG-ECISTYRGHTD--SVMSVDAFKKIIVSGSADKTVKIWHV------ESRTCY--TLRG 370
              + ++ YR  +D  S+      + +   G  D ++K + +       S  C+      
Sbjct: 283 QNMKELAVYRDESDYMSLTWHPINESMFTVGCYDGSMKHFDLLQEPQDSSSGCFHNIPYA 342

Query: 371 HTEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
           H + +  +  +P      S S D TIR W
Sbjct: 343 HDKCITSLAYNPVGHILASASKDRTIRFW 371

>CAGL0M04081g complement(450572..451939) highly similar to sp|P42841
           Saccharomyces cerevisiae YNL317w PFS2 polyadenylation
           factor I, hypothetical start
          Length = 455

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 65/153 (42%), Gaps = 7/153 (4%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYK 321
           R L   ++    ++W+  S      +  H   V T+ +  A   +++G  D TI++W   
Sbjct: 95  RRLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPN 154

Query: 322 TGECISTYRGHTDSVMSVDAFK---KIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNC 377
                   R HT+ +  V AF       V+ S D  +KIW+  + +    L GH   V  
Sbjct: 155 FNMVKELDRIHTEGIRDV-AFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRS 213

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
              HP+     SGS D  +++WD R+  C+   
Sbjct: 214 CDWHPELGLIVSGSKDNLVKLWDPRSGQCVSTL 246

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 45/85 (52%), Gaps = 15/85 (17%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIW 532
           +  ++CS DN +K+W+   GQ  R   GH    WD+ + ++      I+SGS D  +K+W
Sbjct: 179 SKFVTCSDDNILKIWNFSNGQQERVLSGHH---WDVRSCDWHPELGLIVSGSKDNLVKLW 235

Query: 533 DLQSGKCM-------HTFHGKRLQP 550
           D +SG+C+       HT    R QP
Sbjct: 236 DPRSGQCVSTLLKFKHTVLKTRFQP 260

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 71/149 (47%), Gaps = 16/149 (10%)

Query: 239 WRKGNCQVQEF-KGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDG 295
           W+     V+E  + H +G+  + F  N     T S D+ + IW+  + +  R LSGH   
Sbjct: 151 WQPNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWD 210

Query: 296 VKT--LYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV---DAFKKIIVSGS 350
           V++   + +   +V+GS D  +++W+ ++G+C+ST      +V+          ++ + S
Sbjct: 211 VRSCDWHPELGLIVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAIS 270

Query: 351 ADKTVKIWHVESRTCYTLRGHTEWVNCVK 379
            DK+ ++        + LR     + CV+
Sbjct: 271 KDKSCRV--------FDLRASMNELMCVR 291

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 45/112 (40%), Gaps = 3/112 (2%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES 362
           +L+  +      +WN  +    +  + H  SV  M        ++SG AD T+KIW    
Sbjct: 96  RLIVATFSGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNF 155

Query: 363 RTCYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
                L R HTE +  V          + SDD  +++W+       +V  GH
Sbjct: 156 NMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGH 207

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDLQSG 537
           ++S   D TIK+W             H EG+ D+A  N   + ++ S D  +KIW+  +G
Sbjct: 139 MISGDADGTIKIWQPNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNG 198

Query: 538 KCMHTFHG 545
           +      G
Sbjct: 199 QQERVLSG 206

 Score = 33.9 bits (76), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 13/65 (20%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRT--QFGHVEGVWDIAADNFRIISG------SHDGSIKI 531
           ++S S DN +KLWD ++GQC+ T  +F H      +    F+   G      S D S ++
Sbjct: 223 IVSGSKDNLVKLWDPRSGQCVSTLLKFKHT-----VLKTRFQPTKGNLLAAISKDKSCRV 277

Query: 532 WDLQS 536
           +DL++
Sbjct: 278 FDLRA 282

>Sklu_1963.2 YBR175W, Contig c1963 4075-5019 reverse complement
          Length = 314

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 77/160 (48%), Gaps = 15/160 (9%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTG 323
           + T S D T+ I  +   +L  RL GHT  V +L +      L + S+D++I++W+  TG
Sbjct: 71  IATASDDFTIEINHITYGRL-HRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTG 129

Query: 324 ECISTYRGHTDSVMSVDAF---KKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVK 379
             + T   H++ V+S+D       I+ SGS D  ++I+   +  C  TL    +W +   
Sbjct: 130 TLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENG 189

Query: 380 LHPKSFTCFS--------GSDDTTIRMWDIRTNSCLKVFR 411
           + P S   FS         S D  +++WD    S ++ F+
Sbjct: 190 VVPISQVKFSVNGKYLLVKSLDGVLKIWDFIRGSVVRTFK 229

 Score = 52.8 bits (125), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 64/129 (49%), Gaps = 15/129 (11%)

Query: 245 QVQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF- 301
           ++    GH   VL+L +  +  LL + S D ++ IWD+ +  L++ +S H++ V ++   
Sbjct: 89  RLHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMP 148

Query: 302 --DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTD-----SVMSVDAFK-----KIIVSG 349
             D + L +GS D  IR+++  TG C+ T     D      V+ +   K     K ++  
Sbjct: 149 VCDPSILSSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVK 208

Query: 350 SADKTVKIW 358
           S D  +KIW
Sbjct: 209 SLDGVLKIW 217

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI---AADNFRIISGSHDGSIKIWDLQS 536
           L S S+D +IK+WDV TG  ++T   H E V  I     D   + SGS+DG I+I+D  +
Sbjct: 112 LCSASMDESIKIWDVLTGTLLKTISAHSEPVVSIDMPVCDPSILSSGSYDGLIRIFDTTT 171

Query: 537 GKCMHTF 543
           G C+ T 
Sbjct: 172 GHCLKTL 178

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 90/253 (35%), Gaps = 62/253 (24%)

Query: 303 EAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHV 360
           + K +  S   +  ++N   G        H +S+  +      + I + S D T++I H+
Sbjct: 26  DGKFIAVSQGTSYLLYNVSDGLSAFIPTSHVESMSDICWSPDSQCIATASDDFTIEINHI 85

Query: 361 ESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
                + L GHT  V  +    K     S S D +I++WD+ T + LK    H       
Sbjct: 86  TYGRLHRLVGHTAPVLSLVYTSKGNLLCSASMDESIKIWDVLTGTLLKTISAH------- 138

Query: 421 IPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHL 480
                                                       E   ++D  +  P+ L
Sbjct: 139 -------------------------------------------SEPVVSIDMPVCDPSIL 155

Query: 481 LSCSLDNTIKLWDVQTGQCIRT-----QFGHVEGVWDIAADNFRI-----ISGSHDGSIK 530
            S S D  I+++D  TG C++T      +    GV  I+   F +     +  S DG +K
Sbjct: 156 SSGSYDGLIRIFDTTTGHCLKTLTYDKDWKSENGVVPISQVKFSVNGKYLLVKSLDGVLK 215

Query: 531 IWDLQSGKCMHTF 543
           IWD   G  + TF
Sbjct: 216 IWDFIRGSVVRTF 228

>CAGL0G09845g 940598..942100 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP, hypothetical start
          Length = 500

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 121/286 (42%), Gaps = 29/286 (10%)

Query: 262 NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWN 319
           N   + +GS++  V+I D  + ++ + L  H   V  + +  +++ L+TG  D  I V N
Sbjct: 223 NGNYVASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDHLITVSN 282

Query: 320 YKTGECISTYR--GHTDSV--MSVDAFKKIIVSGSADKTVKIWHVESRTCYTLR-GHTEW 374
              GE I++    GH   +  + V    K I + S D T ++W +E +    L+ GH++ 
Sbjct: 283 RSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKE 342

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLT--IIDAENLV 432
           + C+          +   D T  +WD+R+   +   +GH     K I      ID   L 
Sbjct: 343 LYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHA----KTIYCMDWSIDGHTLA 398

Query: 433 VDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPT----HLLSCSLDNT 488
               +G  +G                       E++++  S+ +      +L+S   D +
Sbjct: 399 ----TGGGDG------VITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRS 448

Query: 489 IKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIW 532
           I ++       + +  GH + V  +DI  +N  +ISG  D S+K W
Sbjct: 449 IFVYSKDNYLKVSSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHW 494

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 66/130 (50%), Gaps = 8/130 (6%)

Query: 240 RKGNCQVQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK 297
           R G   V + +GH   +  + ++     L TG  D  + IWDL  +  + +++ H   V 
Sbjct: 370 RSGKA-VSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSDKLTKITEHKSIVT 428

Query: 298 TLYFDEA---KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSAD 352
           +L FD+A    L++   D++I V++      +S+  GH D V++ D  K  K ++SG  D
Sbjct: 429 SLKFDKANDHNLISSGYDRSIFVYSKDNYLKVSSLIGHADKVLTFDIDKNNKNLISGGWD 488

Query: 353 KTVKIWHVES 362
           ++VK W   S
Sbjct: 489 RSVKHWSTVS 498

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 57/116 (49%), Gaps = 6/116 (5%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKL 306
           GH   +  LQ   + + + T S+DST  +WD+   K +    GH+  +  L F  D A +
Sbjct: 296 GHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALV 355

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIWHV 360
            T   DKT  +W+ ++G+ +S  +GH  ++  +D       + +G  D  + IW +
Sbjct: 356 STAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDL 411

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/244 (21%), Positives = 96/244 (39%), Gaps = 23/244 (9%)

Query: 181 RKCPN---CGWGLPLLHMKRARFVKNASICATNNTCTKDS-NGKLMRPWKVIYRERFKVE 236
           R+  N   C + L    +   R +   + C   N     S NG++             ++
Sbjct: 192 RRAANKYWCSFDLLATQVVSTRPISTVTFCNNGNYVASGSWNGEVS-----------IID 240

Query: 237 SNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLI--RRLSGHTD 294
           SN  +    +Q   G + G+     N  +L TG  D  + + +    + I    + GH  
Sbjct: 241 SNTLEVTQTLQNHDGKVGGI-AWTSNDSVLITGGEDHLITVSNRSDGEFITSNSIGGHEG 299

Query: 295 GVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGS 350
            +  L    +   + T S D T R+W+ +  + +    GH+  +  ++  A   ++ +  
Sbjct: 300 RITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALVSTAG 359

Query: 351 ADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKV 409
            DKT  IW + S +    L+GH + + C+       T  +G  D  I +WD+R +  L  
Sbjct: 360 TDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLRKSDKLTK 419

Query: 410 FRGH 413
              H
Sbjct: 420 ITEH 423

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIW 532
           P    + + S D+T +LWD++  + +  Q GH + ++ +A  AD   + +   D +  IW
Sbjct: 308 PSGKFIGTSSFDSTWRLWDIEKQKQLLLQEGHSKELYCLAFQADGALVSTAGTDKTAIIW 367

Query: 533 DLQSGKCMHTFHG 545
           DL+SGK +    G
Sbjct: 368 DLRSGKAVSQLQG 380

 Score = 37.7 bits (86), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 482 SCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQ 535
           +   D T  +WD+++G+ +    GH + ++  D + D   + +G  DG I IWDL+
Sbjct: 357 TAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSIDGHTLATGGGDGVITIWDLR 412

>KLLA0D02530g complement(212703..214826) gi|5679595|emb|CAB51777.1
           Kluyveromyces lactis CRN1 homologue, start by similarity
          Length = 707

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 66/143 (46%), Gaps = 25/143 (17%)

Query: 245 QVQEFKGHMDGVLTLQF---NYRLLFTGSYDSTVAIWDLCSN----------------KL 285
           QV  F+GH   VL   F   N  ++ +GS D  + IW++  +                K 
Sbjct: 85  QVPLFRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKP 144

Query: 286 IRRLSGHTDGVKTLYF---DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVD 340
           +R LSGH+  V  L F    E  L + SLD T+++W+    E   T + H D V  MS  
Sbjct: 145 VRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVKFTLK-HPDMVTSMSFS 203

Query: 341 AFKKIIVSGSADKTVKIWHVESR 363
              K +V+ S DK +++W V + 
Sbjct: 204 YDGKHLVTVSRDKKLRVWDVRAE 226

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 46/93 (49%), Gaps = 6/93 (6%)

Query: 246 VQEFKGHMDGVLTLQFN---YRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF- 301
           V+   GH   V  L F+     +L + S D TV IWD+   ++   L  H D V ++ F 
Sbjct: 145 VRMLSGHSRKVGHLLFHPLAENILASSSLDYTVKIWDISQEEVKFTLK-HPDMVTSMSFS 203

Query: 302 -DEAKLVTGSLDKTIRVWNYKTGECISTYRGHT 333
            D   LVT S DK +RVW+ +  + +S    H+
Sbjct: 204 YDGKHLVTVSRDKKLRVWDVRAEKIVSEGPAHS 236

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 37/176 (21%), Positives = 71/176 (40%), Gaps = 38/176 (21%)

Query: 368 LRGHTEWVNCVKLHP-KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTII 426
            RGHT  V      P       SGSDD  I +W+I  +  L  +    G  + + P+ ++
Sbjct: 89  FRGHTAQVLDTDFSPFNDHIVASGSDDGKIGIWEIPEDYGLHEYVDEEGNPKDLKPVRML 148

Query: 427 DAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLD 486
              +  V ++                                 L ++I     L S SLD
Sbjct: 149 SGHSRKVGHLLF-----------------------------HPLAENI-----LASSSLD 174

Query: 487 NTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCM 540
            T+K+WD+ + + ++    H + V  +  + D   +++ S D  +++WD+++ K +
Sbjct: 175 YTVKIWDI-SQEEVKFTLKHPDMVTSMSFSYDGKHLVTVSRDKKLRVWDVRAEKIV 229

>ACR166W [1213] [Homologous to ScYKL021C (MAK11) - SH]
           complement(647933..649102) [1170 bp, 389 aa]
          Length = 388

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 64/131 (48%), Gaps = 14/131 (10%)

Query: 286 IRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK-- 343
           I     H   VKTL      LV+GS D+ IR+++ +  + + T   H  S+ S+   +  
Sbjct: 34  IFHFQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRAT 93

Query: 344 ----------KIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSD 392
                     K ++S S D T+ IW V+    +  L+GH   +N + +HP S    S S+
Sbjct: 94  TDKDGKQQGNKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHP-SNRVASVSE 152

Query: 393 DTTIRMWDIRT 403
           D +IR+W++ T
Sbjct: 153 DHSIRLWNLMT 163

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 13/125 (10%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--- 305
           F+ H   V TL  + R L +GS D  + I+DL   K +  L  H   + +L F  A    
Sbjct: 37  FQAHALSVKTLDISRRYLVSGSNDEHIRIYDLQKRKELGTLLNHNGSITSLRFSRATTDK 96

Query: 306 ---------LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF-KKIIVSGSADKTV 355
                    L++ S D TI +W  K  E     +GH   +  +D      + S S D ++
Sbjct: 97  DGKQQGNKWLLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSNRVASVSEDHSI 156

Query: 356 KIWHV 360
           ++W++
Sbjct: 157 RLWNL 161

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 3/59 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 536
           LLS S D+TI +W V+  +      GH   +   DI   N R+ S S D SI++W+L +
Sbjct: 106 LLSASEDHTIIIWRVKDWENFGKLKGHNARINDLDIHPSN-RVASVSEDHSIRLWNLMT 163

>Scas_659.9
          Length = 475

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 128/319 (40%), Gaps = 51/319 (15%)

Query: 251 GHMDGVLTLQFNYR---LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-------- 299
           GH DGV  +  NY+    L TGS D  V  W++ + + +     H   +  L        
Sbjct: 65  GHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFKAHYGLITGLCVTPEHLS 124

Query: 300 -YFDEAKLVTGSLDKTIRVW--------NYKTGECISTYRGHTDSVMSVDAFKKI----- 345
              +E  +++ S DKT+++W        N K  E I+T  G   +  S  AF+ I     
Sbjct: 125 KQKNENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDHHRS 184

Query: 346 ---IVSGSADKTVKIWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCF-SGSDDTTIRMWD 400
               V+G A   +++W    S+    L    + ++ VK +        S   D ++ ++D
Sbjct: 185 KSNFVTGGA--KIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAGSDNSLVLYD 242

Query: 401 IRTNSCLKVFRGHVGQVQKVIPL--TIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXX 458
           +RTNS  +     + Q  +   +    ++A N VV N       +D              
Sbjct: 243 LRTNSPTQ----KIVQTMRTNAICWNPMEAFNFVVAN-------EDHNAYYYDMRNMSRA 291

Query: 459 XXXXNDEENQTLDKSI-PYPTHLLSCSLDNTIKLWDVQTGQCIR----TQFGHVEGVWDI 513
                D  +  +D    P    +++ S D TI++++   G         +  HV  V   
Sbjct: 292 LNVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQHVFQV-KF 350

Query: 514 AADNFRIISGSHDGSIKIW 532
           + D   I+SGS DG++++W
Sbjct: 351 SMDAKYIVSGSDDGNVRLW 369

 Score = 32.7 bits (73), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 506 HVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQ 549
           HV  V D+  +     I++GS+D +I+I++   G     +H KR+Q
Sbjct: 298 HVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGHSREIYHTKRMQ 343

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY-----F 301
           FK H+  V+ + F+     + TGSYD T+ I++        R   HT  ++ ++      
Sbjct: 295 FKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIFNTTHGH--SREIYHTKRMQHVFQVKFSM 352

Query: 302 DEAKLVTGSLDKTIRVWNYKTGE 324
           D   +V+GS D  +R+W  K  E
Sbjct: 353 DAKYIVSGSDDGNVRLWRSKAWE 375

>Sklu_2416.5 YNL317W, Contig c2416 8692-10071
          Length = 459

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 62/154 (40%), Gaps = 5/154 (3%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYK 321
           R L   +Y    ++W+  +      +  H   V T+ +  A   L++G  D  I++W   
Sbjct: 94  RRLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPN 153

Query: 322 TGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCV 378
                   + H + V  +S        V+ S D  +KIW+  + +    L GH   V   
Sbjct: 154 FNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSC 213

Query: 379 KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRG 412
             HP      SGS D  I++WD R+  C+    G
Sbjct: 214 DWHPTMGLIVSGSKDNLIKLWDPRSGQCISTILG 247

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 8/71 (11%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----IISGSHDGSIKIWDL 534
            ++CS DN +K+W+   GQ  R   GH    WD+ + ++      I+SGS D  IK+WD 
Sbjct: 180 FVTCSDDNILKIWNFSNGQQERVLSGHH---WDVKSCDWHPTMGLIVSGSKDNLIKLWDP 236

Query: 535 QSGKCMHTFHG 545
           +SG+C+ T  G
Sbjct: 237 RSGQCISTILG 247

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 83/162 (51%), Gaps = 11/162 (6%)

Query: 250 KGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT--LYFDEAK 305
           + HM+ V  + F+       T S D+ + IW+  + +  R LSGH   VK+   +     
Sbjct: 162 QAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVKSCDWHPTMGL 221

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV---DAFKKIIVSGSADKTVKIWHVES 362
           +V+GS D  I++W+ ++G+CIST  G   +++          ++   + DK+ KI+ +  
Sbjct: 222 IVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLAVVAKDKSCKIFDIRQ 281

Query: 363 --RTCYTLRGHTEWVNCVKLHPKSFTCFS-GSDDTTIRMWDI 401
             +   + R  +++++ +  HP + + F+ G  D +++ +D+
Sbjct: 282 NMKELKSFRDESDYMS-LTWHPINESIFTVGCYDGSLKHFDL 322

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 43/112 (38%), Gaps = 3/112 (2%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSADKTVKIWHVES 362
           +LV  +      +WN  T    S  + H  +V  M        ++SG +D  +KIW    
Sbjct: 95  RLVVATYSGEFSLWNGSTFNFESIMQAHDSAVTTMEYSHAGDWLISGDSDGIIKIWQPNF 154

Query: 363 RTCYTL-RGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
                L + H E V  V          + SDD  +++W+       +V  GH
Sbjct: 155 NMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSGH 206

>KLLA0F16038g complement(1487475..1490063) weakly similar to
           ca|CA1657|IPF16022 Candida albicans unknown function,
           hypothetical start
          Length = 862

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 10/105 (9%)

Query: 257 LTLQFNYRLLFTGSYDSTVAIWDLCSN---KLIRRLSGHTDGVKTLYF-----DEAKLVT 308
           L LQ     +     D T+ I+D  SN   +L+R L    DG+   +F      +  L +
Sbjct: 607 LRLQLTNSDIIVSRSDKTMQIFDKTSNSTPRLLRLLDDQGDGILVNHFYVNADSDQILCS 666

Query: 309 GSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVSGSA 351
            SLDKTIR ++Y TG+C++ Y  H D V  M+  A K + V+G+ 
Sbjct: 667 SSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNG 711

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 16/67 (23%), Positives = 33/67 (49%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKC 539
           L S SLD TI+ +   TG+C+   + H + V  +     + ++ + +G +  W+++  + 
Sbjct: 664 LCSSSLDKTIRCFSYTTGKCLNQYYAHADPVVGMTTVANKFVTVTGNGCLFSWEIRPEEE 723

Query: 540 MHTFHGK 546
                GK
Sbjct: 724 ADEISGK 730

>KLLA0E11297g complement(994770..996308) similar to sp|P38262
           Saccharomyces cerevisiae YBR103w SIF2 SIR4P interacting
           protein, start by similarity
          Length = 512

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 87/177 (49%), Gaps = 12/177 (6%)

Query: 274 TVAIWDLCSNKLIRRLSGHTDGVKTLYFDEA--KLVTGSLDKTIRVWNYKTGECISTYRG 331
           ++ ++ + +NK + RL GHT  + TL F+++   L++ S D TI+VW        + +  
Sbjct: 321 SLLVYTIGNNKPLGRLLGHTSTITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTD 380

Query: 332 HTDSVMSVDAFK-KIIVSGSADKTVKIWHVESRTCYTLRG-HTEWVNCVKLHPKSFTCFS 389
           HT ++ S       +I+S + D TVK+W +   +        +E +    L P       
Sbjct: 381 HTKTISSAHWINDDLIISTAYDGTVKVWSISKNSIVAEASLDSEPIFEASLSPDRNWLTV 440

Query: 390 GSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI-----IDAENLVVDNISGSNE 441
           G+   +  ++D++T   L+ +  +  Q Q+ +P++      ID + L V NI+ +NE
Sbjct: 441 GTLQGSAIVFDVKT--FLESYDQNSVQ-QQSVPISTYGEYQIDQDGLQVTNIAWNNE 494

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/161 (18%), Positives = 64/161 (39%), Gaps = 12/161 (7%)

Query: 264 RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKLVTGSLDKTIRVWNYK 321
            L+ TG+    + +W+    KL   L  H   +  + +++    L+T  +   + +W+  
Sbjct: 222 ELVLTGTTSGELRLWN-KQGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTL 280

Query: 322 TGECISTYRGHTDSVMSVDAF---------KKIIVSGSADKTVKIWHVESRTCYTLRGHT 372
           TG  +  +      + + D+           K ++ G     +      ++    L GHT
Sbjct: 281 TGTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHT 340

Query: 373 EWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
             +  ++ +  + +  S SDD TI++W    +S    F  H
Sbjct: 341 STITTLEFNKSNKSLLSASDDNTIKVWRGGNSSAANDFTDH 381

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 4/88 (4%)

Query: 239 WRKGNCQV-QEFKGHMDGVLTLQF-NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGV 296
           WR GN     +F  H   + +  + N  L+ + +YD TV +W +  N ++   S  ++ +
Sbjct: 367 WRGGNSSAANDFTDHTKTISSAHWINDDLIISTAYDGTVKVWSISKNSIVAEASLDSEPI 426

Query: 297 --KTLYFDEAKLVTGSLDKTIRVWNYKT 322
              +L  D   L  G+L  +  V++ KT
Sbjct: 427 FEASLSPDRNWLTVGTLQGSAIVFDVKT 454

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 39/203 (19%), Positives = 80/203 (39%), Gaps = 26/203 (12%)

Query: 344 KIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           +++++G+    +++W+ + +    L  H   +  +K +       +      + +W   T
Sbjct: 222 ELVLTGTTSGELRLWNKQGKLKNILDSHRSPIVAMKWNQDCTHLLTTDVSNVVILWSTLT 281

Query: 404 NSCLKVFRGHVGQVQKV----IPLTIIDAENLVVDNISGS----NEGDDEPXXXXXXXXX 455
            + L+ F    G ++      I L  ++ +  V+    GS      G+++P         
Sbjct: 282 GTQLQHFSFKEGDIENEDSLGIDLEWVETDKFVIPGPGGSLLVYTIGNNKPLGRLLGHTS 341

Query: 456 XXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV----W 511
                  N       +KS      LLS S DNTIK+W             H + +    W
Sbjct: 342 TITTLEFNKS-----NKS------LLSASDDNTIKVWRGGNSSAANDFTDHTKTISSAHW 390

Query: 512 DIAADNFRIISGSHDGSIKIWDL 534
               ++  IIS ++DG++K+W +
Sbjct: 391 ---INDDLIISTAYDGTVKVWSI 410

>KLLA0F22000g complement(2044973..2047354) similar to sp|P42935
           Saccharomyces cerevisiae YGR200c ELP2 90 kDa subunit of
           elongator and elongating RNA polymerase II holoenzyme
           singleton, start by similarity
          Length = 793

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/167 (26%), Positives = 75/167 (44%), Gaps = 22/167 (13%)

Query: 265 LLFTGSYDSTVAIWDLCSN-------KLIRRLSGHTDGVKTLYFDEAK-----LVTGSLD 312
           +L  G  +  V I+ L SN       +   +L GH D +K+L F E       L +GS D
Sbjct: 166 ILAIGGTNVNVFIYSLVSNSEGVSKLEFATKLEGHEDWIKSLVFRETVPGDYLLASGSQD 225

Query: 313 KTIRVWNYKTGECISTYRGHTD--SVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRG 370
           + IR+W  +T E I T        +++S   +K  I   SAD      HV       + G
Sbjct: 226 RYIRLWRIRTNEKIDTSEEDEKKLTLLSNKIYKFDI---SADV-----HVAINFEALIMG 277

Query: 371 HTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
           H +W++ ++ H       + + DT + +W+  T S + +    +G++
Sbjct: 278 HDDWISSLQWHKTKLQLLTSTADTAVMVWEPDTISGIWICSSRLGEL 324

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 13/98 (13%)

Query: 274 TVAIW---DLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNY---KTG-- 323
           T+A+W   D   + + + L GHT  V  + F +    +V+ S D  +RVWN+   + G  
Sbjct: 34  TIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNFPKLREGHM 93

Query: 324 ---ECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIW 358
              ECI   + H  ++      K ++V G AD ++ +W
Sbjct: 94  DEVECIQVIKHHKHTITVFAVLKNLLVVGCADGSISVW 131

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 9/77 (11%)

Query: 346 IVSGSADKTVKIWHVESRTCY----TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
           +V+  A KT+ +W     + +    TL+GHT  V CV+    +    S S+D  +R+W+ 
Sbjct: 26  VVAYGAGKTIALWKSMDTSHHGVFKTLKGHTAEVTCVRFVKGTDMMVSASEDFEVRVWNF 85

Query: 402 RTNSCLKVFRGHVGQVQ 418
                 K+  GH+ +V+
Sbjct: 86  P-----KLREGHMDEVE 97

>CAGL0J04818g 455846..457810 highly similar to sp|Q06440
           Saccharomyces cerevisiae YLR429w CRN1, start by
           similarity
          Length = 654

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 82/188 (43%), Gaps = 36/188 (19%)

Query: 245 QVQEFKGHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKLIRR------------- 288
           QV  F+GH   VL   F+      + + S D  + IWD+  +  I +             
Sbjct: 73  QVPLFRGHTAQVLDTDFDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIKDIEPT 132

Query: 289 --LSGHTDGVK-TLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDA 341
             L+GH+  V   LY   AK  L + SLD T+R+WN +TGE I   + H D V  MS   
Sbjct: 133 KFLTGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVETGEDIYKLK-HPDMVTSMSFSY 191

Query: 342 FKKIIVSGSADKTVKIWHV-ESRTCYTLRGHTE-------WV-NCVKLHPKSFTCFSGSD 392
               + + + DK +++W+V E +       H         W+ N  +L   + T FS   
Sbjct: 192 DGTHLATVARDKKLRVWNVREEKVVSEGAAHAGAKNQRVVWLGNSERL---ATTGFSKLS 248

Query: 393 DTTIRMWD 400
           D  I +WD
Sbjct: 249 DRQIGIWD 256

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 37/63 (58%), Gaps = 3/63 (4%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSG 537
           L S SLD T+++W+V+TG+ I  +  H + V  +  + D   + + + D  +++W+++  
Sbjct: 155 LASSSLDYTVRIWNVETGEDIY-KLKHPDMVTSMSFSYDGTHLATVARDKKLRVWNVREE 213

Query: 538 KCM 540
           K +
Sbjct: 214 KVV 216

 Score = 33.1 bits (74), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 40/104 (38%), Gaps = 22/104 (21%)

Query: 321 KTGECISTYRGHTDSVMSVDAFKKI----IVSGSADKTVKIWHVES-------------- 362
           K  + +  +RGHT  V+  D F       + S S D  + IW +                
Sbjct: 69  KLPDQVPLFRGHTAQVLDTD-FDPFDDNRVASSSDDGKIGIWDIPQDYSILKSGDNEEIK 127

Query: 363 --RTCYTLRGHTEWVNCVKLHPKSFTCFSGSD-DTTIRMWDIRT 403
                  L GH+  V  +  HP +    + S  D T+R+W++ T
Sbjct: 128 DIEPTKFLTGHSRKVGHILYHPTAKDVLASSSLDYTVRIWNVET 171

>AER114W [2619] [Homologous to ScYLR429W (CRN1) - SH]
           complement(850726..850730,850789..852685) [1902 bp, 633
           aa]
          Length = 633

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 73/185 (39%), Gaps = 25/185 (13%)

Query: 241 KGNCQVQEFKGHMDGVLTLQFN---YRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK 297
           K   Q+  F+GH   VL   F+    R+L +GS D  + +W++ +             V+
Sbjct: 69  KAPDQIPLFRGHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEIPATYSFHNAQDEDGNVE 128

Query: 298 TLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKI 357
             +    K +TG   K   V  + T + +                   + S S D TV++
Sbjct: 129 --HVAPVKFLTGHQRKVGHVLYHPTAQGV-------------------LASSSLDHTVRL 167

Query: 358 WHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG-Q 416
           W+VE  T   +  H + V  +          +   D  +R+WDIR    +    GH G +
Sbjct: 168 WNVEQGTNPIVLTHPDMVTSMSFSYGGTYLATVCRDKMLRVWDIRKGEVVSEGMGHSGPK 227

Query: 417 VQKVI 421
            Q+V+
Sbjct: 228 NQRVV 232

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 10/54 (18%)

Query: 505 GHVEGVWDIAADNF---RIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQDEEG 555
           GH   V D   D F    ++SGS DG I +W++      ++FH      QDE+G
Sbjct: 79  GHTAQVLDTDFDPFDERMLVSGSDDGRIGVWEI---PATYSFHNA----QDEDG 125

>CAGL0D05588g 533235..534668 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1, start by
           similarity
          Length = 477

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 69/323 (21%), Positives = 126/323 (39%), Gaps = 56/323 (17%)

Query: 251 GHMDGVLTLQFNYRLL---FTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL------YF 301
           GH DGV  L  +Y  L    +GS D  +  WD+ S + I     H   +  L        
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNI 124

Query: 302 DEAK------LVTGSLDKTIRVWNYK--------TGECISTYRGHTDSVMSVDAFKKI-- 345
           D A       +++ S DKT+++W+            + I+T  G         AF+ +  
Sbjct: 125 DSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDH 184

Query: 346 ------IVSGSADKTVKIWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCF-SGSDDTTIR 397
                  V+G     + +W +  S+    L    + +N VK +        S   D +I 
Sbjct: 185 SRMTSNFVTGGP--RINLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIV 242

Query: 398 MWDIRTNSCLKVFRGHVGQVQKVIPL--TIIDAENLVVDNISGSNEGDDEPXXXXXXXXX 455
           ++D+RTNS  +     + Q  +V  +    ++A N VV         +D           
Sbjct: 243 LYDLRTNSATQ----KIVQTMRVNSMCWNPMEAFNFVV-------ASEDHNAYYYDMRNM 291

Query: 456 XXXXXXXNDEENQTLDKSI-PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI- 513
                   D  +  +D  I P    +++ S D TI+++ +  G     +  H + +  + 
Sbjct: 292 SRALNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPINKGHS--REIYHTKRMQHVF 349

Query: 514 ----AADNFRIISGSHDGSIKIW 532
               + D+  ++SGS DG++++W
Sbjct: 350 QAKFSMDSKYVMSGSDDGNVRLW 372

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 505 GHVEGVWDIAA---DNFRIISGSHDGSIKIWDLQSGKCMHTF 543
           GH +GV+ +A    D  +I SGS DG IK WD+ S + + +F
Sbjct: 65  GHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQIASF 106

 Score = 33.1 bits (74), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK-----KIIVSGSADKTVKIWH 359
           ++VT S DKTIR++    G     Y  HT  +  V   K     K ++SGS D  V++W 
Sbjct: 316 EVVTASYDKTIRIFPINKGHSREIY--HTKRMQHVFQAKFSMDSKYVMSGSDDGNVRLWR 373

Query: 360 VES 362
            ++
Sbjct: 374 AKA 376

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY-----F 301
           FK H+  V+ +  +     + T SYD T+ I+ +  NK   R   HT  ++ ++      
Sbjct: 298 FKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPI--NKGHSREIYHTKRMQHVFQAKFSM 355

Query: 302 DEAKLVTGSLDKTIRVWNYKTGE 324
           D   +++GS D  +R+W  K  E
Sbjct: 356 DSKYVMSGSDDGNVRLWRAKAWE 378

>KLLA0A08866g 776960..778231 weakly similar to sp|P53196
           Saccharomyces cerevisiae YGL004c singleton, hypothetical
           start
          Length = 423

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 39/73 (53%), Gaps = 2/73 (2%)

Query: 474 IPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-ADNFR-IISGSHDGSIKI 531
            P     LS S+D  +K+WD  TG  +RT  GH   V D A  D  R  +S S DGS+K+
Sbjct: 167 FPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKL 226

Query: 532 WDLQSGKCMHTFH 544
           W+  +  C+ T +
Sbjct: 227 WECSTSACVFTLN 239

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 297 KTLYFDEAK-LVTGSLDKTIRVWNYKTGECISTYRGHTDSV---MSVDAFKKIIVSGSAD 352
           KT +F      ++ S+D  +++W+  TG  + T+ GHT SV     VD  +   VS S+D
Sbjct: 163 KTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRN-FVSASSD 221

Query: 353 KTVKIWHVESRTCYTLRGHTEWVNCVKL 380
            ++K+W   +  C       + +NC+ L
Sbjct: 222 GSLKLWECSTSACVFTLNSNDGINCISL 249

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 50/123 (40%), Gaps = 11/123 (8%)

Query: 296 VKTLYFDEAKLVTGSLDKTIRVWNYKTG--------ECISTYRGHTDSVMSVDAFKKI-- 345
           +  ++  E +LV G  +  I V    TG        E I     H   +     F     
Sbjct: 113 ITNVFDPEIRLVCGDTNGGIYVLRKNTGTNYSGPLQEVIKLPEAHASHITKTQFFPNGHG 172

Query: 346 IVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN 404
            +S S D  +KIW   + T   T  GHT  VN   +  +     S S D ++++W+  T+
Sbjct: 173 FLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSASSDGSLKLWECSTS 232

Query: 405 SCL 407
           +C+
Sbjct: 233 ACV 235

 Score = 33.9 bits (76), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 35/83 (42%), Gaps = 4/83 (4%)

Query: 250 KGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEAK- 305
           + H   +   QF  N     + S D  + IWD  +   +R   GHT  V      D  + 
Sbjct: 155 EAHASHITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRN 214

Query: 306 LVTGSLDKTIRVWNYKTGECIST 328
            V+ S D ++++W   T  C+ T
Sbjct: 215 FVSASSDGSLKLWECSTSACVFT 237

>Sklu_2430.9 YMR102C, Contig c2430 15497-18397
          Length = 966

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 41/76 (53%), Gaps = 2/76 (2%)

Query: 328 TYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFT 386
           ++ GH   ++ +D  K   +++GS DKTVK+WH + +       H ++V CVK HP    
Sbjct: 391 SFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWHCDRKQLLKNFPHPDFVTCVKFHPNDDR 450

Query: 387 CF-SGSDDTTIRMWDI 401
            F SG  D   R+W I
Sbjct: 451 FFISGCLDHKARLWSI 466

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 247 QEFKGHMDGVLTLQFNYR-LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF---D 302
           + F GH   +L + ++    + TGS D TV +W  C  K + +   H D V  + F   D
Sbjct: 390 RSFLGHNQDILDIDWSKNNFVLTGSMDKTVKLWH-CDRKQLLKNFPHPDFVTCVKFHPND 448

Query: 303 EAKLVTGSLDKTIRVWN 319
           +   ++G LD   R+W+
Sbjct: 449 DRFFISGCLDHKARLWS 465

>Kwal_26.7655
          Length = 743

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 329 YRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTC 387
           Y+ HT  ++ +D  K   I++ S DKT ++WH +      +  H ++V C K HP     
Sbjct: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWHCDRPKALKVFTHPDFVTCAKFHPNDDRF 327

Query: 388 F-SGSDDTTIRMWDIRTNSC 406
           F SG  D T+R+W I  NS 
Sbjct: 328 FISGCLDHTLRLWSILDNSV 347

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 76/199 (38%), Gaps = 47/199 (23%)

Query: 249 FKGHMDGVLTLQFNYR-LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF---DEA 304
           ++ H   +L L ++    + T S D T  +W  C      ++  H D V    F   D+ 
Sbjct: 268 YQEHTQDILDLDWSKNGFILTTSMDKTARLWH-CDRPKALKVFTHPDFVTCAKFHPNDDR 326

Query: 305 KLVTGSLDKTIRVW---------NYKTGECIS---------------TYRGHTDSVMSVD 340
             ++G LD T+R+W         +Y  G+ I+               T+ GH        
Sbjct: 327 FFISGCLDHTLRLWSILDNSVSFDYYCGDIITAIDTSPRDGKYTAAGTFNGHI------- 379

Query: 341 AFKKIIVSGSADKTVKIWHVESRTCYTLRGHTE------WVNCVKLHPKS-FTCFSGSDD 393
               II+     + V  +HV  +   T +   E       +   K  P +       S+D
Sbjct: 380 ----IILYTRGLEMVSTFHVLEKPNGTTKKVPESGPKITGIEFFKSAPDNDLRIMVTSND 435

Query: 394 TTIRMWDIRTNSCLKVFRG 412
           + IR++ I+  S L+V +G
Sbjct: 436 SRIRIFRIKGQSLLEVLKG 454

>Scas_615.11
          Length = 349

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 78/169 (46%), Gaps = 34/169 (20%)

Query: 265 LLFTGSYDSTVAIW-------------------DLCSNKLIRRLSGHTDGVKTLYF--DE 303
           LL  GS+DSTV+IW                   +     L+  + GH + VK + +  D 
Sbjct: 74  LLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133

Query: 304 AKLVTGSLDKTIRVW----NYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKI 357
           A L + S DK++ +W    + +  ECIS  + H+  V  V    +  ++ S S D T+++
Sbjct: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193

Query: 358 W--HVESRTCYT-LRGHTEWVNCVKL----HPKSFTCFSGSDDTTIRMW 399
           W  + +   C   L GH   V C       + +S    SGSDD+T+R+W
Sbjct: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 88/229 (38%), Gaps = 30/229 (13%)

Query: 334 DSVMSVDAFKKIIVSGSADKTVKIWHVES--RTCYTLRG------HTEWVNCVKLHPKSF 385
           D + S+D    ++ +GS D+ +KI +V +  R   +L        H + + CV   P S 
Sbjct: 14  DKLWSLDYSHGLLATGSTDRKIKIINVTNAPRGQVSLMDVLDDTVHKKAIRCVAWRPHSN 73

Query: 386 TCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP---LTIIDAENLVVDNISGSNEG 442
              +GS D+T+ +W    +   +            +    L II+     V  I+ S++G
Sbjct: 74  LLAAGSFDSTVSIWTREDDLEEEEDDDEGEGTTNSLEMDLLAIIEGHENEVKGIAWSHDG 133

Query: 443 DDEPXXXXXXXXXXXXXXXXNDE---------ENQTLDKSIPYPTH--LLSCSLDNTIKL 491
                                +E          +Q +   + +P    L S S D+TI+L
Sbjct: 134 ALLSSCSRDKSVWIWETDQDGEEYECISVLQEHSQDVKHVVWHPELPLLASSSYDDTIRL 193

Query: 492 WDV--QTGQCIRTQFGHVEGVW------DIAADNFRIISGSHDGSIKIW 532
           W       +C     GH   VW          ++ R+ SGS D ++++W
Sbjct: 194 WKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVRVW 242

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 265 LLFTGSYDSTVAIWDLCSN--KLIRRLSGHTDGVKTLYFDEAK------LVTGSLDKTIR 316
           LL + SYD T+ +W    +  +    L+GH   V    F++ K      L +GS D T+R
Sbjct: 181 LLASSSYDDTIRLWKDYDDDWECAAVLNGHEGTVWCSDFEKGKNGESIRLCSGSDDSTVR 240

Query: 317 VWNY 320
           VW Y
Sbjct: 241 VWRY 244

>KLLA0F15598g 1439610..1441046 highly similar to sp|P33750
           Saccharomyces cerevisiae YLL011w SOF1 involved in 18S
           pre-rRNA production singleton, start by similarity
          Length = 478

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/322 (21%), Positives = 131/322 (40%), Gaps = 58/322 (18%)

Query: 251 GHMDGVLTLQFNYRLL---FTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-----YFD 302
           GH DGV T+  NY +L    T S D  +  W++ + + +     H   V  L     Y  
Sbjct: 65  GHRDGVYTIAKNYNVLNKLATASGDGVIKYWNMSTREELSSFKAHYGMVTGLCVTPSYLS 124

Query: 303 EAK---LVTGSLDKTIRVW--------NYKTGECISTYRGHTDSVMSVDAFKKI------ 345
             +   +++   DKT+++W        N K    ++T  G   +     AF+ +      
Sbjct: 125 PQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLNTDEGIIKTFHGEHAFQSLDHHRQK 184

Query: 346 --IVSGSADKTVKIWHV-ESRTCYTLRGHTEWVNCVKLHPKSFTCFS--GSDDTTIRMWD 400
              V+G A   +++W    S+    L    + +N V+ +       +  GSD++ + ++D
Sbjct: 185 SNFVTGGAQ--IELWDTNRSKPISNLSWGADNINHVRFNQNEVDILASTGSDNSVV-LYD 241

Query: 401 IRTNSCLKVFRGHVGQVQKVIPLTI----IDAENLVVDNISGSNEGDDEPXXXXXXXXXX 456
           +RTNS  +        VQ +   +I    ++A N V+ N       +D            
Sbjct: 242 LRTNSPTQKI------VQTMRTNSICWNPVEAFNFVIAN-------EDHNAYYYDMRNMS 288

Query: 457 XXXXXXNDEENQTLDKSI-PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI-- 513
                  D  +  +D    P    +++ S D TI+++ V+ G     +  H + +  I  
Sbjct: 289 KALHVFKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHS--REIYHTKRMQHIFQ 346

Query: 514 ---AADNFRIISGSHDGSIKIW 532
                D+  I+SGS DG++++W
Sbjct: 347 VKYTMDSKYIVSGSDDGNVRLW 368

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK-----KIIVSGSADKTVKIWH 359
           ++VTGS DKTIR++  K G     Y  HT  +  +   K     K IVSGS D  V++W 
Sbjct: 312 EVVTGSYDKTIRIYQVKHGHSREIY--HTKRMQHIFQVKYTMDSKYIVSGSDDGNVRLWR 369

Query: 360 VES 362
            ++
Sbjct: 370 AKA 372

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 506 HVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQ 549
           HV  V D+  +     +++GS+D +I+I+ ++ G     +H KR+Q
Sbjct: 297 HVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGHSREIYHTKRMQ 342

 Score = 33.5 bits (75), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 40/83 (48%), Gaps = 9/83 (10%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY-----F 301
           FK H+  V+ + F+     + TGSYD T+ I+ +       R   HT  ++ ++      
Sbjct: 294 FKDHVSAVMDVDFSPTGDEVVTGSYDKTIRIYQVKHGH--SREIYHTKRMQHIFQVKYTM 351

Query: 302 DEAKLVTGSLDKTIRVWNYKTGE 324
           D   +V+GS D  +R+W  K  E
Sbjct: 352 DSKYIVSGSDDGNVRLWRAKAWE 374

>AFL056C [3137] [Homologous to ScYPL183C - SH] (329216..332146)
           [2931 bp, 976 aa]
          Length = 976

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 68/143 (47%), Gaps = 10/143 (6%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRLSGHTDGVK-TLYFDEAKLVTG-SLDKTIRVWNYKTGEC 325
            G+    V +W+L +  +++RL GH   +   +  D+ +LV   S D++IRVW+ +TGE 
Sbjct: 156 AGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQ 215

Query: 326 ISTYRGHTDSVMSVDAFKKI--IVSGSADKTVKIWHV-----ESRTCYTLRGHTEWVNCV 378
           +    GHT  +  +   +    +VS S D T ++W V     +    Y +   T+ V  V
Sbjct: 216 VGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVH-QTKSVWAV 274

Query: 379 KLHPKSFTCFSGSDDTTIRMWDI 401
            +        +  +D  +R+ D+
Sbjct: 275 DVQEDDMVAVTAGNDGRLRLVDL 297

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 36/59 (61%), Gaps = 6/59 (10%)

Query: 482 SCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI----AADNFRIISGSHDGSIKIWDLQS 536
           SCS D +I++W ++TG+ +   +GH   +WD+     AD  +++S S D + ++W + +
Sbjct: 198 SCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLRVAD--KLVSVSEDCTCRVWAVGA 254

 Score = 38.5 bits (88), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 48/103 (46%), Gaps = 3/103 (2%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVM--SVDAFKKIIVSGSADKTVKIWH 359
           D   +  G++   + VW   TG  +    GH  S+    V    +++ S S D+++++W 
Sbjct: 150 DAVYVCAGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWS 209

Query: 360 VESRTCYTLR-GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
           +E+     +  GHT  +  ++    +    S S+D T R+W +
Sbjct: 210 LETGEQVGIAWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAV 252

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 36/83 (43%), Gaps = 1/83 (1%)

Query: 346 IVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN 404
           + +G+    V +W + +      L GH   + C  +        S SDD +IR+W + T 
Sbjct: 154 VCAGTVMGGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETG 213

Query: 405 SCLKVFRGHVGQVQKVIPLTIID 427
             + +  GH  ++  +  L + D
Sbjct: 214 EQVGIAWGHTARIWDLRFLRVAD 236

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 246 VQEFKGHMDGVL--TLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE 303
           VQ  +GH   +    +  + RL+ + S D ++ +W L + + +    GHT  +  L F  
Sbjct: 174 VQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGIAWGHTARIWDLRFLR 233

Query: 304 A--KLVTGSLDKTIRVW 318
              KLV+ S D T RVW
Sbjct: 234 VADKLVSVSEDCTCRVW 250

>KLLA0E04741g 428278..429657 similar to sp|P20053 Saccharomyces
           cerevisiae YPR178w PRP4 U4/U6 snRNP 52 KD protein, start
           by similarity
          Length = 459

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 79/164 (48%), Gaps = 18/164 (10%)

Query: 250 KGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AK 305
           +GH   V +L F  +  L+ T   D+   IWD+ S K I  L GH+  + ++ + +   +
Sbjct: 302 EGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQ 361

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK----IIVSGSADKTVKIWH-- 359
           L +GS D TI+VW+ +    + T   H +S++S   F K     +VS   DK V I++  
Sbjct: 362 LASGSGDGTIKVWDIRKKGNVETILAH-NSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDG 420

Query: 360 --VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
             ++ R   +L GH + V  + +       +S   D ++  W +
Sbjct: 421 NWIKER---SLEGHLDKVMSIDIVGPDI--YSAGWDRSVNKWGV 459

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 70/170 (41%), Gaps = 25/170 (14%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLV------------TGSLDK 313
           +F  ++D  + I+D          SG    VK LY ++A+              + S DK
Sbjct: 236 IFVCTHDGRIVIYD----------SGDETTVKILYKNDARFAQVRCHPCNSFIGSTSFDK 285

Query: 314 TIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVES-RTCYTLRG 370
           T  + +      I    GH+  V S+       ++ +   D    IW + S +   +L+G
Sbjct: 286 TWILIDTVKQAPILIQEGHSAEVFSLSFHNDGSLVSTAGLDAIALIWDIRSGKNIMSLQG 345

Query: 371 HTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
           H++ +  V      +   SGS D TI++WDIR    ++    H   V +V
Sbjct: 346 HSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQV 395

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 54/120 (45%), Gaps = 5/120 (4%)

Query: 246 VQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE 303
           +   +GH   + ++ +  N   L +GS D T+ +WD+     +  +  H   V  + F++
Sbjct: 340 IMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGNVETILAHNSIVSQVKFNK 399

Query: 304 ---AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV 360
                LV+   DK + ++N        +  GH D VMS+D     I S   D++V  W V
Sbjct: 400 QNGGYLVSSGYDKKVNIFNDGNWIKERSLEGHLDKVMSIDIVGPDIYSAGWDRSVNKWGV 459

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 482 SCSLDNTIKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKC 539
           +  LD    +WD+++G+ I +  GH + ++  D + + +++ SGS DG+IK+WD++    
Sbjct: 322 TAGLDAIALIWDIRSGKNIMSLQGHSKPIYSVDWSQNGYQLASGSGDGTIKVWDIRKKGN 381

Query: 540 MHTF 543
           + T 
Sbjct: 382 VETI 385

>CAGL0L02761g complement(320826..322085) similar to sp|P18851
           Saccharomyces cerevisiae YOR212w STE4, hypothetical
           start
          Length = 419

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/258 (22%), Positives = 108/258 (41%), Gaps = 30/258 (11%)

Query: 291 GHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD------AFK 343
           GHT  +  + F  E+++VT S D T  +W+    + +  Y  H   V+++       +  
Sbjct: 172 GHTGYISGVEFVSESRVVTSSGDMTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKN 231

Query: 344 KIIVSGSADKTVKIWHVESRTC---YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWD 400
            +  S  +D    IW V S +    +++       NC+K  P   +   G+DD TI ++D
Sbjct: 232 NMFASCGSDGYTFIWDVRSPSAVQQFSIGSCDS--NCLKFFPDGNSVAVGNDDGTISLFD 289

Query: 401 IRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXX 460
           +R +  + ++  +     +  PL     EN+ +      N  + +               
Sbjct: 290 LRADCTIALYSIN----DRGSPL---QKENVFL------NSNEYQSSSSSPKSPISLATN 336

Query: 461 XXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH---VEGVWDIAADN 517
              D    +LD S      + SC ++   ++WDV  G+ + +  GH   + GV   + D 
Sbjct: 337 YFEDRGVISLDFS-GSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGV-KCSPDG 394

Query: 518 FRIISGSHDGSIKIWDLQ 535
             I +GS D ++K+W  Q
Sbjct: 395 MAICTGSWDQTLKLWTPQ 412

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 68/159 (42%), Gaps = 12/159 (7%)

Query: 284 KLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVM--SV 339
           K +  L GHT+ +    +  D   +++ S D  + VW+  TG   S     +  V+  ++
Sbjct: 76  KPVGILKGHTNKIADFRWSRDSKLILSASQDGFMIVWDSLTGLKRSAIPLDSQWVLTCAL 135

Query: 340 DAFKKIIVSGSADKTVKIWH------VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDD 393
                +  S   +    I+       V+       +GHT +++ V+   +S    S S D
Sbjct: 136 SPSGALAASAGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSESRVVTS-SGD 194

Query: 394 TTIRMWDIRTNSCLKVFRGHVGQVQKV-IPLTIIDAENL 431
            T  +WDI     ++ +  H+G V  + IP+T +   N+
Sbjct: 195 MTCALWDIPKAKRVREYSDHLGDVLAISIPVTNLSKNNM 233

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 255 GVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTD---GVKTLYFDEAKLVTG 309
           GV++L F+   RL+++   +    +WD+   +++  L GH +   GVK    D   + TG
Sbjct: 342 GVISLDFSGSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGVKC-SPDGMAICTG 400

Query: 310 SLDKTIRVW 318
           S D+T+++W
Sbjct: 401 SWDQTLKLW 409

>YMR102C (YMR102C) [4060] chr13 complement(469847..472351) Protein
           containing six WD domains (WD-40 repeat), which may
           mediate protein-protein interactions, has moderate
           similarity to S. cerevisiae Ykl121p, which binds
           phosphatidylinositol [2505 bp, 834 aa]
          Length = 834

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 90/220 (40%), Gaps = 27/220 (12%)

Query: 329 YRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTC 387
           Y+ H   V+ ++  K   I+S S DKTVK+WH + +       H ++V CV+ HP     
Sbjct: 274 YKEHVQDVLDINWSKNNFILSASMDKTVKLWHPDRKNSLKTFIHPDFVTCVEFHPTDDRF 333

Query: 388 F-SGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEP 446
           F SG  D   R+W I  +     F      +   + L+  + +  ++   +G        
Sbjct: 334 FISGCLDHKCRLWSILDDEV--SFEYDCQDLITSVTLSPEEGKYTIIGTFNG-------- 383

Query: 447 XXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTG-QCIRTQFG 505
                           +  + QT +++     H++    D+ I+     TG Q  R+Q  
Sbjct: 384 YVHILMTRGLTPVSSFHVADRQTQEQN----AHVMVTETDSKIRHGPRVTGLQAFRSQLD 439

Query: 506 HVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
                     ++FR++  S+D  I+I+DL+  K +    G
Sbjct: 440 ----------NSFRLVVTSNDSRIRIFDLEQRKLLEVLKG 469

>Kwal_55.21450
          Length = 503

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 82/180 (45%), Gaps = 22/180 (12%)

Query: 246 VQEFKGHMDG---VLTLQFNYRLLFTGSYDSTVAIWDLCSNK-LIRRLSGHTDGVKTLYF 301
           +  + GH +G   +L L  +  L  +   D+ V IWDL  ++ L+R   GH+  V+ + F
Sbjct: 203 IHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISF 262

Query: 302 DE--AKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTV---- 355
           +   ++ ++ S D+ I++W+ +TG+    Y     S   +    +   S S +  V    
Sbjct: 263 NSEGSEFLSVSFDQQIKIWDTETGKVRHQY-----SYSCIPNCAEFRPSNSNEFIVGLSN 317

Query: 356 -KIWHVESRTCY------TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
            +I H + RT +          H   +  +K  P      S S+D ++R+W+ + N  +K
Sbjct: 318 SEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSSSEDKSMRIWENQINIPIK 377

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 4/74 (5%)

Query: 474 IPYPTHL-LSCSLDNTIKLWDV-QTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSI 529
           +P   HL LS   DN +K+WD+ +  + +R   GH + V  I+  ++    +S S D  I
Sbjct: 219 LPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKAVRGISFNSEGSEFLSVSFDQQI 278

Query: 530 KIWDLQSGKCMHTF 543
           KIWD ++GK  H +
Sbjct: 279 KIWDTETGKVRHQY 292

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query: 320 YKTGECISTYRGH---TDSVMSVDAFKKIIVSGSADKTVKIWHV--ESRTCYTLRGHTEW 374
           Y   + I TY GH   T+S++ +     + +S   D  VKIW +  +       RGH++ 
Sbjct: 197 YLPKKLIHTYPGHKNGTNSILLLPKSGHLCLSAGNDNQVKIWDLYRDRELLRDYRGHSKA 256

Query: 375 VNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           V  +  + +     S S D  I++WD  T
Sbjct: 257 VRGISFNSEGSEFLSVSFDQQIKIWDTET 285

>Kwal_26.8628
          Length = 422

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/263 (20%), Positives = 103/263 (39%), Gaps = 25/263 (9%)

Query: 284 KLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--- 339
           +++    GHT  V  + +F+   ++T S D T  +W+    + I+ +  H   V+++   
Sbjct: 166 QIVSMFKGHTCYVSQVEFFENNSIITASGDMTCALWDIPKAKRIAEFSDHLGDVLALALP 225

Query: 340 ----DAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEW-VNCVKLHPKSFTCFSGSDDT 394
                    I  SG +D  V IW   +R        +E  ++ +K     +   +G+DD 
Sbjct: 226 PPHAQTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDISTLKFFNNGYAIVTGADDG 285

Query: 395 TIRMWDIRTNSCLKVFR-GHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXX 453
             RM+D+R++  +  +      Q Q   P  + ++  L         E D  P       
Sbjct: 286 VARMFDMRSDCAVASYSLSQNLQQQANSPTRLYNSSPL---------EYDVTPSNASLTK 336

Query: 454 XXXXXXXXXNDEEN-QTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH---VEG 509
                     D +   +LD S      + +C  D    +WD    + +    GH   + G
Sbjct: 337 TSRSANSTYLDNQGIVSLDFS-GSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISG 395

Query: 510 VWDIAADNFRIISGSHDGSIKIW 532
           V   + D   + +GS D ++K+W
Sbjct: 396 V-KTSPDGMAVCTGSWDATLKLW 417

 Score = 35.8 bits (81), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 255 GVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTD---GVKTLYFDEAKLVTG 309
           G+++L F+   RL+     D    IWD    +++ +L GH+    GVKT   D   + TG
Sbjct: 350 GIVSLDFSGSGRLMHACYTDYGCVIWDTLRAEIVGKLEGHSSRISGVKT-SPDGMAVCTG 408

Query: 310 SLDKTIRVWN 319
           S D T+++W+
Sbjct: 409 SWDATLKLWS 418

 Score = 33.5 bits (75), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 43/214 (20%), Positives = 76/214 (35%), Gaps = 63/214 (29%)

Query: 245 QVQEFKGHMDGVLTL-------QFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK 297
           ++ EF  H+  VL L       Q +  +  +G  D  V IWD  +    +        + 
Sbjct: 208 RIAEFSDHLGDVLALALPPPHAQTSSPIFASGGSDGYVYIWDTRARAAAQSFFVSESDIS 267

Query: 298 TLYF--DEAKLVTGSLDKTIRVWNYKTGECISTY--------------RGHTDSVMSVDA 341
           TL F  +   +VTG+ D   R+++ ++   +++Y              R +  S +  D 
Sbjct: 268 TLKFFNNGYAIVTGADDGVARMFDMRSDCAVASYSLSQNLQQQANSPTRLYNSSPLEYDV 327

Query: 342 F-------------------KKIIVSGSADKTVKIWHVESRTCYT--------------- 367
                                + IVS     + ++ H     CYT               
Sbjct: 328 TPSNASLTKTSRSANSTYLDNQGIVSLDFSGSGRLMHA----CYTDYGCVIWDTLRAEIV 383

Query: 368 --LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
             L GH+  ++ VK  P      +GS D T+++W
Sbjct: 384 GKLEGHSSRISGVKTSPDGMAVCTGSWDATLKLW 417

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/139 (20%), Positives = 60/139 (43%), Gaps = 11/139 (7%)

Query: 289 LSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVM--SVDAFKK 344
           L+GH + +    +  D   +++ S D  + VW+   G   +     +  V+  ++++   
Sbjct: 82  LNGHNNKISDFAWSSDSRSILSASQDGFMIVWDASLGFKKNAIPLDSQWVLTCAINSSGN 141

Query: 345 IIVSGSADKTVKIWH------VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
           ++ S     +  I+       V+ +     +GHT +V+ V+    + +  + S D T  +
Sbjct: 142 LVASAGLTNSCTIYRISQENRVQQQIVSMFKGHTCYVSQVEFFENN-SIITASGDMTCAL 200

Query: 399 WDIRTNSCLKVFRGHVGQV 417
           WDI     +  F  H+G V
Sbjct: 201 WDIPKAKRIAEFSDHLGDV 219

>YMR146C (TIF34) [4102] chr13 complement(557480..558523) Translation
           initiation factor eIF3, p39 subunit, contains two WD
           (WD-40) repeats [1044 bp, 347 aa]
          Length = 347

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 2/66 (3%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSG 537
           L SCS D++  +W    G+ + T  GH   +W I  D F    ++GS D SIK+WD+ +G
Sbjct: 25  LFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSNG 84

Query: 538 KCMHTF 543
           +C+ T+
Sbjct: 85  QCVATW 90

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 45/82 (54%), Gaps = 4/82 (4%)

Query: 288 RLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDA--FK 343
           +L+GH   +  + +++    L + S D +  VW    GE + T  GHT ++ S+D   F 
Sbjct: 5   KLTGHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFT 64

Query: 344 KIIVSGSADKTVKIWHVESRTC 365
           K  V+GSAD ++K+W V +  C
Sbjct: 65  KYCVTGSADYSIKLWDVSNGQC 86

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 48/84 (57%), Gaps = 4/84 (4%)

Query: 251 GHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKL 306
           GH   +  +++N    LLF+ S DS+ ++W   + + +  L GHT  + ++  D      
Sbjct: 8   GHERPLTQVKYNKEGDLLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYC 67

Query: 307 VTGSLDKTIRVWNYKTGECISTYR 330
           VTGS D +I++W+   G+C++T++
Sbjct: 68  VTGSADYSIKLWDVSNGQCVATWK 91

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 345 IIVSGSADKTVKIWH-VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           ++ S S D +  +W+ +      TL GHT  +  + +   +  C +GS D +I++WD+  
Sbjct: 24  LLFSCSKDSSASVWYSLNGERLGTLDGHTGTIWSIDVDCFTKYCVTGSADYSIKLWDVSN 83

Query: 404 NSCLKVFRGHV 414
             C+  ++  V
Sbjct: 84  GQCVATWKSPV 94

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 476 YPTHLLSCSLDNTIKLWDVQTGQCIRT 502
           +  + ++ S D +IKLWDV  GQC+ T
Sbjct: 63  FTKYCVTGSADYSIKLWDVSNGQCVAT 89

>CAGL0A00561g complement(63710..64948) similar to sp|P53196
           Saccharomyces cerevisiae YGL004c, hypothetical start
          Length = 412

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 40/74 (54%), Gaps = 2/74 (2%)

Query: 472 KSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD--IAADNFRIISGSHDGSI 529
           K  P    LLS S D  +K+W ++ G   RT  GH  G+ D  I      ++S S DGS+
Sbjct: 148 KIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSV 207

Query: 530 KIWDLQSGKCMHTF 543
           ++W+L SGK +  F
Sbjct: 208 RLWELGSGKTISKF 221

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF--KKIIVSGSADKTVKIWHVE- 361
           K+V G     I V++++    +S    H   V +V  F    +++SGS D  +K+W +E 
Sbjct: 113 KIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLED 172

Query: 362 SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
                TL+GH+  +    +  +     S S D ++R+W++ +   +  F
Sbjct: 173 GSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGSGKTISKF 221

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/186 (21%), Positives = 77/186 (41%), Gaps = 34/186 (18%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVK-TLYFDEAK-L 306
            H+  V T++   +  +L +GS D  + +W L      R L GH+ G+  T+  +  + +
Sbjct: 139 AHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNV 198

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVES--RT 364
           ++ SLD ++R+W   +G+ IS +    ++   V +   ++   S   + ++   E+  R 
Sbjct: 199 LSSSLDGSVRLWELGSGKTISKFCRKENTTDGVTSMSLLVGEESTSMSAQVTDRETGDRL 258

Query: 365 CYTLRGHTEWV----NCVKLH-----------PKSFTC-------------FSGSDDTTI 396
            +   G   +       + +H           P SF                SG +D T+
Sbjct: 259 EFGTEGKQVFAGHLSGTITVHDLFNKQQILQIPSSFVAPCNTIAQISEHAIVSGYEDGTV 318

Query: 397 RMWDIR 402
             WDIR
Sbjct: 319 ATWDIR 324

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 48/105 (45%), Gaps = 3/105 (2%)

Query: 336 VMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRG-HTEWVNCVKLHPKSFTCFSGSDDT 394
           ++S DA    IV G +   + ++  E  +  +L G H   V  VK+ P +    SGS D 
Sbjct: 104 LISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGSTDM 163

Query: 395 TIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGS 439
            +++W +   S  +  +GH   +   I   I    N++  ++ GS
Sbjct: 164 QLKVWSLEDGSNPRTLKGHSAGITDTI--IIERGRNVLSSSLDGS 206

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 40/78 (51%), Gaps = 4/78 (5%)

Query: 289 LSGHTDGVKT--LYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKI- 345
           +  H   V T  ++   A L++GS D  ++VW+ + G    T +GH+  +      ++  
Sbjct: 137 VGAHVSDVTTVKIFPSNAVLLSGSTDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGR 196

Query: 346 -IVSGSADKTVKIWHVES 362
            ++S S D +V++W + S
Sbjct: 197 NVLSSSLDGSVRLWELGS 214

>CAGL0G03399g complement(325879..326988) highly similar to sp|P40066
           Saccharomyces cerevisiae YER107c GLE2, start by
           similarity
          Length = 369

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 62/105 (59%), Gaps = 8/105 (7%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK------LVTGSLDKTIRVWN 319
           + +G  D+TV ++D+ S +  +++  H D VK+L F +        LVTGS DKTI+ W+
Sbjct: 94  IASGGCDNTVKLYDVASGQS-QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWD 152

Query: 320 YKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRT 364
            +  + I+T     + V ++D  ++++V G+A++ + I ++ + T
Sbjct: 153 TRQPQPITTI-AMPERVYTMDNKQQLLVVGTAERHIAIINLANPT 196

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 13/103 (12%)

Query: 310 SLDKTIRVWNYKTG--ECISTYRGHTDSVM----SVDAFKKIIVSGSADKTVKIWHVESR 363
           S D  +R+W+ + G  +  + Y  H   V+    S+D  +  I SG  D TVK++ V S 
Sbjct: 55  SWDGKVRIWDAQNGVPQGKAQYE-HNGPVLCTRWSLDGAR--IASGGCDNTVKLYDVASG 111

Query: 364 TCYTLRGHTEWVNCVKL---HPKSFTCF-SGSDDTTIRMWDIR 402
               +  H + V  ++     P +  C  +GS D TI+ WD R
Sbjct: 112 QSQQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTR 154

 Score = 37.4 bits (85), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 76/204 (37%), Gaps = 33/204 (16%)

Query: 245 QVQEFKGHMDGVLTLQF------NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT 298
           Q Q+   H D V +L+F      N   L TGS+D T+  WD    + I  ++   + V T
Sbjct: 112 QSQQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTRQPQPITTIA-MPERVYT 170

Query: 299 LYFDEAKLVTGSLDKTIRVWNYKTGECI-----STYRGHTDSVMSVDAFKKIIVSGSADK 353
           +   +  LV G+ ++ I + N      I     S  +  T  V   +      + GS + 
Sbjct: 171 MDNKQQLLVVGTAERHIAIINLANPTTIFKSSQSPLKWQTRVVACYNEGDGYAI-GSVEG 229

Query: 354 TVKIWHV----ESRTCYTLRGHTEW----------------VNCVKLHPKSFTCFSGSDD 393
              I +V    + ++ ++ + H +                 VN +  HP   T  +   D
Sbjct: 230 RCAIKYVDDEAQKKSGFSFKCHRQTQPNRAAGSSSQSLVYPVNSIAFHPIYGTFVTAGGD 289

Query: 394 TTIRMWDIRTNSCLKVFRGHVGQV 417
            +   WD      LK F    G +
Sbjct: 290 GSFHFWDKNQRHRLKGFPSMQGSI 313

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 7/60 (11%)

Query: 484 SLDNTIKLWDVQTG-QCIRTQFGHVEGV----WDIAADNFRIISGSHDGSIKIWDLQSGK 538
           S D  +++WD Q G    + Q+ H   V    W +  D  RI SG  D ++K++D+ SG+
Sbjct: 55  SWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSL--DGARIASGGCDNTVKLYDVASGQ 112

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 9/70 (12%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFG-HVEGVWDI------AADNFRIISGSHDGSIKIW 532
           + S   DNT+KL+DV +GQ    Q G H + V  +        +   +++GS D +IK W
Sbjct: 94  IASGGCDNTVKLYDVASGQS--QQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFW 151

Query: 533 DLQSGKCMHT 542
           D +  + + T
Sbjct: 152 DTRQPQPITT 161

>Kwal_33.15475
          Length = 783

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 70/154 (45%), Gaps = 15/154 (9%)

Query: 271 YDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK-----LVTGSLDKTIRVWNYKTGEC 325
           Y  T+    L + +L   L GH D VK + F E       L TGS D+ IR+W  +T E 
Sbjct: 176 YSFTLQDGTLNNFQLAAELEGHEDWVKAMDFYEESPGNMLLATGSQDRYIRLWRIRTNEL 235

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCY--TLRGHTEWVNCVKLHPK 383
           I     ++D     D FK  ++     K      ++    +   + GH +W++C+K H +
Sbjct: 236 ID----NSDE----DEFKLNLLGNKQSKFFITPDLKVAINFDALIVGHDDWISCLKWHKE 287

Query: 384 SFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
                + + DT + +W+   +S + +    +G++
Sbjct: 288 RPQLLASTADTAVMVWEPDADSGVWICASRLGEL 321

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 12/114 (10%)

Query: 265 LLFTGSYDSTVAIW---DLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWN 319
           L F G    T+A+W   D   + + R L GH   V  + F      +V+ S D  +R+W 
Sbjct: 27  LAFAGG--KTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWA 84

Query: 320 YKTGE-----CISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTL 368
           ++  +     C+     H  ++ S+     I+  G AD +V +W  E+     L
Sbjct: 85  FEEKDQDALKCVQVIDHHKHTITSLSVISNILSVGCADGSVSLWLTENNQAILL 138

 Score = 36.6 bits (83), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 9/77 (11%)

Query: 346 IVSGSADKTVKIWH----VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMW-- 399
           I++ +  KT+ +W            TL+GH   V CVK  P +    S S+D+ +R+W  
Sbjct: 26  ILAFAGGKTIALWKPLDPAHHGVYRTLKGHNAEVTCVKFVPGTNLMVSSSEDSQVRLWAF 85

Query: 400 ---DIRTNSCLKVFRGH 413
              D     C++V   H
Sbjct: 86  EEKDQDALKCVQVIDHH 102

>Scas_700.27*
          Length = 433

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 73/160 (45%), Gaps = 18/160 (11%)

Query: 273 STVAIWDLCSNKLIRRLSGHT-DGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECI----- 326
           +T+ I DL   KL+  L+ H  D  +TL F    + T      IR+++  T + I     
Sbjct: 143 TTIKICDLAKGKLLVTLACHIHDRNETLPFPN-DIPTYFQPLNIRLYHAGTWKKIWLLEI 201

Query: 327 --STYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTC-YTLRGHTEWVN---CVKL 380
             +TY  +   +  +     +I +   D  V++W + +R    TL GH   +N   C+ +
Sbjct: 202 TMATYHEYIQMIFIL--LLNLIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPV 259

Query: 381 HPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKV 420
            P+  +C   S D TIR+WDI     +KV   H   V+ +
Sbjct: 260 DPQIVSC---STDATIRLWDIVAGKSMKVITHHKKSVRNI 296

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 3/77 (3%)

Query: 474 IPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKI 531
           +P    ++SCS D TI+LWD+  G+ ++    H + V +IA     F + S S +  I+ 
Sbjct: 257 LPVDPQIVSCSTDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSAN-DIRS 315

Query: 532 WDLQSGKCMHTFHGKRL 548
           W L  G  +  F+   L
Sbjct: 316 WKLPEGGLLTNFNSDGL 332

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 249 FKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY--FDEAKL 306
           +  ++  +  L  N  L+ T   DS V +WD+ +   +  L GH + +  ++    + ++
Sbjct: 206 YHEYIQMIFILLLN--LIATAGRDSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDPQI 263

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV 339
           V+ S D TIR+W+   G+ +     H  SV ++
Sbjct: 264 VSCSTDATIRLWDIVAGKSMKVITHHKKSVRNI 296

 Score = 38.5 bits (88), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 486 DNTIKLWDVQTGQCIRTQFGH---VEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMH- 541
           D+ ++LWD++    + T  GH   +  V  +  D  +I+S S D +I++WD+ +GK M  
Sbjct: 227 DSVVRLWDIRARVAVMTLIGHKNPINKVHCLPVDP-QIVSCSTDATIRLWDIVAGKSMKV 285

Query: 542 -TFHGKRLQ 549
            T H K ++
Sbjct: 286 ITHHKKSVR 294

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/149 (16%), Positives = 62/149 (41%), Gaps = 12/149 (8%)

Query: 270 SYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKT-IRVWNYKTGECIST 328
           S D+T+ +WD+ + K ++ ++ H   V+ + F   +    S     IR W    G  ++ 
Sbjct: 267 STDATIRLWDIVAGKSMKVITHHKKSVRNIAFHPTEFSMSSCSANDIRSWKLPEGGLLTN 326

Query: 329 YRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHVESRTCYT------LRGHTE---WVNC 377
           +      +++  +  +  ++ +GS +  +  +  +S   Y       + G  E    + C
Sbjct: 327 FNSDGLGIINTLSINQDDVLFAGSDNGMLSFYDYKSGHKYQSMMTKEIPGSLESERGILC 386

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSC 406
                      +G  D +I++W + +++ 
Sbjct: 387 STFDRTGLRLLTGETDKSIKIWSMDSDAT 415

>Scas_721.128
          Length = 851

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 75/179 (41%), Gaps = 23/179 (12%)

Query: 255 GVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIR---------RLSGHTDGVK---TLY 300
            + TL+F++  + + TGS D  V +W + S+ + R          L      ++    L 
Sbjct: 168 AIWTLKFSHDGKYMATGSKDGCVMLWKVISSPVERWELDRAEESNLVAMAKSIRIKQNLE 227

Query: 301 FDEAKLVTGS---LDKTIRVWNYKTG----ECISTYRGHTDSVMSVDAFKK-IIVSGSAD 352
            +EA L   S    D  +   N          +  Y+ H+  ++ +D  K   +++ S D
Sbjct: 228 TNEAHLNAPSRPPTDTNLESLNLYAPIFHPNPVRIYKEHSHDILDLDWSKNNFLLTASMD 287

Query: 353 KTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCF-SGSDDTTIRMWDIRTNSCLKVF 410
           K V +WH +  T      H ++V  V+ HPK    F SG  D   RMW I  N  +  F
Sbjct: 288 KLVSLWHPDRETSLKSFPHPDFVTSVRFHPKDDRFFVSGCLDHKCRMWSILENKVVYEF 346

>YER066W (YER066W) [1497] chr5 (290240..290797) Protein containing
           three WD domains (WD-40 repeat), which may mediate
           protein-protein interactions, has high similarity to a
           region of S. cerevisiae Cdc4p, which is a component of
           the SCF-Cdc4p complex involved in ubiquitin-dependent
           degradation [558 bp, 185 aa]
          Length = 185

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 53/126 (42%), Gaps = 22/126 (17%)

Query: 289 LSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKT----GEC----------------I 326
           LSGHTD + +  +D  +   ++ S+D TIR+W+ +     GEC                +
Sbjct: 7   LSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAM 66

Query: 327 STYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFT 386
            T RGH   V  +    K +VS S D +++ W   +        HT+      LH     
Sbjct: 67  YTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANTYFLKHFFDHTQLNTITALHVSDEV 126

Query: 387 CFSGSD 392
             SGS+
Sbjct: 127 LVSGSE 132

 Score = 33.9 bits (76), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 20/90 (22%)

Query: 481 LSCSLDNTIKLWDVQT----GQC----------------IRTQFGHVEGVWDIAADNFRI 520
           +S S+D TI++WD++     G+C                + T  GH   V  +   +  +
Sbjct: 27  ISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAMYTLRGHRALVGLLGLSDKFL 86

Query: 521 ISGSHDGSIKIWDLQSGKCMHTFHGKRLQP 550
           +S S DGSI+ WD  +    H F   +L  
Sbjct: 87  VSASVDGSIRCWDANTYFLKHFFDHTQLNT 116

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 25/126 (19%)

Query: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDL------------------CSNKL--I 286
             GH D + +  +++  +   + S D+T+ IWDL                  C+  L  +
Sbjct: 7   LSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAM 66

Query: 287 RRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHT--DSVMSVDAFKK 344
             L GH   V  L   +  LV+ S+D +IR W+  T   +  +  HT  +++ ++    +
Sbjct: 67  YTLRGHRALVGLLGLSDKFLVSASVDGSIRCWDANT-YFLKHFFDHTQLNTITALHVSDE 125

Query: 345 IIVSGS 350
           ++VSGS
Sbjct: 126 VLVSGS 131

 Score = 32.3 bits (72), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 366 YTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
           Y L GHT+ +       +   C S S DTTIR+WD+
Sbjct: 5   YILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDL 40

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 6/51 (11%)

Query: 498 QCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQ----SGKCMHT 542
           +C+    GH + ++    D+ R   IS S D +I+IWDL+    +G+C + 
Sbjct: 2   KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYA 52

>ABL024W [568] [Homologous to ScYMR102C - SH; ScYKL121W - SH]
           complement(353684..355888) [2205 bp, 734 aa]
          Length = 734

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 345 IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPK-SFTCFSGSDDTTIRMWDIRT 403
            +++ S DKTVK+WH+   T      H ++V CV+ HP      FSG  D T+R W I  
Sbjct: 227 FLLTASMDKTVKLWHINRTTSLKTFVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILE 286

Query: 404 NSCLKVF 410
               + F
Sbjct: 287 GEVAEAF 293

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/193 (22%), Positives = 81/193 (41%), Gaps = 26/193 (13%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF---DEAKLVTGSLDKTIRVWNYK 321
            L T S D TV +W +     ++    H D V  + F   D+    +G LD T+R W+  
Sbjct: 227 FLLTASMDKTVKLWHINRTTSLKTFV-HPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSIL 285

Query: 322 TGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVES----RTCYTLRGHTEWV 375
            GE    +    D +M++D       ++ G+ +  V + H        + + L+   E  
Sbjct: 286 EGEVAEAFNC-GDLIMALDVSPDGNWLLIGTFNGYVHVLHTNGLKLLHSFHLLQKPNETE 344

Query: 376 NCVKLHPKS-------------FTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIP 422
           N  +  PK                    S+D+ +R++D+ T   L++FRG   +  ++  
Sbjct: 345 NRPRHGPKITGVEFIRHKAYPWLGLLITSNDSRVRLFDMSTTRLLEIFRGFSNESSRISA 404

Query: 423 --LTIIDAENLVV 433
             L + D E++V+
Sbjct: 405 HHLEMEDGESVVL 417

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI---AADNFRIISGSHDGSIKIWDLQS 536
           LL+ S+D T+KLW +     ++T F H + V  +     D+    SG  D +++ W +  
Sbjct: 228 LLTASMDKTVKLWHINRTTSLKT-FVHPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILE 286

Query: 537 GKCMHTF 543
           G+    F
Sbjct: 287 GEVAEAF 293

>ADL322C [1419] [Homologous to ScYBR103W (SIF2) - SH]
           (128830..130335) [1506 bp, 501 aa]
          Length = 501

 Score = 48.9 bits (115), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 39/180 (21%), Positives = 77/180 (42%), Gaps = 18/180 (10%)

Query: 272 DSTVAIWDLCSNKLIRRLS------GHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           D+   +W++ S   ++  S        + GV   + D+ K     +  +I V+N    + 
Sbjct: 256 DNMTIVWNVLSGTAVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKP 315

Query: 326 ISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHP 382
           I   RGH+ ++ ++  +   K+++S S D T+++W   +    +   GH++ +       
Sbjct: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375

Query: 383 KSFTCFSGSDDTTIRMWDIRTNSCLKV--------FRGHVGQVQKVIPLTIIDAENLVVD 434
              T  S S D +IR+W + +NS +          F G +   Q       +D E +V D
Sbjct: 376 DD-TIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYD 434

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/208 (23%), Positives = 86/208 (41%), Gaps = 30/208 (14%)

Query: 346 IVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
           +++G     +++W VE +    L  H   + C+K +       +   D    +W++ + +
Sbjct: 209 LLTGVESGELRLWSVEGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSGT 268

Query: 406 CLKVFRGHVGQVQKVIPL--TIIDAENLVVDNISGS----NEGDDEPXXXXXXXXXXXXX 459
            ++ F       ++ + +  T ID +   +  I GS    N G  +P             
Sbjct: 269 AVQHFSFKEAGTEESLGVDATWIDQDKFAIPGIQGSILVFNIGISKPIGKLRG------- 321

Query: 460 XXXNDEENQTLDKSIPYPTH---LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV----WD 512
                  ++TL  +I Y  H   LLS S DNT+++W           +GH + +    W 
Sbjct: 322 ------HSKTL-TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHW- 373

Query: 513 IAADNFRIISGSHDGSIKIWDLQSGKCM 540
              D+  IIS S DGSI++W L S   +
Sbjct: 374 --VDDDTIISTSMDGSIRVWSLASNSTV 399

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 80/184 (43%), Gaps = 15/184 (8%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTG 323
           L TG     + +W +   KL   LS H   +  + +  DE  ++T   D    VWN  +G
Sbjct: 209 LLTGVESGELRLWSV-EGKLQNILSYHRAPIVCIKWNSDETHVLTCDADNMTIVWNVLSG 267

Query: 324 ECISTY---RGHTDSVMSVDAF----KKIIVSGSADKTVKIWHVE-SRTCYTLRGHTEWV 375
             +  +      T+  + VDA      K  + G    ++ ++++  S+    LRGH++ +
Sbjct: 268 TAVQHFSFKEAGTEESLGVDATWIDQDKFAIPG-IQGSILVFNIGISKPIGKLRGHSKTL 326

Query: 376 NCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDN 435
             +  +  +    S SDD T+R+W     +   VF GH    Q +     +D + ++  +
Sbjct: 327 TTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGH---SQSITSAHWVDDDTIISTS 383

Query: 436 ISGS 439
           + GS
Sbjct: 384 MDGS 387

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/121 (19%), Positives = 61/121 (50%), Gaps = 5/121 (4%)

Query: 246 VQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-D 302
           + + +GH   + T+ +N   +LL + S D+T+ +W   +        GH+  + + ++ D
Sbjct: 316 IGKLRGHSKTLTTIAYNEHNKLLLSASDDNTLRVWRGGNLNPSHVFYGHSQSITSAHWVD 375

Query: 303 EAKLVTGSLDKTIRVWNYKTGECI--STYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHV 360
           +  +++ S+D +IRVW+  +   +  +T  G  +   ++   +    +G+ D  V ++ +
Sbjct: 376 DDTIISTSMDGSIRVWSLASNSTVASATVDGVPNFTGALSPDQGKFATGTLDGEVMVYDI 435

Query: 361 E 361
           +
Sbjct: 436 Q 436

>Kwal_27.11126
          Length = 996

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 38/55 (69%), Gaps = 2/55 (3%)

Query: 482 SCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDL 534
           SCS D +IKLWD+++GQ + T +GH   +W++    ++ ++IS S D + ++WD+
Sbjct: 198 SCSDDRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDI 252

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 68/143 (47%), Gaps = 4/143 (2%)

Query: 295 GVKTLYF-DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSA 351
           G  T+Y  D+  +  G++   + VW+ ++ + +  +  H  ++  V A K  K   S S 
Sbjct: 142 GTITVYSQDKVHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSD 201

Query: 352 DKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
           D+++K+W ++S +   T  GHT  +  +          S S+D T R+WDI  ++ L   
Sbjct: 202 DRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQA 261

Query: 411 RGHVGQVQKVIPLTIIDAENLVV 433
             H G + K +    +D E ++ 
Sbjct: 262 SVHEGHLLKSVWGLDVDNERMIA 284

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 50/100 (50%), Gaps = 10/100 (10%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK-----LVTGSLDKTIRVWNYKT 322
            G+    V +WDL S + +   + H   +   +F  A        + S D++I++W+ K+
Sbjct: 156 AGTVMDGVIVWDLESEQNLHHFTDHEGAI---FFVTASKNGKYAASCSDDRSIKLWDLKS 212

Query: 323 GECISTYRGHTDSVMSVDAF--KKIIVSGSADKTVKIWHV 360
           G+ +ST  GHT  + ++  F     ++S S D T ++W +
Sbjct: 213 GQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDI 252

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 54/101 (53%), Gaps = 8/101 (7%)

Query: 272 DSTVAIWDLCSNKLIRRLSGHTDGV-KTLYFD-EAKLVTGSLDKTIRVWNYKTGECI--- 326
           D ++ +WDL S +L+    GHT  +   L+FD ++K+++ S D T RVW+      +   
Sbjct: 202 DRSIKLWDLKSGQLLSTAWGHTARIWNLLFFDNDSKVISVSEDCTCRVWDISEDNTLSQA 261

Query: 327 STYRGH-TDSV--MSVDAFKKIIVSGSADKTVKIWHVESRT 364
           S + GH   SV  + VD  + I  +   D  +K+  +++++
Sbjct: 262 SVHEGHLLKSVWGLDVDNERMIAATSGNDGRIKLTDLKAKS 302

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDLQ 535
            H+ + ++ + + +WD+++ Q +     H   ++ + A  +     S S D SIK+WDL+
Sbjct: 152 VHINAGTVMDGVIVWDLESEQNLHHFTDHEGAIFFVTASKNGKYAASCSDDRSIKLWDLK 211

Query: 536 SGKCMHTFHG 545
           SG+ + T  G
Sbjct: 212 SGQLLSTAWG 221

>CAGL0J06512g complement(620516..622153) similar to sp|Q04199
           Saccharomyces cerevisiae YML102w CAC2, start by
           similarity
          Length = 545

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 74/181 (40%), Gaps = 42/181 (23%)

Query: 241 KGNCQVQE------FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNK-------- 284
           KG C+V           H   V  ++F++R  +L +   D  V +W L + +        
Sbjct: 62  KGTCKVDTIDFLSGLSLHEQAVNVIRFDHRGNVLASAGDDGQVLLWKLTNEETRKKQQRM 121

Query: 285 -----------LIRRLSGHTD--------GVKTLY-----FDEAKLVTGSLDKTIRVWNY 320
                      + +RL G  +        G   +Y      D+  LVT S+D +++V+N 
Sbjct: 122 GDEPVEGDGWAVWKRLRGTANDLDNMPGGGASEIYDLSWSPDDKYLVTASMDNSLKVFNV 181

Query: 321 KTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCV 378
            TG C++  + H   V  V  D   + I+S S D+++ I+ +E R    +   T     +
Sbjct: 182 DTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRSINIYEIELRDSKDITSSTTSTELI 241

Query: 379 K 379
           K
Sbjct: 242 K 242

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 40/65 (61%), Gaps = 6/65 (9%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH---VEGV-WDIAADNFRIISGSHDGSIK 530
           P   +L++ S+DN++K+++V TG C+     H   V+GV WD    N  IIS S D SI 
Sbjct: 162 PDDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPL--NQYIISQSVDRSIN 219

Query: 531 IWDLQ 535
           I++++
Sbjct: 220 IYEIE 224

>Sklu_2364.4 YGL003C, Contig c2364 7265-8932 reverse complement
          Length = 555

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/183 (25%), Positives = 80/183 (43%), Gaps = 11/183 (6%)

Query: 230 RERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIR 287
           R+R  +  + R      ++ + H   V  L++N     L +G  D+ V ++D  S K   
Sbjct: 351 RDRKILHRDVRMPEPYFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTL 410

Query: 288 RLSGHTDGVKTLYFDEAK---LVTG--SLDKTIRVWNYKTG---ECISTYRGHTDSVMSV 339
           +L+ HT  VK + +   K   L TG  + DK +++WN  T      I T     + + S 
Sbjct: 411 KLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKIWNVNTSTKLRDIDTGSQVCNMIWSK 470

Query: 340 DAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
           +  + +   G +   + +W   S      L+GH+  V  + L     T  SG+ D T+R 
Sbjct: 471 NTNELVTSHGYSRYNLTLWDYPSMEPVAILKGHSFRVLHLTLSADGTTVVSGAGDETLRY 530

Query: 399 WDI 401
           W +
Sbjct: 531 WKL 533

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 65/150 (43%), Gaps = 7/150 (4%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L  G  +  V I+D+   K IR LSGH D V  L ++   L +GS D+ I   + +  E 
Sbjct: 306 LAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEP 365

Query: 326 -ISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESR-TCYTLRGHTEWVNCVKLH 381
                  HT  V  +  +  +  + SG  D  V ++   SR     L  HT  V  +   
Sbjct: 366 YFEQVETHTQEVCGLKWNTDENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWS 425

Query: 382 PKS---FTCFSGSDDTTIRMWDIRTNSCLK 408
           P          G+ D  +++W++ T++ L+
Sbjct: 426 PHKRGILATGGGTADKKMKIWNVNTSTKLR 455

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 10/182 (5%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDL-CSNKLIRRLSGHTDGVKTLYF--D 302
           ++   GHMD V  L +N  +L +GS D  +   D+        ++  HT  V  L +  D
Sbjct: 326 IRTLSGHMDRVACLSWNNHILTSGSRDRKILHRDVRMPEPYFEQVETHTQEVCGLKWNTD 385

Query: 303 EAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVS---GSADKTVKI 357
           E +L +G  D  + V++  + +       HT +V ++     K+ I++   G+ADK +KI
Sbjct: 386 ENRLASGGNDNVVYVYDGTSRKPTLKLAEHTAAVKAIAWSPHKRGILATGGGTADKKMKI 445

Query: 358 WHVESRT-CYTLRGHTEWVNCV-KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           W+V + T    +   ++  N +   +        G     + +WD  +   + + +GH  
Sbjct: 446 WNVNTSTKLRDIDTGSQVCNMIWSKNTNELVTSHGYSRYNLTLWDYPSMEPVAILKGHSF 505

Query: 416 QV 417
           +V
Sbjct: 506 RV 507

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 529
           +HL     +  ++++D+   +CIRT  GH++ V  ++ +N  + SGS D  I
Sbjct: 304 SHLAVGQGNGLVEIYDIVKRKCIRTLSGHMDRVACLSWNNHILTSGSRDRKI 355

>CAGL0L06952g complement(780793..781836) highly similar to sp|P40217
           Saccharomyces cerevisiae YMR146c TIF34 translation
           initiation factor eIF3, start by similarity
          Length = 347

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRI--ISGSHDGSIKIWDLQSG 537
           L +CS D +  +W    G+ + T  GH+  +W I +D+  +  ++GS D +IK+W L +G
Sbjct: 25  LFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNG 84

Query: 538 KCMHTF 543
           +C+ T+
Sbjct: 85  QCVQTW 90

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 44/83 (53%), Gaps = 4/83 (4%)

Query: 251 GHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKL-- 306
           GH   +  +++N    LLFT S D + ++W   + + +  L GH   + ++  D   L  
Sbjct: 8   GHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYC 67

Query: 307 VTGSLDKTIRVWNYKTGECISTY 329
           VTGS D TI+VW    G+C+ T+
Sbjct: 68  VTGSADYTIKVWTLMNGQCVQTW 90

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKII--VSGSADKTVKIWHVESR 363
           L T S D +  VW    GE + T  GH  S+ S+D+    +  V+GSAD T+K+W + + 
Sbjct: 25  LFTCSKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNG 84

Query: 364 TC 365
            C
Sbjct: 85  QC 86

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 350 SADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
           S D +  +W+  +     TL GH   +  +     S  C +GS D TI++W +    C++
Sbjct: 29  SKDISASVWYSNNGERLGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNGQCVQ 88

Query: 409 VF 410
            +
Sbjct: 89  TW 90

>YLL011W (SOF1) [3408] chr12 (127522..128991) Protein component of
           U3 snoRNP (also called small subunit processome), which
           is required for 18S rRNA biogenesis, contains seven WD
           (WD-40) repeats [1470 bp, 489 aa]
          Length = 489

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 77/158 (48%), Gaps = 14/158 (8%)

Query: 254 DGVLTLQFNYR----LLFTGSYDSTVAIWDLCSNKLIRRL--SGHTDGVKTLYFDEAKLV 307
           D + +L+FN      L  TGS D+++ ++DL +N   +++  +  T+ +     +    V
Sbjct: 220 DNITSLKFNQNETDILASTGS-DNSIVLYDLRTNSPTQKIVQTMRTNAICWNPMEAFNFV 278

Query: 308 TGSLDKTIRVWNYKT-GECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIW---HVE 361
           T + D     ++ +     ++ ++ H  +VM VD       IV+GS DK+++I+   H  
Sbjct: 279 TANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGH 338

Query: 362 SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
           SR  Y  +   + V  VK    S    SGSDD  +R+W
Sbjct: 339 SREIYHTK-RMQHVFQVKYSMDSKYIISGSDDGNVRLW 375

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 68/325 (20%), Positives = 122/325 (37%), Gaps = 57/325 (17%)

Query: 251 GHMDGVLTLQFNY---RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-----YFD 302
           GH DGV  +  NY     L TGS D  +  W++ + +       H   V  L      F 
Sbjct: 65  GHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFKAHYGLVTGLCVTQPRFH 124

Query: 303 EAK--------LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKT 354
           + K        +++ S DKT+++W+    +  +      DSV + +   +     SA + 
Sbjct: 125 DKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQG 184

Query: 355 VKIWHVESRTCYTLRGHTEWVNCVKLHPKS--------------------FTCFSGSDDT 394
           +   H E+ T  T        +  +L P S                        +GSD++
Sbjct: 185 IDS-HRENSTFATGGAKIHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNS 243

Query: 395 TIRMWDIRTNSCLKVFRGHVGQVQKVIPL--TIIDAENLVVDNISGSNEGDDEPXXXXXX 452
            + ++D+RTNS  +     + Q  +   +    ++A N V  N       +D        
Sbjct: 244 IV-LYDLRTNSPTQ----KIVQTMRTNAICWNPMEAFNFVTAN-------EDHNAYYYDM 291

Query: 453 XXXXXXXXXXNDEENQTLDKSI-PYPTHLLSCSLDNTIKLWDVQTGQCIR----TQFGHV 507
                      D  +  +D    P    +++ S D +I+++    G         +  HV
Sbjct: 292 RNLSRSLNVFKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQHV 351

Query: 508 EGVWDIAADNFRIISGSHDGSIKIW 532
             V   + D+  IISGS DG++++W
Sbjct: 352 FQV-KYSMDSKYIISGSDDGNVRLW 375

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 506 HVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQ 549
           HV  V D+  +     I++GS+D SI+I+    G     +H KR+Q
Sbjct: 304 HVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQ 349

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY-----F 301
           FK H+  V+ + F+     + TGSYD ++ I+   +N    R   HT  ++ ++      
Sbjct: 301 FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYK--TNHGHSREIYHTKRMQHVFQVKYSM 358

Query: 302 DEAKLVTGSLDKTIRVWNYKTGE 324
           D   +++GS D  +R+W  K  E
Sbjct: 359 DSKYIISGSDDGNVRLWRSKAWE 381

>Kwal_47.17567
          Length = 590

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 79/183 (43%), Gaps = 11/183 (6%)

Query: 230 RERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIR 287
           R+R  +  + R      +E + H   V  L++N     L +G  D+ V ++D  S     
Sbjct: 386 RDRRILHRDVRTPQSSFEEIRTHNQEVCGLKWNVEDNKLASGGNDNAVFVYDGTSRLPFL 445

Query: 288 RLSGHTDGVKTLYFDEAK---LVTG--SLDKTIRVWNYKTG---ECISTYRGHTDSVMSV 339
           +L  HT  VK + +   +   L TG  + DK +++WN KT      + T     + + S 
Sbjct: 446 KLEEHTAAVKAMAWSPHRRGILATGGGTADKRLKIWNVKTSVKLHDVDTASQVCNMIWSK 505

Query: 340 DAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
           +  + I   G +   + +W   +      L+GH+  V  + L     T  SG+ D T+R 
Sbjct: 506 NTNEIITSHGYSKYNLTLWDGNTLEPMAILKGHSFRVLHMTLSTDGTTVVSGAGDETLRY 565

Query: 399 WDI 401
           W +
Sbjct: 566 WKL 568

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 63/146 (43%), Gaps = 7/146 (4%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGE- 324
           L  G  +  V I+D+   K IR + GH D V  L ++   L +GS D+ I   + +T + 
Sbjct: 341 LAVGQTNGLVNIFDVEKKKCIRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQS 400

Query: 325 CISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLH 381
                R H   V  +  +     + SG  D  V ++   SR  +  L  HT  V  +   
Sbjct: 401 SFEEIRTHNQEVCGLKWNVEDNKLASGGNDNAVFVYDGTSRLPFLKLEEHTAAVKAMAWS 460

Query: 382 PKS---FTCFSGSDDTTIRMWDIRTN 404
           P          G+ D  +++W+++T+
Sbjct: 461 PHRRGILATGGGTADKRLKIWNVKTS 486

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 83/183 (45%), Gaps = 12/183 (6%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDL----CSNKLIRRLSGHTDGVKTLYF 301
           ++   GH+D V  L +N  +L +GS D  +   D+     S + IR  +    G+K    
Sbjct: 361 IRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRTPQSSFEEIRTHNQEVCGLK-WNV 419

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVS---GSADKTVK 356
           ++ KL +G  D  + V++  +         HT +V  M+    ++ I++   G+ADK +K
Sbjct: 420 EDNKLASGGNDNAVFVYDGTSRLPFLKLEEHTAAVKAMAWSPHRRGILATGGGTADKRLK 479

Query: 357 IWHVE-SRTCYTLRGHTEWVNCV-KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHV 414
           IW+V+ S   + +   ++  N +   +        G     + +WD  T   + + +GH 
Sbjct: 480 IWNVKTSVKLHDVDTASQVCNMIWSKNTNEIITSHGYSKYNLTLWDGNTLEPMAILKGHS 539

Query: 415 GQV 417
            +V
Sbjct: 540 FRV 542

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 34/59 (57%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQS 536
           +HL     +  + ++DV+  +CIRT  GH++ V  ++ +N  + SGS D  I   D+++
Sbjct: 339 SHLAVGQTNGLVNIFDVEKKKCIRTIPGHIDRVACLSWNNHILTSGSRDRRILHRDVRT 397

>AFL009C [3184] [Homologous to ScYGL004C - SH] (420007..421248)
           [1242 bp, 413 aa]
          Length = 413

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 53/111 (47%), Gaps = 4/111 (3%)

Query: 303 EAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHV 360
           EA+   G  +  + + N +  +C S   GH+  + S+  F   K+++S S D  +KIW  
Sbjct: 117 EAQYAIGDTEGRLTLHNAEFSDCRS-LDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSA 175

Query: 361 ESRT-CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
              T   TL GHT  +    L  +     S S D ++R+W+  + S L+ F
Sbjct: 176 ADGTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSVRLWECGSGSMLRAF 226

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 2/73 (2%)

Query: 474 IPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD--IAADNFRIISGSHDGSIKI 531
            P    LLS S+D  +K+W    G   RT FGH   +    +      ++S S DGS+++
Sbjct: 155 FPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSVRL 214

Query: 532 WDLQSGKCMHTFH 544
           W+  SG  +  FH
Sbjct: 215 WECGSGSMLRAFH 227

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/100 (22%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query: 247 QEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE- 303
           +   GH   + +L +  + ++L + S D  + IW        R L GHT  +      E 
Sbjct: 140 RSLDGHSGHITSLHYFPSGKVLLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIER 199

Query: 304 -AKLVTGSLDKTIRVWNYKTGECISTYR---GHTDSVMSV 339
              +++ S D ++R+W   +G  +  +     H+D V ++
Sbjct: 200 GRNVLSSSKDGSVRLWECGSGSMLRAFHRRDRHSDGVNAL 239

>CAGL0K03377g complement(306529..309465) similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 978

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 326 ISTYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKS 384
           + TY+ H   V+ +D  K   ++S S DKT K+WH           H ++V CVK HP  
Sbjct: 405 VRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQHPDFVTCVKFHPTD 464

Query: 385 FTCF-SGSDDTTIRMWDI 401
              F SG  D   R+W I
Sbjct: 465 DRFFISGCLDQKCRLWSI 482

>YOR212W (STE4) [5005] chr15 (742910..744181) Beta subunit of the
           trimeric G protein that mediates signal transduction by
           pheromones, member of the WD (WD-40) repeat family [1272
           bp, 423 aa]
          Length = 423

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 101/258 (39%), Gaps = 34/258 (13%)

Query: 291 GHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--------DA 341
           GHT  +  + F D A ++T S D T  +W+    + +  Y  H   V+++        + 
Sbjct: 179 GHTCYISDIEFTDNAHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSEN 238

Query: 342 FKKIIVSGSADKTVKIWHVESRTCY-TLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWD 400
                 S  +D    IW   S +   +   +   +N ++      +  +GSD+  I M+D
Sbjct: 239 SSNTFASCGSDGYTYIWDSRSPSAVQSFYVNDSDINALRFFKDGMSIVAGSDNGAINMYD 298

Query: 401 IRTN---SCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXX 457
           +R++   +   +FRG+    ++  P     A N+  +                       
Sbjct: 299 LRSDCSIATFSLFRGY----EERTPTPTYMAANMEYN------------TAQSPQTLKST 342

Query: 458 XXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH---VEGVWDIA 514
                +++   +LD S      + SC  D    +WDV  G+ +    GH   V GV   +
Sbjct: 343 SSSYLDNQGVVSLDFSAS-GRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRS-S 400

Query: 515 ADNFRIISGSHDGSIKIW 532
            D   + +GS D ++KIW
Sbjct: 401 PDGLAVCTGSWDSTMKIW 418

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 40/70 (57%), Gaps = 6/70 (8%)

Query: 255 GVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGH---TDGVKTLYFDEAKLVTG 309
           GV++L F+   RL+++   D    +WD+   +++ +L GH     GV++   D   + TG
Sbjct: 351 GVVSLDFSASGRLMYSCYTDIGCVVWDVLKGEIVGKLEGHGGRVTGVRS-SPDGLAVCTG 409

Query: 310 SLDKTIRVWN 319
           S D T+++W+
Sbjct: 410 SWDSTMKIWS 419

 Score = 36.2 bits (82), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 52/270 (19%), Positives = 106/270 (39%), Gaps = 64/270 (23%)

Query: 289 LSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS--VDAFKK 344
           L GH + +    +  D  ++++ S D  + +W+  +G   +     +  V+S  +     
Sbjct: 88  LKGHNNKISDFRWSRDSKRILSASQDGFMLIWDSASGLKQNAIPLDSQWVLSCAISPSST 147

Query: 345 IIVSGSADKTVKIWHV--ESRTCYTL----RGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
           ++ S   +    I+ V  E+R    +    +GHT +++ ++    +    + S D T  +
Sbjct: 148 LVASAGLNNNCTIYRVSKENRVAQNVASIFKGHTCYISDIEFTDNAH-ILTASGDMTCAL 206

Query: 399 WDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXX 458
           WDI     ++ +  H+G    V+ L I                  +EP            
Sbjct: 207 WDIPKAKRVREYSDHLGD---VLALAI-----------------PEEP------------ 234

Query: 459 XXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA--- 515
                + EN +            SC  D    +WD ++   +++ + +     DI A   
Sbjct: 235 -----NSENSS--------NTFASCGSDGYTYIWDSRSPSAVQSFYVNDS---DINALRF 278

Query: 516 --DNFRIISGSHDGSIKIWDLQSGKCMHTF 543
             D   I++GS +G+I ++DL+S   + TF
Sbjct: 279 FKDGMSIVAGSDNGAINMYDLRSDCSIATF 308

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 10/76 (13%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA---------ADNFRIISGSHDGS 528
            H+L+ S D T  LWD+   + +R    H+  V  +A         + N     GS DG 
Sbjct: 193 AHILTASGDMTCALWDIPKAKRVREYSDHLGDVLALAIPEEPNSENSSNTFASCGS-DGY 251

Query: 529 IKIWDLQSGKCMHTFH 544
             IWD +S   + +F+
Sbjct: 252 TYIWDSRSPSAVQSFY 267

>AAL157C [30] [Homologous to ScYLL011W (SOF1) - SH] (70077..71516)
           [1440 bp, 479 aa]
          Length = 479

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 110/292 (37%), Gaps = 43/292 (14%)

Query: 291 GHTDGVKTL---YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGH---------TDSVMS 338
           GH DG   L   Y    KL +GS D  ++ WN  T E + ++R H         T + +S
Sbjct: 65  GHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLS 124

Query: 339 VDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVN------------------CVKL 380
                  ++S   DKT+K+W V S    +++  T+ V+                   +  
Sbjct: 125 PTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGEHAFQSIDH 184

Query: 381 HPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSN 440
           H ++    +G     I++WD+     L      V  V  V         N   ++I  S 
Sbjct: 185 HRRNPNFVTGG--AQIQLWDVNRKKPLSNLSWGVDNVSFV-------RFNQNEEDILAST 235

Query: 441 EGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQT-GQC 499
            G D                         L  +   P +    + D+    +D++   + 
Sbjct: 236 -GSDNSIVLYDLRTNSPTQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRA 294

Query: 500 IRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQ 549
           +     HV  V D+  +     I++GS+D +I+I++L+ G     +H KR+Q
Sbjct: 295 LHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQ 346

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 77/161 (47%), Gaps = 18/161 (11%)

Query: 253 MDGVLTLQFNYR----LLFTGSYDSTVAIWDLCSN----KLIRRLSGHTDGVKTLYFDEA 304
           +D V  ++FN      L  TGS D+++ ++DL +N    K+++R+   T+ +     +  
Sbjct: 216 VDNVSFVRFNQNEEDILASTGS-DNSIVLYDLRTNSPTQKVVQRM--RTNALCWNPMEPF 272

Query: 305 KLVTGSLDKTIRVWNYKT-GECISTYRGHTDSVMSVD--AFKKIIVSGSADKTVKIW--- 358
                + D     ++ +     +  ++ H  +VM VD     + IV+GS DKT++I+   
Sbjct: 273 NFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLK 332

Query: 359 HVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
           H  SR  Y  +   + V  VK    S    SGSDD  +R+W
Sbjct: 333 HGHSREVYHTK-RMQHVFQVKFTMDSKYIVSGSDDGNVRLW 372

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 71/334 (21%), Positives = 136/334 (40%), Gaps = 60/334 (17%)

Query: 251 GHMDGVLTLQFNYRL---LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-----YFD 302
           GH DG   L  NY +   L +GS D  V  W++ + + +     H   V  L     +  
Sbjct: 65  GHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLS 124

Query: 303 EAK----LVTGSLDKTIRVWNYKT------------------GECISTYRGHTDSVMSVD 340
             K    +++   DKTI++W+  +                  G  + T+ G   +  S+D
Sbjct: 125 PTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGE-HAFQSID 183

Query: 341 AFKK--IIVSGSADKTVKIWHVESRTCYT-LRGHTEWVNCVKL--HPKSFTCFSGSDDTT 395
             ++    V+G A   +++W V  +   + L    + V+ V+   + +     +GSD++ 
Sbjct: 184 HHRRNPNFVTGGAQ--IQLWDVNRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSI 241

Query: 396 IRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDA---ENLVVDNISGSNEGDDEPXXXXXX 452
           + ++D+RTNS            QKV+     +A     +   N + +NE  D        
Sbjct: 242 V-LYDLRTNSP----------TQKVVQRMRTNALCWNPMEPFNFAIANE--DHNAYYYDM 288

Query: 453 XXXXXXXXXXNDEENQTLDKSI-PYPTHLLSCSLDNTIKLWDVQTGQCIRT----QFGHV 507
                      D  +  +D    P    +++ S D TI++++++ G         +  HV
Sbjct: 289 RNMSRALHVFKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGHSREVYHTKRMQHV 348

Query: 508 EGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMH 541
             V     D+  I+SGS DG++++W  ++ +  H
Sbjct: 349 FQV-KFTMDSKYIVSGSDDGNVRLWRAKAWERSH 381

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 9/83 (10%)

Query: 249 FKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLY-----F 301
           FK H+  V+ + F+     + TGSYD T+ I++L       R   HT  ++ ++      
Sbjct: 298 FKDHVSAVMDVDFSPTGEEIVTGSYDKTIRIFNLKHGH--SREVYHTKRMQHVFQVKFTM 355

Query: 302 DEAKLVTGSLDKTIRVWNYKTGE 324
           D   +V+GS D  +R+W  K  E
Sbjct: 356 DSKYIVSGSDDGNVRLWRAKAWE 378

>Sklu_2291.4 YPL183C, Contig c2291 6003-8996 reverse complement
          Length = 997

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRLSGHTDGV--KTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
            G+    V IWDL S   +  L GH   +   TL  +   +V+ S D++I++WN K+GE 
Sbjct: 156 AGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGEL 215

Query: 326 ISTYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHV 360
           +ST  GHT  +  +        +VS S D T ++W +
Sbjct: 216 LSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 40/58 (68%), Gaps = 2/58 (3%)

Query: 479 HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIWDL 534
           +++SCS D +IKLW++++G+ + T +GH   +W +    ++ +++S S D + ++WD+
Sbjct: 195 YVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 48/97 (49%), Gaps = 3/97 (3%)

Query: 308 TGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHVES-RT 364
            G++   + +W+  +   +    GH  S+  V   K  + +VS S D+++K+W+++S   
Sbjct: 156 AGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGEL 215

Query: 365 CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
             T  GHT  +  +K         S S+D T R+WDI
Sbjct: 216 LSTGWGHTARIWQLKFIDNDTKVVSVSEDCTCRVWDI 252

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 4/103 (3%)

Query: 332 HTDSVMSVDAFKKIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCFSG 390
           ++ S+      K  I +G+    V IW + S T  + L GH   +  V L        S 
Sbjct: 140 YSGSISVFSDTKVYINAGTVMGGVFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSC 199

Query: 391 SDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVV 433
           SDD +I++W++++   L    GH  ++ +   L  ID +  VV
Sbjct: 200 SDDRSIKLWNLKSGELLSTGWGHTARIWQ---LKFIDNDTKVV 239

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 4/79 (5%)

Query: 245 QVQEFKGHMDGV--LTLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF- 301
           +V    GH   +  +TL  N   + + S D ++ +W+L S +L+    GHT  +  L F 
Sbjct: 173 KVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWGHTARIWQLKFI 232

Query: 302 -DEAKLVTGSLDKTIRVWN 319
            ++ K+V+ S D T RVW+
Sbjct: 233 DNDTKVVSVSEDCTCRVWD 251

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 489 IKLWDVQTGQCIRTQFGHVEGVW--DIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHG 545
           + +WD+ +   +    GH   ++   ++ +   ++S S D SIK+W+L+SG+ + T  G
Sbjct: 163 VFIWDLFSETKVHNLLGHEGSIFYVTLSKNGEYVVSCSDDRSIKLWNLKSGELLSTGWG 221

>ACR017W [1065] [Homologous to ScYEL056W (HAT2) - SH]
           complement(387122..388393) [1272 bp, 423 aa]
          Length = 423

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 79/177 (44%), Gaps = 17/177 (9%)

Query: 240 RKGNCQVQEFKGHMDGVLTLQFNYRL---LFTGSYDSTVAIWDLCSNKLIRR-LSGHTD- 294
            +   QV     H +    L FN  +   L +GS D+TVA+WD+ + K  +  L+ H D 
Sbjct: 173 EESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAAKKPKSILTSHDDI 232

Query: 295 --GVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK----IIVS 348
              VK   F+     T S DKT++V + +        +  T S  +  +F K    ++ +
Sbjct: 233 VNDVKWHEFESNVFGTVSEDKTLQVHDKRV-RLEPVKKLPTASPFNTLSFSKHSRNLLAA 291

Query: 349 GSADKTVKIWHVE--SRTCYTLRGHTEWVNCVKLHPKS--FTCFSGSDDTTIRMWDI 401
              D  + ++ +   S   + + GH + V  V+  P +    C SGSD   I +WD+
Sbjct: 292 AGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSSGSDRRAI-IWDL 347

>Scas_465.4
          Length = 1002

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 8/72 (11%)

Query: 471 DKSIPYPT------HLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADN--FRIIS 522
           + SI Y T      ++ SCS D +IKLW++QTG+ + T +GH   +W++   N   ++IS
Sbjct: 179 EGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHTARIWNLKFFNNDTQLIS 238

Query: 523 GSHDGSIKIWDL 534
            S D + ++WD+
Sbjct: 239 VSEDNTCRVWDI 250

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 4/96 (4%)

Query: 269 GSYDSTVAIWDLCSNKLIRRLSGHTDGV-KTLYFDEAKLVTG-SLDKTIRVWNYKTGECI 326
           G+    V IWDL     +  L GH   +      D  + +T  S D++I++WN +TGE +
Sbjct: 155 GTVMGGVLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEEL 214

Query: 327 STYRGHTDSVMSVDAFKK--IIVSGSADKTVKIWHV 360
            T  GHT  + ++  F     ++S S D T ++W +
Sbjct: 215 CTGWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 72/154 (46%), Gaps = 13/154 (8%)

Query: 260 QFNYR--LLFTGSYDSTVAIWDLCSNKLIRR-LSG-----HTDGVKTLYFDEAKLVTGSL 311
           +FNYR   ++  +  + V + DL    L R+ L G     ++  +K    ++  +  G++
Sbjct: 98  EFNYRGDQVYLLTCYNKVFVCDLTGEILSRKTLQGERSILYSGSIKEFSPEKVYISAGTV 157

Query: 312 DKTIRVWNYKTGECISTYRGHTDSVM--SVDAFKKIIVSGSADKTVKIWHVES--RTCYT 367
              + +W+      +    GH  S+   ++    + I S S D+++K+W++++    C T
Sbjct: 158 MGGVLIWDLFLETKLYNLVGHEGSIFYATISDNGRYITSCSDDRSIKLWNLQTGEELC-T 216

Query: 368 LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
             GHT  +  +K         S S+D T R+WDI
Sbjct: 217 GWGHTARIWNLKFFNNDTQLISVSEDNTCRVWDI 250

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 8/104 (7%)

Query: 322 TGECIS--TYRG-----HTDSVMSVDAFKKIIVSGSADKTVKIWHVESRT-CYTLRGHTE 373
           TGE +S  T +G     ++ S+      K  I +G+    V IW +   T  Y L GH  
Sbjct: 121 TGEILSRKTLQGERSILYSGSIKEFSPEKVYISAGTVMGGVLIWDLFLETKLYNLVGHEG 180

Query: 374 WVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
            +    +        S SDD +I++W+++T   L    GH  ++
Sbjct: 181 SIFYATISDNGRYITSCSDDRSIKLWNLQTGEELCTGWGHTARI 224

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 36/67 (53%), Gaps = 4/67 (5%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEG--VWDIAADNFRIISG-SHDGSIKI 531
           P   ++ + ++   + +WD+     +    GH EG   +   +DN R I+  S D SIK+
Sbjct: 147 PEKVYISAGTVMGGVLIWDLFLETKLYNLVGH-EGSIFYATISDNGRYITSCSDDRSIKL 205

Query: 532 WDLQSGK 538
           W+LQ+G+
Sbjct: 206 WNLQTGE 212

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 14/92 (15%)

Query: 478 THLLSCSLDNTIKLWDV----QTGQCIRT-----QFGHVEGVW--DIAADNFRIISGSHD 526
           T L+S S DNT ++WD+      G    T     +   ++ VW  DI   +   ++  +D
Sbjct: 234 TQLISVSEDNTCRVWDILQDEGNGNTSLTLSQIYEVHLIKNVWGVDIQEKDMVAVTSGND 293

Query: 527 GSIKIWDLQSGKCMHTFHGKRLQPQDEEGSTH 558
           G +K+  +Q  K M   + + +    E+ STH
Sbjct: 294 GRLKLTKIQDTKTM---NAQEVSFSLEDISTH 322

>AFL007C [3186] [Homologous to ScYGL003C (CDH1) - SH]
           (424004..425659) [1656 bp, 551 aa]
          Length = 551

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 78/193 (40%), Gaps = 30/193 (15%)

Query: 226 KVIYRERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKL 285
           K+++R+    E  +   N   QE  G     L    +   L +G  D+ V ++D  S K 
Sbjct: 350 KILHRDVRMPEHYFETANTHSQEVCG-----LKWNVDENRLASGGNDNVVYVYDGPSKKP 404

Query: 286 IRRLSGHTDGVKTLYFDEAKLVT-----GSLDKTIRVWNYKTGE-----------CISTY 329
           + + + H   VK + +   +  T     G+ D+ +++WN  +G            C   +
Sbjct: 405 VLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKIWNVNSGVRLNDVDTGSQVCNMVW 464

Query: 330 RGHTDSVMSVDAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCF 388
             +TD +++   + K          + +W   +      L+GH+  V  + L     T  
Sbjct: 465 SKNTDEIVTSHGYSKF--------NLTLWDCPTLEPLAVLKGHSFRVLHLTLSTDGTTIV 516

Query: 389 SGSDDTTIRMWDI 401
           SG+ D T+R W +
Sbjct: 517 SGAGDETLRYWKL 529

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 80/182 (43%), Gaps = 10/182 (5%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDL-CSNKLIRRLSGHTDGVKTLYF--D 302
           ++   GH+D V  L +N  +L +GS D  +   D+          + H+  V  L +  D
Sbjct: 322 IRTLSGHLDRVACLSWNQHILSSGSKDHKILHRDVRMPEHYFETANTHSQEVCGLKWNVD 381

Query: 303 EAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVS---GSADKTVKI 357
           E +L +G  D  + V++  + + +  +  H  +V  M+    ++  ++   G+AD+ +KI
Sbjct: 382 ENRLASGGNDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKI 441

Query: 358 WHVESRTCYT-LRGHTEWVNCV-KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           W+V S      +   ++  N V   +        G     + +WD  T   L V +GH  
Sbjct: 442 WNVNSGVRLNDVDTGSQVCNMVWSKNTDEIVTSHGYSKFNLTLWDCPTLEPLAVLKGHSF 501

Query: 416 QV 417
           +V
Sbjct: 502 RV 503

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 34/145 (23%), Positives = 60/145 (41%), Gaps = 7/145 (4%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGE- 324
           L  G  +  V + D+   K IR LSGH D V  L +++  L +GS D  I   + +  E 
Sbjct: 302 LAVGLGNGLVELHDVVKQKCIRTLSGHLDRVACLSWNQHILSSGSKDHKILHRDVRMPEH 361

Query: 325 CISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLH 381
              T   H+  V  +  +  +  + SG  D  V ++   S +       H   V  +   
Sbjct: 362 YFETANTHSQEVCGLKWNVDENRLASGGNDNVVYVYDGPSKKPVLKFTEHNAAVKAMAWS 421

Query: 382 P---KSFTCFSGSDDTTIRMWDIRT 403
           P    +     G+ D  +++W++ +
Sbjct: 422 PHRRATLATGGGTADRRLKIWNVNS 446

>Kwal_47.17555
          Length = 417

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 4/123 (3%)

Query: 307 VTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWH-VESR 363
            TG     I +++ +  E   T  GH   +  V  F   ++++SGSAD  +K+W  ++  
Sbjct: 123 ATGDQGGIISIYDSQA-EVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDGS 181

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPL 423
              TL+GHT  V  + +  +     S S D ++++W+  +   +  F     Q   V  +
Sbjct: 182 NPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSGETIHSFARKTDQSDPVNDM 241

Query: 424 TII 426
            I+
Sbjct: 242 LIL 244

 Score = 46.6 bits (109), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 47/103 (45%), Gaps = 15/103 (14%)

Query: 472 KSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAA-DNFR-IISGSHDGSI 529
           K  P    LLS S D  +K+W    G   RT  GH   V  +   D  R ++S S DGS+
Sbjct: 155 KFFPSGEVLLSGSADMQLKVWSTLDGSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSL 214

Query: 530 KIWDLQSGKCMHTFHGKRLQP-------------QDEEGSTHL 559
           K+W+  SG+ +H+F  K  Q                E+GS HL
Sbjct: 215 KLWECGSGETIHSFARKTDQSDPVNDMLILCSPGSSEDGSRHL 257

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 71/154 (46%), Gaps = 9/154 (5%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNYKT 322
           L  TG     ++I+D    ++ R L GH   +  + F  +   L++GS D  ++VW+   
Sbjct: 121 LYATGDQGGIISIYD-SQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLD 179

Query: 323 GECISTYRGHTDSVMSVDAFKKI--IVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVK 379
           G    T +GHT +V ++    +   ++S S D ++K+W   S  T ++    T+  + V 
Sbjct: 180 GSNPRTLKGHTSTVTALGIIDRGRNVMSSSKDGSLKLWECGSGETIHSFARKTDQSDPV- 238

Query: 380 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGH 413
            +     C  GS +   R  +  T +   VF GH
Sbjct: 239 -NDMLILCSPGSSEDGSRHLEFGT-AGKTVFAGH 270

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 4/96 (4%)

Query: 345 IIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN 404
           +  +G     + I+  ++    TL GH   +  VK  P      SGS D  +++W     
Sbjct: 121 LYATGDQGGIISIYDSQAEVTRTLEGHYAEITDVKFFPSGEVLLSGSADMQLKVWSTLDG 180

Query: 405 SCLKVFRGHVGQVQKVIPLTIID-AENLVVDNISGS 439
           S  +  +GH      V  L IID   N++  +  GS
Sbjct: 181 SNPRTLKGH---TSTVTALGIIDRGRNVMSSSKDGS 213

>Scas_680.11
          Length = 347

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSG 537
           L SCS DN   +W    G+ + T  GH   +W I  D F    ++GS D SIK+W +++G
Sbjct: 25  LFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVETG 84

Query: 538 KCMHT 542
           + +++
Sbjct: 85  ENVYS 89

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS--VDAFKKIIVSGSADKTVKIWHVES 362
           L + S D    VW    GE + T  GH  ++ S  VD F +  V+GSAD ++K+W VE+
Sbjct: 25  LFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVET 83

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 46/83 (55%), Gaps = 4/83 (4%)

Query: 251 GHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKL 306
           GH   +  +++N    LLF+ S D+  ++W   + + +  L+GH   + ++  D+     
Sbjct: 8   GHERPLTQVKYNREGDLLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYC 67

Query: 307 VTGSLDKTIRVWNYKTGECISTY 329
           VTGS D +I++W  +TGE + ++
Sbjct: 68  VTGSADYSIKMWKVETGENVYSW 90

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%)

Query: 345 IIVSGSADKTVKIWH-VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
           ++ S S D    +W+ V      TL GH   +  + +   +  C +GS D +I+MW + T
Sbjct: 24  LLFSCSKDNFASVWYSVNGERLGTLNGHAGTIWSIDVDKFTEYCVTGSADYSIKMWKVET 83

Query: 404 N 404
            
Sbjct: 84  G 84

>CAGL0A00605g complement(67281..69203) similar to sp|P53197
           Saccharomyces cerevisiae YGL003c CDH1 substrate-specific
           activator of APC-dependent proteolysis, hypothetical
           start
          Length = 640

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 65/161 (40%), Gaps = 37/161 (22%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L  G  +  V I+D+   K IR LSGH D V  L ++   L +GS D+TI          
Sbjct: 391 LAIGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTIL--------- 441

Query: 326 ISTYRGHTDSVMSVDAFKKI------------------IVSGSADKTVKIWHVESRTCY- 366
                 H D  M+   F+KI                  + SG  D  V ++   SRT + 
Sbjct: 442 ------HRDVRMADPFFEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFL 495

Query: 367 TLRGHTEWVNCVKLHPKS---FTCFSGSDDTTIRMWDIRTN 404
           ++  H   V  +   P          G+ D T++MW++ T+
Sbjct: 496 SINEHKAAVKAMAWSPHKQGILATGGGTADRTLKMWNVNTS 536

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 79/183 (43%), Gaps = 11/183 (6%)

Query: 230 RERFKVESNWRKGNCQVQEFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIR 287
           R+R  +  + R  +   ++ + H   +  L++N     L +G  D+ V ++D  S     
Sbjct: 436 RDRTILHRDVRMADPFFEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFL 495

Query: 288 RLSGHTDGVKTLYFDEAK---LVTG--SLDKTIRVWNYKTG---ECISTYRGHTDSVMSV 339
            ++ H   VK + +   K   L TG  + D+T+++WN  T      + T     + V S 
Sbjct: 496 SINEHKAAVKAMAWSPHKQGILATGGGTADRTLKMWNVNTSVKLNDVDTGSQVCNMVWST 555

Query: 340 DAFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
           +  + +   G +   + IW   +      L+GH+  V  + L     T  SG+ D T+R 
Sbjct: 556 NTDEIVTSHGYSKYNLTIWEASNLEPLAILKGHSFRVLHLTLSADGTTIVSGAGDETLRY 615

Query: 399 WDI 401
           W +
Sbjct: 616 WKL 618

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 64/125 (51%), Gaps = 8/125 (6%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDL-CSNKLIRRLSGHTDGVKTLYF--D 302
           ++   GH+D V  L +N  +L +GS D T+   D+  ++    ++  H   +  L +  +
Sbjct: 411 IRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADPFFEKIETHEQEICGLKWNTN 470

Query: 303 EAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVS---GSADKTVKI 357
           + KL +G  D  + V++  +     +   H  +V  M+    K+ I++   G+AD+T+K+
Sbjct: 471 DNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMAWSPHKQGILATGGGTADRTLKM 530

Query: 358 WHVES 362
           W+V +
Sbjct: 531 WNVNT 535

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 31/52 (59%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSI 529
           +HL     +  ++++DV   +CIRT  GH++ V  ++ +N  + SGS D +I
Sbjct: 389 SHLAIGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTI 440

>Scas_718.6*
          Length = 546

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 76/166 (45%), Gaps = 9/166 (5%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD---EAKLVTGSLDKTIRVWNYKT 322
           L     + ++ ++ +  NK I +L GH   +  + F+      L +   D +IR+W+ + 
Sbjct: 342 LVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQK 401

Query: 323 GECISTYRGHTDSVMSVDAFK-KIIVSGSADKTVKIWHVESRTCYTLRGHTEW--VNCVK 379
             C + + GH+ S++S+      +++S S D +V+IW V    C       +   + C K
Sbjct: 402 ENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV-VENCLVGMAMVDGNAIICGK 460

Query: 380 LHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTI 425
           +         GS +  I ++DI+      + R    ++  V+P+TI
Sbjct: 461 ISHDKNKFAIGSMNGQINVYDIKRFVSRLLKRDKKQEL--VVPITI 504

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/189 (20%), Positives = 83/189 (43%), Gaps = 28/189 (14%)

Query: 239 WRKGNCQVQEFKGHMDGVLTLQFN--YRLLFTGSYDSTVAIWDLCSNKLIR------RLS 290
           W K       F  H   ++++++N   +   +   D+   +W+  +  +++      +L 
Sbjct: 265 WNKDGRLQNVFNFHRSPIVSIKWNEDSKHFISLDLDNITILWNAINGIILQHFEPEQKLE 324

Query: 291 GHTD--GVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD---AFKKI 345
            +T+  GV   + D+ KLV   ++ +I V++    + I    GH  ++  ++     + +
Sbjct: 325 NNTESLGVDIEWVDKDKLVVPGVNGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLL 384

Query: 346 IVSGSADKTVKIWHVESRTCYT-LRGHTE------WVNCVKLHPKSFTCFSGSDDTTIRM 398
           + S  +D +++IWH +   C     GH++      W+N            S S D ++R+
Sbjct: 385 LTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWIN-------DDLVISASMDGSVRI 437

Query: 399 WDIRTNSCL 407
           W +  N CL
Sbjct: 438 WSVVEN-CL 445

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 71/150 (47%), Gaps = 17/150 (11%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYR------GHTDSVMSVDAF----KKIIVSGSA 351
           D    ++  LD    +WN   G  +  +        +T+S + VD       K++V G  
Sbjct: 290 DSKHFISLDLDNITILWNAINGIILQHFEPEQKLENNTES-LGVDIEWVDKDKLVVPG-V 347

Query: 352 DKTVKIWHVE-SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSD-DTTIRMWDIRTNSCLKV 409
           + ++ ++ ++ ++    L GH   ++C++ +  S    + SD D +IR+W  +  +C   
Sbjct: 348 NGSILVYSIDDNKPIGKLLGHQGTISCIEFNVNSRLLLTSSDSDYSIRIWHGQKENCCNC 407

Query: 410 FRGHVGQVQKVIPLTIIDAENLVVDNISGS 439
           F GH    Q +I L+ I+ + ++  ++ GS
Sbjct: 408 FYGH---SQSIISLSWINDDLVISASMDGS 434

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA-ADNFRIISGSHDGSIKIWDL 534
           L S   D +I++W  Q   C    +GH + +  ++  ++  +IS S DGS++IW +
Sbjct: 385 LTSSDSDYSIRIWHGQKENCCNCFYGHSQSIISLSWINDDLVISASMDGSVRIWSV 440

>KLLA0B12804g 1117475..1120033 weakly similar to sp|Q03177
           Saccharomyces cerevisiae YMR102c, hypothetical start
          Length = 852

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 89/219 (40%), Gaps = 34/219 (15%)

Query: 199 RFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWR-------------KGNCQ 245
           RF  +    AT     KD   +++R WKVI     ++E N               + N Q
Sbjct: 133 RFSHDGKFMAT---AGKD---EILRIWKVISSPAERLELNQHSISFLKSTANAISQLNGQ 186

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLCSNKLI-RRLSGHTDGVKTLYFDEA 304
           + ++ G  D   +L          S  S+ A  D  S K + +   G T G +  Y    
Sbjct: 187 LAQYGGDTDSA-SLNSGSSNTHVDSLGSSNANRDGFSTKAVPQEQQGQTQGHRHPY---- 241

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK-KIIVSGSADKTVKIWHVESR 363
               G  D    V++      + T+  HTD ++ +D  K   I++GS DK+ K+WH    
Sbjct: 242 ----GLGDSYCGVFHPNP---LVTFHEHTDDILDIDWSKNSFILTGSMDKSCKLWHCARP 294

Query: 364 TCYTLRGHTEWVNCVKLHPKSFTCF-SGSDDTTIRMWDI 401
           T      H+++V  V+ HP+    F S   D   R+W I
Sbjct: 295 TSLKTFVHSDFVTAVRFHPEDDRFFLSACLDQKCRLWSI 333

>Scas_571.4
          Length = 601

 Score = 46.2 bits (108), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 59/141 (41%), Gaps = 20/141 (14%)

Query: 301 FDEAKLVTGSLDKTIRVWNYKTGECISTYR----------------GHTDSVMSV---DA 341
           F++ K+ + S D  I +WN      + TYR                GHT  V  V     
Sbjct: 100 FNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKILSGHTRKVGHVLFHPR 159

Query: 342 FKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDI 401
            + ++ S S D TVKIW+++         H++ V  +   P      + + +  + +WDI
Sbjct: 160 IRNVLASSSLDFTVKIWNIKKGKVIGTLQHSDMVTAMAFDPDGAYLATITRNKKLTIWDI 219

Query: 402 RTNSCLKVFRGHVG-QVQKVI 421
            +   +   + H G + Q+V+
Sbjct: 220 ASKQIVSQTKSHQGPKNQRVV 240

 Score = 36.2 bits (82), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 66/179 (36%), Gaps = 44/179 (24%)

Query: 368 LRGHTEWVNCVKLHP-KSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTII 426
            RGH   V      P   F   S SDD  I +W+I  N  ++ +R    +   + P  I+
Sbjct: 85  FRGHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMDIRPSKIL 144

Query: 427 DAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYP---THLLSC 483
                 V ++                                     + +P     L S 
Sbjct: 145 SGHTRKVGHV-------------------------------------LFHPRIRNVLASS 167

Query: 484 SLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKCM 540
           SLD T+K+W+++ G+ I T   H + V  +A   D   + + + +  + IWD+ S + +
Sbjct: 168 SLDFTVKIWNIKKGKVIGT-LQHSDMVTAMAFDPDGAYLATITRNKKLTIWDIASKQIV 225

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 3/51 (5%)

Query: 505 GHVEGVWDIAAD---NFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQPQD 552
           GH   V D   D   +F+I S S DG I IW++     M T+     +P D
Sbjct: 87  GHKGQVLDTDFDPFNDFKIASASDDGKIGIWNIPMNYSMRTYRDSENKPMD 137

>AGL301C [4011] [Homologous to ScYER107C (GLE2) - SH]
           (137221..138306) [1086 bp, 361 aa]
          Length = 361

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 71/131 (54%), Gaps = 14/131 (10%)

Query: 235 VESNWRKGNCQVQEFKGHMDGVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGH 292
           V++   +G  Q +    H   VLT +++     + +G  D+ + ++D+ S +  +++  H
Sbjct: 63  VQNGMTQGRAQYE----HQAPVLTTRWSSDGTKVASGGCDNILKLYDVASGQA-QQIGSH 117

Query: 293 TDGVKTLYF------DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKII 346
              V+ L F      ++  +VTGS DKTI+ W+ +  + IST     + V ++D+ +K++
Sbjct: 118 DSAVRALRFVQCGPSNQECIVTGSWDKTIKYWDMRQPQPISTV-AMPERVYALDSKQKLL 176

Query: 347 VSGSADKTVKI 357
           V G+A++ + +
Sbjct: 177 VVGTAERHIVV 187

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 483 CSLDNTIKLWDVQTGQCI-RTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKC 539
            + DNT+++WDVQ G    R Q+ H   V     ++D  ++ SG  D  +K++D+ SG+ 
Sbjct: 52  AAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVASGQA 111

Query: 540 MH 541
             
Sbjct: 112 QQ 113

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 12/104 (11%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLS-GHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           L    ++D+TV IWD+ +     R    H   V T  +  D  K+ +G  D  +++++  
Sbjct: 48  LFSVAAWDNTVRIWDVQNGMTQGRAQYEHQAPVLTTRWSSDGTKVASGGCDNILKLYDVA 107

Query: 322 TGECISTYRGHTDSVMSVDAF-------KKIIVSGSADKTVKIW 358
           +G+      G  DS +    F       ++ IV+GS DKT+K W
Sbjct: 108 SGQAQQI--GSHDSAVRALRFVQCGPSNQECIVTGSWDKTIKYW 149

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 64/153 (41%), Gaps = 17/153 (11%)

Query: 263 YRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK---LVTGSLDKTIRVWN 319
           YR   + S  S +A     SN +      + D V  + F   +       + D T+R+W+
Sbjct: 4   YRPTGSASTSSAMATDKELSNDITINNPAN-DSVSDIAFSPQQDFLFSVAAWDNTVRIWD 62

Query: 320 YKTG--ECISTYRGHTDSVM----SVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTE 373
            + G  +  + Y  H   V+    S D  K  + SG  D  +K++ V S     +  H  
Sbjct: 63  VQNGMTQGRAQYE-HQAPVLTTRWSSDGTK--VASGGCDNILKLYDVASGQAQQIGSHDS 119

Query: 374 WVNCVKL---HPKSFTCF-SGSDDTTIRMWDIR 402
            V  ++     P +  C  +GS D TI+ WD+R
Sbjct: 120 AVRALRFVQCGPSNQECIVTGSWDKTIKYWDMR 152

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 17/76 (22%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----------IISGSHD 526
           T + S   DN +KL+DV +GQ  +       G  D A    R           I++GS D
Sbjct: 90  TKVASGGCDNILKLYDVASGQAQQI------GSHDSAVRALRFVQCGPSNQECIVTGSWD 143

Query: 527 GSIKIWDLQSGKCMHT 542
            +IK WD++  + + T
Sbjct: 144 KTIKYWDMRQPQPIST 159

>Kwal_27.10785
          Length = 367

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 57/98 (58%), Gaps = 8/98 (8%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK------LVTGSLDKTIRVWN 319
           + +G  D+ V ++D+ S +  +++  H   VK+L F +        LVTGS DKTI+ W+
Sbjct: 94  IASGGCDNAVMVFDVSSGQS-QQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWD 152

Query: 320 YKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKI 357
            +  + +ST     + V ++D+ +K++V G+A++ + +
Sbjct: 153 LRQPQPVSTL-AMPERVYTMDSKQKLLVVGTAERHIVV 189

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 48/103 (46%), Gaps = 13/103 (12%)

Query: 310 SLDKTIRVWNYKTGE--CISTYRGHTDSVM----SVDAFKKIIVSGSADKTVKIWHVESR 363
           S DK +RVW+   G+  C + Y+ H   V+    S D  K  I SG  D  V ++ V S 
Sbjct: 55  SWDKKVRVWDVNGGQAQCRAEYQ-HQAPVLATRWSTDGTK--IASGGCDNAVMVFDVSSG 111

Query: 364 TCYTLRGHTEWVNCVKL---HPKSFTCF-SGSDDTTIRMWDIR 402
               +  H   V  ++     P +  C  +GS D TI+ WD+R
Sbjct: 112 QSQQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWDLR 154

 Score = 33.1 bits (74), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 7/79 (8%)

Query: 245 QVQEFKGHMDGVLTLQF------NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKT 298
           Q Q+   H   V +L+F      N   L TGS+D T+  WDL   + +  L+   + V T
Sbjct: 112 QSQQVGAHDAAVKSLRFVQCGPSNTECLVTGSWDKTIKYWDLRQPQPVSTLA-MPERVYT 170

Query: 299 LYFDEAKLVTGSLDKTIRV 317
           +   +  LV G+ ++ I V
Sbjct: 171 MDSKQKLLVVGTAERHIVV 189

 Score = 32.7 bits (73), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 484 SLDNTIKLWDVQTGQC-IRTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCM 540
           S D  +++WDV  GQ   R ++ H   V     + D  +I SG  D ++ ++D+ SG+  
Sbjct: 55  SWDKKVRVWDVNGGQAQCRAEYQHQAPVLATRWSTDGTKIASGGCDNAVMVFDVSSGQSQ 114

Query: 541 H 541
            
Sbjct: 115 Q 115

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 17/77 (22%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----------IISGSHD 526
           T + S   DN + ++DV +GQ  +       G  D A  + R           +++GS D
Sbjct: 92  TKIASGGCDNAVMVFDVSSGQSQQV------GAHDAAVKSLRFVQCGPSNTECLVTGSWD 145

Query: 527 GSIKIWDLQSGKCMHTF 543
            +IK WDL+  + + T 
Sbjct: 146 KTIKYWDLRQPQPVSTL 162

>Kwal_27.12586
          Length = 509

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 72/184 (39%), Gaps = 15/184 (8%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTG 323
             TG     + +W     KL      H   + T+ +  D    +T  +D    VWN +TG
Sbjct: 221 FLTGVESGEIRLW-THDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTG 279

Query: 324 ECISTY----RGHTDSVMSVDAF----KKIIVSGSADKTVKIWHVESRTCYTLRGHTEWV 375
             +  +     G  DS + VDA      K ++ G           ESR    L GH+  +
Sbjct: 280 TALQQFSFRENGTVDS-LGVDASWIGPDKFVIPGPQGSIYICGMGESRPLGKLNGHSATI 338

Query: 376 NCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDN 435
                + ++    SGSDD T+R+W   + S    F G+   +        ID + ++  +
Sbjct: 339 TAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAF---WIDDDKVIATS 395

Query: 436 ISGS 439
           + GS
Sbjct: 396 LDGS 399

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 5/119 (4%)

Query: 248 EFKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF-DEA 304
           +  GH   +    FN    +L +GS D T+ +W   S        G+T G+ + ++ D+ 
Sbjct: 330 KLNGHSATITAFDFNSENNMLLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFWIDDD 389

Query: 305 KLVTGSLDKTIRVWNYKTG--ECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVE 361
           K++  SLD ++R+W++ T   + IS   G      S+   K     G  D  V ++++E
Sbjct: 390 KVIATSLDGSVRLWSHLTNTLQAISMVDGVPIFCGSLSPDKLKFAIGKMDGEVTVYNIE 448

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 37/197 (18%), Positives = 74/197 (37%), Gaps = 24/197 (12%)

Query: 346 IVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
            ++G     +++W  +++       H   +  +K +  +    +   D    +W+ +T +
Sbjct: 221 FLTGVESGEIRLWTHDAKLQNAFDFHKSSIVTIKWNSDATHFLTYDVDNVAIVWNAQTGT 280

Query: 406 CLKVFRGHV-GQVQKV-IPLTIIDAENLVVDNISGS----NEGDDEPXXXXXXXXXXXXX 459
            L+ F     G V  + +  + I  +  V+    GS      G+  P             
Sbjct: 281 ALQQFSFRENGTVDSLGVDASWIGPDKFVIPGPQGSIYICGMGESRPLGKLNGHSATITA 340

Query: 460 XXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLW---DVQTGQC-IRTQFGHVEGVWDIAA 515
              N E N            LLS S D T+++W    + +  C +    G     W    
Sbjct: 341 FDFNSENNM-----------LLSGSDDKTLRVWRSGSLSSSNCFMGNTLGITSAFW---I 386

Query: 516 DNFRIISGSHDGSIKIW 532
           D+ ++I+ S DGS+++W
Sbjct: 387 DDDKVIATSLDGSVRLW 403

>Kwal_34.15818
          Length = 349

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 105/263 (39%), Gaps = 43/263 (16%)

Query: 289 LSGHTDGVKTLYFD-EAKLV-TGSLDKTIRVWNYKTGECISTYRGHTDSVMS--VDAFKK 344
           L GH   +  + F+ E  L+ T + D    VW    GE + T+ GH  ++ S  VD F +
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 345 IIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRT 403
             V+GSAD ++K+W V+  T  +T +  T  V  V+  P                     
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKTP-VRRVQFSPSG------------------- 105

Query: 404 NSCLKVFRGHVGQVQKVIPLTI-IDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXX 462
           +  L V  G +G    V   T+  D E   + +IS      +EP                
Sbjct: 106 DKILAVLDGVMGYPGSVTVYTVRRDPETKDIVDIS------EEPTFNILTREGFEIAAVA 159

Query: 463 NDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDI--AADNFRI 520
               N          T++++   D  +  ++  +G+ I +   H + V DI  + D    
Sbjct: 160 AWSFND---------TYIVAGHKDGRVSKYEGHSGEYIDSAALHTQNVSDIQFSPDGTYF 210

Query: 521 ISGSHDGSIKIWDLQSGKCMHTF 543
           I+ S D + K+ D ++ + + T+
Sbjct: 211 ITSSRDSAAKLVDTETLEVLKTY 233

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSG 537
           + +C+ DN   +W    G+ + T  GH   +W I  D F    ++GS D SIK+W +Q G
Sbjct: 25  IFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQYAVTGSADFSIKLWKVQDG 84

Query: 538 KCMHTFHGK 546
             + T+  K
Sbjct: 85  TNVFTWKTK 93

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 65/141 (46%), Gaps = 16/141 (11%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--A 304
            KGH   +  ++FN    L+FT + D+  ++W   + + +    GH   + ++  D+   
Sbjct: 6   LKGHERSLTQVKFNREGDLIFTCAKDNVASVWYSINGERLGTFEGHQGTIWSIDVDQFTQ 65

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIW-----H 359
             VTGS D +I++W  + G  + T++  T         +++  S S DK + +      +
Sbjct: 66  YAVTGSADFSIKLWKVQDGTNVFTWKTKT-------PVRRVQFSPSGDKILAVLDGVMGY 118

Query: 360 VESRTCYTLRGHTEWVNCVKL 380
             S T YT+R   E  + V +
Sbjct: 119 PGSVTVYTVRRDPETKDIVDI 139

>Scas_660.7*
          Length = 603

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 14/110 (12%)

Query: 300 YFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDS---------VMSVDAFKKIIVSGS 350
           + DE K VT S D TIRVW+  + +C+  +   + S         V  V + +  IVS S
Sbjct: 247 WIDENKFVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLS 306

Query: 351 ADKTVKIWHVESRTCYT-LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMW 399
            D T+ I+ +E     T ++GH++ +  + ++P      +GS D  I  W
Sbjct: 307 LDGTLNIFQLEQDNIITSIKGHSKGITALAVNP----LITGSYDGKIMDW 352

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 56/111 (50%), Gaps = 11/111 (9%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRR--LSGHTDG-------VKTLYFDEAKLVTGSLDKTIR 316
             T S D+T+ +WD+ S+K +++  ++  +D        V  +   E ++V+ SLD T+ 
Sbjct: 253 FVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLN 312

Query: 317 VWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVESRTCYT 367
           ++  +    I++ +GH+  + ++      +++GS D  +  W  +    +T
Sbjct: 313 IFQLEQDNIITSIKGHSKGITALAV--NPLITGSYDGKIMDWSNKPEVAHT 361

 Score = 36.2 bits (82), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 265 LLFTGSYDSTVAIWDLC-SNKLIRRLSGHTDGVKTLYFDEAK-LVTGSLDKTIRVWNYK 321
           L+ TGS D+ + ++ +    K+I+RL+ H DG+  L +++A  LV+   D  I+ W  +
Sbjct: 543 LVATGSLDTNIFVYSIKRPMKIIKRLNAHKDGISALLWEDASTLVSTGADACIKKWGVE 601

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKC 539
           ++S SLD T+ ++ ++    I +  GH +G+  +A +   +I+GS+DG I  W  +  + 
Sbjct: 302 IVSLSLDGTLNIFQLEQDNIITSIKGHSKGITALAVN--PLITGSYDGKIMDWSNKP-EV 358

Query: 540 MHTFH 544
            HT H
Sbjct: 359 AHTKH 363

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRT---------QFGHVEGVWDIAADNFRIISGSHDGSIK 530
            ++ S D TI++WDV + +C++               + V  +A+   RI+S S DG++ 
Sbjct: 253 FVTASADATIRVWDVNSSKCVQKWVVTSSSDDNVLRDQQVGVVASQEGRIVSLSLDGTLN 312

Query: 531 IWDLQSGKCMHTFHG 545
           I+ L+    + +  G
Sbjct: 313 IFQLEQDNIITSIKG 327

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 36/66 (54%), Gaps = 5/66 (7%)

Query: 481 LSCSLDNTIKLWDVQTGQCIRTQFGHVE----GVWDIA-ADNFRIISGSHDGSIKIWDLQ 535
           ++   D  I  +D +TG+ +++     E    G++ ++  D  + ++ S D +I++WD+ 
Sbjct: 209 ITVGSDRKINCFDSKTGEFVKSIVDESEPIQGGIFALSWIDENKFVTASADATIRVWDVN 268

Query: 536 SGKCMH 541
           S KC+ 
Sbjct: 269 SSKCVQ 274

>Scas_512.3
          Length = 534

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 37/57 (64%), Gaps = 2/57 (3%)

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHV 360
           +V+GS+D +IRV++ ++G+ + TY  H   V  V  D   + I+S SAD++V I+ +
Sbjct: 161 VVSGSMDNSIRVFDIESGKLLGTYADHNHYVQGVTWDPLNEFILSQSADRSVNIYQI 217

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 83/206 (40%), Gaps = 30/206 (14%)

Query: 343 KKIIVSGSADKTVKIWHVESRT----------CYTLRGHTEWVNCVKLHPKSFTCFSGSD 392
           KK +++   D  ++ W++                +L  H + +N VK +       S  D
Sbjct: 28  KKKLLTAGGDNKIRSWNLNLVKDTNKIDTIDFLSSLTQHEQAINVVKFNSPGTILASAGD 87

Query: 393 DTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXX 452
           D  I +W  +              V +    T    ++ V      + E D+E       
Sbjct: 88  DGQILLWKQQ-------------DVNEQNGETAAPVDSSVPKPFGSTFEDDEENNKESWF 134

Query: 453 XXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH---VEG 509
                     N  E   LD S P   +++S S+DN+I+++D+++G+ + T   H   V+G
Sbjct: 135 VWKRLRAPGSNSSEIYDLDWS-PCDRYVVSGSMDNSIRVFDIESGKLLGTYADHNHYVQG 193

Query: 510 V-WDIAADNFRIISGSHDGSIKIWDL 534
           V WD    N  I+S S D S+ I+ +
Sbjct: 194 VTWDPL--NEFILSQSADRSVNIYQI 217

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 20/24 (83%)

Query: 520 IISGSHDGSIKIWDLQSGKCMHTF 543
           ++SGS D SI+++D++SGK + T+
Sbjct: 161 VVSGSMDNSIRVFDIESGKLLGTY 184

>Sklu_1659.2 YMR092C, Contig c1659 410-2251
          Length = 613

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 4/90 (4%)

Query: 270 SYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTY 329
           S D T+ I+ +  + L+RR+ GH  G+  L  +   LV+GS D  +  W  +    +  Y
Sbjct: 315 SLDGTLNIFKIGEDSLVRRIEGHNKGITALVVN--PLVSGSYDGRVVQWINENEPHMENY 372

Query: 330 RGHTDSVMSVDAFKKIIVSGSADKTVKIWH 359
             H + ++S+D   KI+ + S D T+K+++
Sbjct: 373 --HGNMIVSIDNTDKIVSTVSWDDTLKVFN 400

 Score = 37.7 bits (86), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 2/86 (2%)

Query: 463 NDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIIS 522
           N   NQ +  ++     +++ SLD T+ ++ +     +R   GH +G+  +  +   ++S
Sbjct: 294 NTLSNQQVGVAVTKDHEIVALSLDGTLNIFKIGEDSLVRRIEGHNKGITALVVN--PLVS 351

Query: 523 GSHDGSIKIWDLQSGKCMHTFHGKRL 548
           GS+DG +  W  ++   M  +HG  +
Sbjct: 352 GSYDGRVVQWINENEPHMENYHGNMI 377

 Score = 30.0 bits (66), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 265 LLFTGSYDSTVAIWDLC-SNKLIRRLSGHTDGVKTL-YFDEAKLVTGSLDKTIRVW 318
           L+ TGS D+ + I+ +    K+I++L+ H DGV  + + ++  +V+  +D  I+ W
Sbjct: 553 LVATGSLDTHMFIYSVKRPMKIIKKLNAHKDGVSVVKWKNKETIVSAGVDACIKEW 608

>Scas_397.2
          Length = 410

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 6/88 (6%)

Query: 336 VMSVDAFKKI-----IVSGSADKTVKIWHVESRTCYTLR-GHTEWVNCVKLHPKSFTCFS 389
           V S+DAF +       + G+ + ++ ++  +    +T    H   +  +K  P      S
Sbjct: 97  VTSIDAFARANDVASYIVGNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVLS 156

Query: 390 GSDDTTIRMWDIRTNSCLKVFRGHVGQV 417
           GS D  +++W I+  SC ++FRGH  ++
Sbjct: 157 GSSDMQLKLWSIKDASCPRIFRGHTSKI 184

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 472 KSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWD-IAADNFR-IISGSHDGSI 529
           K  P    +LS S D  +KLW ++   C R   GH   + D +  +  R  +S S DG++
Sbjct: 146 KFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDFVSSSLDGTM 205

Query: 530 KIWDLQSGKCMHTFHGKRLQPQD 552
           K+W+  SG  + TF  +R  P D
Sbjct: 206 KLWECGSGSTVRTFM-RRENPND 227

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 50/96 (52%), Gaps = 8/96 (8%)

Query: 269 GSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL-YFDEAKLV-TGSLDKTIRVWNYKTGECI 326
           G+ + +++++D   +    +   H   + TL +F   ++V +GS D  +++W+ K   C 
Sbjct: 115 GNEEGSISLYDSQFSHEWTQEDAHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCP 174

Query: 327 STYRGH----TDSVMSVDAFKKIIVSGSADKTVKIW 358
             +RGH    TDSV+      +  VS S D T+K+W
Sbjct: 175 RIFRGHTSKITDSVLIERG--RDFVSSSLDGTMKLW 208

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 4/83 (4%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--AKL 306
            H   + TL+F  +  ++ +GS D  + +W +      R   GHT  +      E     
Sbjct: 137 AHCSEITTLKFFPSGEVVLSGSSDMQLKLWSIKDASCPRIFRGHTSKITDSVLIERGRDF 196

Query: 307 VTGSLDKTIRVWNYKTGECISTY 329
           V+ SLD T+++W   +G  + T+
Sbjct: 197 VSSSLDGTMKLWECGSGSTVRTF 219

>YGL003C (CDH1) [1969] chr7 complement(492476..494176) Protein of
           the WD (WD-40) repeat family that binds to substrates
           (CLB2, CLB3, CDC5, HSL1) of the anaphase promoting
           complex (APC) and targets them for degradation [1701 bp,
           566 aa]
          Length = 566

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 82/182 (45%), Gaps = 10/182 (5%)

Query: 246 VQEFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDL-CSNKLIRRLSGHTDGVKTLYFDEA 304
           ++   GH+D V  L +N  +L +GS D  +   D+   +     +  HT  V  L ++ A
Sbjct: 337 IRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVA 396

Query: 305 --KLVTGSLDKTIRVWNYKTGECISTYRGHTDSV--MSVDAFKKIIVS---GSADKTVKI 357
             KL +G  D  + V+   +   I T+  H  +V  M+    K+ +++   G+AD+ +KI
Sbjct: 397 DNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKI 456

Query: 358 WHVESRTCYT-LRGHTEWVNCV-KLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVG 415
           W+V +    + +   ++  N V   +        G     + +WD  +   + + +GH  
Sbjct: 457 WNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSF 516

Query: 416 QV 417
           +V
Sbjct: 517 RV 518

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 61/146 (41%), Gaps = 7/146 (4%)

Query: 266 LFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGEC 325
           L  G  +  V I+D+   K IR LSGH D V  L ++   L +GS D  I   + +  + 
Sbjct: 317 LAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDP 376

Query: 326 -ISTYRGHTDSVMSV--DAFKKIIVSGSADKTVKIWHVESRT-CYTLRGHTEWVNCVKLH 381
              T   HT  V  +  +     + SG  D  V ++   S++   T   H   V  +   
Sbjct: 377 FFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWS 436

Query: 382 PKS---FTCFSGSDDTTIRMWDIRTN 404
           P          G+ D  +++W++ T+
Sbjct: 437 PHKRGVLATGGGTADRRLKIWNVNTS 462

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 464 DEENQTLDKS-IPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFRIIS 522
           D EN+    S I   +HL     +  ++++DV   +CIRT  GH++ V  ++ +N  + S
Sbjct: 300 DTENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTS 359

Query: 523 GSHDGSI 529
           GS D  I
Sbjct: 360 GSRDHRI 366

>Sklu_2423.1 YLR409C, Contig c2423 869-3703
          Length = 944

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 4/69 (5%)

Query: 272 DSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTY 329
           D ++ + D  + K++R+L GH++ V    F  D   +V+ SLD TIR W+  TG CI   
Sbjct: 570 DLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGV 629

Query: 330 RGHTDSVMS 338
           R   DSV +
Sbjct: 630 R--LDSVAT 636

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 3/64 (4%)

Query: 480 LLSCSLDN-TIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 536
           L + +LD+ +I + D  T + +R  +GH   V  +D + D   I+S S D +I+ WDL +
Sbjct: 563 LFAVALDDLSIVVIDAVTQKVVRQLWGHSNRVTAFDFSPDGRWIVSASLDSTIRTWDLPT 622

Query: 537 GKCM 540
           G C+
Sbjct: 623 GGCI 626

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 60/160 (37%), Gaps = 26/160 (16%)

Query: 267 FTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKLVTGSLDKTIRVWNYKTGE 324
           F GS +  + +++L S    ++   H   V  +  D    K+V+  LD  I  +++    
Sbjct: 482 FVGSSEGGIGVYNLQSGLQRKKYRLHKKAVTGVAIDGMNRKMVSCGLDGLIGFYDFTKSA 541

Query: 325 CIST------------YRGHTDSVMSVDAFKKIIVSGSADKTVK-IWHVESRTCYTLRGH 371
            +              +R      +++D    +++     K V+ +W           GH
Sbjct: 542 FLGKLQLDAPVTSMVYHRSSDLFAVALDDLSIVVIDAVTQKVVRQLW-----------GH 590

Query: 372 TEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFR 411
           +  V      P      S S D+TIR WD+ T  C+   R
Sbjct: 591 SNRVTAFDFSPDGRWIVSASLDSTIRTWDLPTGGCIDGVR 630

>Sklu_1926.5 YBR103W, Contig c1926 4197-5726 reverse complement
          Length = 509

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 3/98 (3%)

Query: 274 TVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRG 331
           ++ ++ +  +K I +L GHT  +  L +  D   L++ S DKT+R W        + + G
Sbjct: 317 SILVFSIGESKPIGKLVGHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYG 376

Query: 332 HTDSVMSVDAF-KKIIVSGSADKTVKIWHVESRTCYTL 368
           HT S+   D      ++S S D +V++W V+      L
Sbjct: 377 HTQSITYADWLDDDRLISTSMDGSVRVWSVKQNALVGL 414

 Score = 37.0 bits (84), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 239 WRKGNCQVQE-FKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDG 295
           WR GN      F GH   +    +  + RL+ T S D +V +W +  N L+       DG
Sbjct: 363 WRGGNANSSNCFYGHTQSITYADWLDDDRLIST-SMDGSVRVWSVKQNALVGL--SVVDG 419

Query: 296 VK----TLYFDEAKLVTGSLDKTIRVWNYK 321
           V     TL  D+ K  TG+LD  + V+N K
Sbjct: 420 VPIFCGTLSSDKQKFATGTLDGEVSVYNVK 449

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 59/145 (40%), Gaps = 10/145 (6%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTY-----RGHTDSVMSVDAFK--KIIVSGSADKT 354
           D   ++T  +D    VWN  TG  +  +      G+    + V+  +  K ++ G     
Sbjct: 259 DSTHVLTSDVDNITIVWNALTGTALQHFDLKDTTGNESLGIDVEWIETDKFVIPGLQGSI 318

Query: 355 VKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHV 414
           +     ES+    L GHT+ +  +  +  +    S SDD T+R W     +    F GH 
Sbjct: 319 LVFSIGESKPIGKLVGHTKTLTVLCYNSDNKLLLSASDDKTLRTWRGGNANSSNCFYGH- 377

Query: 415 GQVQKVIPLTIIDAENLVVDNISGS 439
              Q +     +D + L+  ++ GS
Sbjct: 378 --TQSITYADWLDDDRLISTSMDGS 400

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/197 (18%), Positives = 75/197 (38%), Gaps = 18/197 (9%)

Query: 346 IVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNS 405
           +++G  +  +++W            H   V  ++ +  S    +   D    +W+  T +
Sbjct: 222 LITGVENGELRMWSFRGILQNVFNFHRSPVVSIEWNADSTHVLTSDVDNITIVWNALTGT 281

Query: 406 CLKVF--RGHVGQVQKVIPLTIIDAENLVVDNISGS----NEGDDEPXXXXXXXXXXXXX 459
            L+ F  +   G     I +  I+ +  V+  + GS    + G+ +P             
Sbjct: 282 ALQHFDLKDTTGNESLGIDVEWIETDKFVIPGLQGSILVFSIGESKPIGKLVGHTKTLTV 341

Query: 460 XXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGV-WDIAADNF 518
              N +              LLS S D T++ W           +GH + + +    D+ 
Sbjct: 342 LCYNSDNKL-----------LLSASDDKTLRTWRGGNANSSNCFYGHTQSITYADWLDDD 390

Query: 519 RIISGSHDGSIKIWDLQ 535
           R+IS S DGS+++W ++
Sbjct: 391 RLISTSMDGSVRVWSVK 407

>ACR097W [1144] [Homologous to ScYOR212W (STE4) - SH]
           complement(529784..531187) [1404 bp, 467 aa]
          Length = 467

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 6/70 (8%)

Query: 255 GVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTD---GVKTLYFDEAKLVTG 309
           GV+++ F+   RLL+    +   A+WDL   ++I +L GH+D   GV T   D   + TG
Sbjct: 395 GVISMDFSRSGRLLYVSYTEFGCAVWDLVKGEIIGKLDGHSDRISGVAT-SPDGLAICTG 453

Query: 310 SLDKTIRVWN 319
           S D T++VW+
Sbjct: 454 SWDMTMKVWS 463

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/288 (19%), Positives = 108/288 (37%), Gaps = 22/288 (7%)

Query: 262 NYRLLFTGSYDSTVAIW-----DLCSNKLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTI 315
           N  L+ +   D+   I+     D     ++    GHT  +  + F D+  ++T S D T 
Sbjct: 180 NGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDNSILTASGDMTC 239

Query: 316 RVWNYKTGECISTYRGHTDSVMSVDAFK-------KIIVSGSADKTVKIWHVESRTCY-T 367
            +W+    + I+ +  H   V+S+ A          +  SG +D  + IW     T   +
Sbjct: 240 ALWDITKSKRINEFADHLGDVLSLSAAPTETEGNGNVFASGGSDGYLYIWDKRVPTSVQS 299

Query: 368 LRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIID 427
                  V+ VK      T  +GSDD    ++D+R++  +     +    + +   T + 
Sbjct: 300 FFVSDSDVSKVKFFRNGNTIATGSDDGCTNLYDLRSDCRI----ANYSLSRSIHGATPVQ 355

Query: 428 AENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSL-D 486
            +  ++ N+  +                        D +   +         LL  S  +
Sbjct: 356 QQTYIMSNMDYTAPSGTLARASPYSPAIGTVSSSFIDNQG-VISMDFSRSGRLLYVSYTE 414

Query: 487 NTIKLWDVQTGQCIRTQFGHVEGVWDIAA--DNFRIISGSHDGSIKIW 532
               +WD+  G+ I    GH + +  +A   D   I +GS D ++K+W
Sbjct: 415 FGCAVWDLVKGEIIGKLDGHSDRISGVATSPDGLAICTGSWDMTMKVW 462

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 62/144 (43%), Gaps = 11/144 (7%)

Query: 284 KLIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS--V 339
           K +  L GH + V +  +  D   +++ S D  + +W+  TG   +    H+  V+S  +
Sbjct: 118 KPVTTLKGHNNKVSSFRWSSDSRTILSASQDGFMLLWDAATGLKSNAIPLHSQWVLSCAI 177

Query: 340 DAFKKIIVSGSADKTVKIWHVESR------TCYTLRGHTEWVNCVKLHPKSFTCFSGSDD 393
                ++ S   D    I+ V  +           +GHT +++ ++    + +  + S D
Sbjct: 178 CPNGNLVASAGLDNNCTIYRVSRKDRIQQNIVSIFKGHTCYISEIEFLDDN-SILTASGD 236

Query: 394 TTIRMWDIRTNSCLKVFRGHVGQV 417
            T  +WDI  +  +  F  H+G V
Sbjct: 237 MTCALWDITKSKRINEFADHLGDV 260

>AGR168W [4479] [Homologous to ScYBL008W (HIR1) - SH]
           complement(1061522..1063999) [2478 bp, 825 aa]
          Length = 825

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 58/128 (45%), Gaps = 21/128 (16%)

Query: 252 HMDGVLTLQF--NYRLLFTGSYDSTVAIW---------------DLCSNKLIRRLSGHTD 294
           H   V  L+F  + + L +GS D  + IW               DL    + RRL  H +
Sbjct: 76  HTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLFDMENDLEHWNVRRRLVAHDN 135

Query: 295 GVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV--DAFKKIIVSGS 350
            ++ + +  D + LVT  LD++I VWN  T E I  +  H   V  V  D   K   + S
Sbjct: 136 DIQDICWAPDSSILVTVGLDRSIIVWNGSTFEKIKRFDVHQSHVKGVVFDPANKYFATAS 195

Query: 351 ADKTVKIW 358
            D+TVK++
Sbjct: 196 DDRTVKVF 203

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 41/109 (37%), Gaps = 21/109 (19%)

Query: 302 DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIWHVE 361
           D  ++ TG LD  IR+W                SV  +  F K  VS  A +        
Sbjct: 28  DGQRVATGGLDGKIRIW----------------SVADILVFAKPKVSWPARE-----EQL 66

Query: 362 SRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVF 410
            +    +  HT  V  +K  P +    SGSDD  + +W+    +   +F
Sbjct: 67  RKPLANMSRHTGSVTALKFSPDNKYLASGSDDKILLIWEKEEGAVQPLF 115

>Sklu_2406.11 YOR212W, Contig c2406 16632-17912 reverse complement
          Length = 426

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/261 (20%), Positives = 104/261 (39%), Gaps = 19/261 (7%)

Query: 284 KLIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVD-- 340
           K++    GHT  V  L F +   ++T S D T  +W+    + +S Y  H   V+++   
Sbjct: 168 KIVSIFKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVP 227

Query: 341 -----AFKKIIVSGSADKTVKIWHVES-RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDT 394
                ++  +  SG +D  V +W   S  +          ++ V+      +  +GSDD 
Sbjct: 228 PAGTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDG 287

Query: 395 TIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXX 454
             R++D+R++  L  +       Q+ + L      + +   +  SN              
Sbjct: 288 IARLFDLRSDCELSSYSLSQKVQQQQMKL---KNRSYLSSTMEYSNSS--AAATPYSPAA 342

Query: 455 XXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH---VEGVW 511
                   +++   +LD SI     L +C  +    +WD   G+ +    GH   + GV 
Sbjct: 343 ETIRSSYLDNQGIVSLDFSIS-GRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISGV- 400

Query: 512 DIAADNFRIISGSHDGSIKIW 532
             + D   + +GS D ++K+W
Sbjct: 401 RTSPDGMCVCTGSWDSTMKLW 421

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 55/127 (43%), Gaps = 10/127 (7%)

Query: 246 VQEFKGHMDGVLTLQF-NYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEA 304
           V  FKGH   V  L+F N   + T S D T A+WD+  +K +   S H   V TL    A
Sbjct: 170 VSIFKGHTCYVSDLEFINNESILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVPPA 229

Query: 305 K-------LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSGSADKTV 355
                     +G  D  + +W+ ++   +  +      + +V  F     I++GS D   
Sbjct: 230 GTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSDGNSIITGSDDGIA 289

Query: 356 KIWHVES 362
           +++ + S
Sbjct: 290 RLFDLRS 296

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 255 GVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHT---DGVKTLYFDEAKLVTG 309
           G+++L F+   RLL+    +    +WD    +++ RL GH+    GV+T   D   + TG
Sbjct: 354 GIVSLDFSISGRLLYACYTEYGCIVWDTLRGEIVGRLEGHSSRISGVRT-SPDGMCVCTG 412

Query: 310 SLDKTIRVW 318
           S D T+++W
Sbjct: 413 SWDSTMKLW 421

 Score = 30.8 bits (68), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 47/260 (18%), Positives = 98/260 (37%), Gaps = 59/260 (22%)

Query: 289 LSGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMS--VDAFKK 344
           L GH + +    +  D   +++ S D  + +W+  +G   +     +  V++  +   + 
Sbjct: 84  LKGHNNKISDFRWSRDSKSILSASQDGFMLIWDPMSGLKKNAIPLDSQWVLACAISPSRN 143

Query: 345 IIVSGSADKTVKIWHV--ESRT----CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRM 398
           ++ SG       I+ +  E+RT        +GHT +V+ ++      +  + S D T  +
Sbjct: 144 LVASGGLSNNCTIYRISQENRTQQKIVSIFKGHTCYVSDLEFINNE-SILTASGDMTCAL 202

Query: 399 WDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXX 458
           WDI  +  +  +  H+G V   + L++  A                              
Sbjct: 203 WDIPKSKRVSEYSDHLGDV---LTLSVPPA------------------------------ 229

Query: 459 XXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--AD 516
                         +  Y +   S   D  + LWD ++   ++  F     +  +   +D
Sbjct: 230 -------------GTTSYDSMFASGGSDGYVYLWDTRSPSSVQNFFVSDSDISTVRFFSD 276

Query: 517 NFRIISGSHDGSIKIWDLQS 536
              II+GS DG  +++DL+S
Sbjct: 277 GNSIITGSDDGIARLFDLRS 296

>Kwal_27.10385
          Length = 536

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 287 RRLSGHTDGVKTLY-----FDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV-- 339
           R  S  T G   +Y      D+  +VTGS+D ++R++  + G C++    H   V  V  
Sbjct: 127 RLRSSSTAGSSEIYDLAWSPDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVW 186

Query: 340 DAFKKIIVSGSADKTVKIWHVESRTCYTLRG 370
           D   + I S SAD++V ++ +E     ++ G
Sbjct: 187 DPQNEFIFSQSADRSVHVYRIEKTPSGSISG 217

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 38/65 (58%), Gaps = 6/65 (9%)

Query: 475 PYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGH---VEG-VWDIAADNFRIISGSHDGSIK 530
           P   ++++ S+DN++++++V+ G C+     H   V+G VWD    N  I S S D S+ 
Sbjct: 146 PDDNYIVTGSMDNSLRIFEVEEGTCVANAADHNHYVQGVVWD--PQNEFIFSQSADRSVH 203

Query: 531 IWDLQ 535
           ++ ++
Sbjct: 204 VYRIE 208

>Kwal_55.21144
          Length = 570

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 75/324 (23%), Positives = 125/324 (38%), Gaps = 41/324 (12%)

Query: 223 RPWKVIYRE---RFKVESNWRKGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAI 277
           RP K+ + +   RF  ES     N      +GH D +LTL    + + + TG  D  + I
Sbjct: 204 RPKKIKFTKGGRRFVPESKIEYDNTT----EGHYDEILTLAASPDGKYVITGGRDRKLII 259

Query: 278 WDLCSNKLIRRL--SGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHT 333
           W   S   ++ +        V +L F  +  +L     D  IR ++      +    GH 
Sbjct: 260 WSTESLAPVKVIPTKDRRGEVLSLVFRKNSDQLYAACADYKIRTYSINQFSQLEILYGHQ 319

Query: 334 DSVMSVDAF--KKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGS 391
           D V+ + A   ++ +  GS D+T  +W +   T  T RG  +    +K   K  T  S +
Sbjct: 320 DLVVGISALGMERCVTVGSRDRTAMLWKIADETRLTFRGGDDPERLLKRWIKQNTTKSDT 379

Query: 392 DDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXX 451
            +      DI  +   + F    G +  V   T+ID  +     I+GS+ G+        
Sbjct: 380 GE------DITPDESERPFFYGEGSIDCV---TMIDDSHF----ITGSDNGNISLWSLSK 426

Query: 452 XXXXXXXXXXXNDEENQTLDKSIPYPTHL-LSCSLDNTIKLWDVQTGQCIRTQFGHVEGV 510
                           +T     P PT   +S   D   +   +Q  +  +  +  +  +
Sbjct: 427 KKPLYT---------ERTAHGVAPAPTSTQISAEADEQKRNLQLQNQKIAQPYW--ITAL 475

Query: 511 WDIAADNFRIISGSHDGSIKIWDL 534
             I   N   +SGS DGS++IW L
Sbjct: 476 HAIPYSNV-FVSGSWDGSLRIWKL 498

>YGR200C (ELP2) [2150] chr7 complement(899907..902273) 90 kDa
           subunit of elongator and elongating RNA polymerase II
           holoenzyme, has WD (WD-40) repeats [2367 bp, 788 aa]
          Length = 788

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 8/93 (8%)

Query: 274 TVAIWDLC--SNK-LIRRLSGHTDGVKTLYF--DEAKLVTGSLDKTIRVW---NYKTGEC 325
           T+A+WD    +NK +   L GH   V  + F  D   +V+ S D  +++W   +Y   +C
Sbjct: 37  TIALWDPIEPNNKGVYATLKGHEAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQC 96

Query: 326 ISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIW 358
           I T + ++ +++++ A   +I  G AD T+ IW
Sbjct: 97  IQTIQHYSKTIVALSALPSLISVGCADGTISIW 129

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/143 (21%), Positives = 62/143 (43%), Gaps = 18/143 (12%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK------LVTGSLDKTIRVWNYKTGECISTYRGHTDSVM 337
           +++  L GH D VK+L F   +      L +GS D+ IR+W  +  + I           
Sbjct: 193 RVVAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLIDD--------- 243

Query: 338 SVDAFKKIIVSGSADKTVKI---WHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDT 394
           S +  KK+ +  +     +I     V       + GH +W++ ++ H       + + DT
Sbjct: 244 SEEDSKKLTLLSNKQYKFQIDDELRVGINFEALIMGHDDWISSLQWHESRLQLLAATADT 303

Query: 395 TIRMWDIRTNSCLKVFRGHVGQV 417
           ++ +W+    S + V    +G++
Sbjct: 304 SLMVWEPDETSGIWVCSLRLGEM 326

 Score = 37.7 bits (86), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 5/91 (5%)

Query: 322 TGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIW---HVESRTCY-TLRGHTEWVNC 377
           T E I         V  +   KKI+  G A KT+ +W      ++  Y TL+GH   V C
Sbjct: 6   TPEAIFIGANKQTQVSDIHKVKKIVAFG-AGKTIALWDPIEPNNKGVYATLKGHEAEVTC 64

Query: 378 VKLHPKSFTCFSGSDDTTIRMWDIRTNSCLK 408
           V+  P S    S S+D  +++W     S L+
Sbjct: 65  VRFVPDSDFMVSASEDHHVKIWKFTDYSHLQ 95

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query: 465 EENQTLDKSIPYPTHLLSCSLDNTIKLW---DVQTGQCIRTQFGHVEGVWDIAADNFRII 521
           E   T  + +P    ++S S D+ +K+W   D    QCI+T   + + +  ++A    I 
Sbjct: 59  EAEVTCVRFVPDSDFMVSASEDHHVKIWKFTDYSHLQCIQTIQHYSKTIVALSALPSLIS 118

Query: 522 SGSHDGSIKIW 532
            G  DG+I IW
Sbjct: 119 VGCADGTISIW 129

 Score = 29.6 bits (65), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 55/123 (44%), Gaps = 17/123 (13%)

Query: 246 VQEFKGHMDGVLTLQFNYR------LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTL 299
           V E +GH D V +L F ++      LL +GS D  + +W +  N LI       +  K L
Sbjct: 195 VAELEGHEDWVKSLAFRHQETPGDYLLCSGSQDRYIRLWRIRINDLI---DDSEEDSKKL 251

Query: 300 YFDEAKLVTGSLDKTIRVW-NYKTGECISTYRGHTDSVMSVDAFKK--IIVSGSADKTVK 356
                K     +D  +RV  N++     +   GH D + S+   +    +++ +AD ++ 
Sbjct: 252 TLLSNKQYKFQIDDELRVGINFE-----ALIMGHDDWISSLQWHESRLQLLAATADTSLM 306

Query: 357 IWH 359
           +W 
Sbjct: 307 VWE 309

>Kwal_56.24399
          Length = 369

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 78/197 (39%), Gaps = 23/197 (11%)

Query: 251 GHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCS--NKLIRRLSGHTDGVKTL-YFDEAK 305
           GH   VL  +F  +  L  +   D  + IWDL S  N ++      +  + T    D+ +
Sbjct: 74  GHTRPVLACKFVKSGTLALSAGLDPHLCIWDLKSGHNHVLGHCHRRSAAITTFDTLDDTR 133

Query: 306 LVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKK-IIVSGSADKTVKIWHVESRT 364
            VTGS D  + + +  TG  +  + GHT  V  V A       S S D  +KIW   +++
Sbjct: 134 AVTGSSDTRLALVDLHTGRKLRNFAGHTRVVNQVRALNTDRFASVSDDGALKIWDAHTKS 193

Query: 365 ----------CYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHV 414
                      +TL   +   +   L+           D  IR +D+R N+  ++F    
Sbjct: 194 PVWQISSEFPLFTLTSSSSSSDDNILYTSGL-------DPVIRAYDLRQNNGQELFNWST 246

Query: 415 GQVQKVIPLTIIDAENL 431
                V  + I  + NL
Sbjct: 247 PHTDSVTSIHINASRNL 263

 Score = 36.6 bits (83), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNF-RIISGSHDGSIKIWD 533
           T  ++ S D  + L D+ TG+ +R   GH   V  + A N  R  S S DG++KIWD
Sbjct: 132 TRAVTGSSDTRLALVDLHTGRKLRNFAGHTRVVNQVRALNTDRFASVSDDGALKIWD 188

>CAGL0J10340g complement(1008637..1009653) highly similar to
           sp|P53011 Saccharomyces cerevisiae YGL100w SEH1 nuclear
           pore protein, start by similarity
          Length = 338

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 71/165 (43%), Gaps = 28/165 (16%)

Query: 290 SGHTDGVKTLYFD--EAKLVTGSLDKTIRVWNYKTG----ECISTYRGHTDSVMSVD--- 340
           +GH D V  + +D     + T S D+ I+V+         E   ++R H  S++S+D   
Sbjct: 6   TGHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATRWEVNDSWRAHDSSIVSLDWAS 65

Query: 341 -AFKKIIVSGSADKTVKIWHVE-----------SRTCYTLRGHTEWVNCVKLHPK--SFT 386
             + +II S S DKT+KIW  +           +R C TL      + CVK  P      
Sbjct: 66  PEYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLC-TLNDSKGSLYCVKFAPSHLGLR 124

Query: 387 CFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENL 431
             S  +D  +RM+D    S L+ +        +V  L +  A NL
Sbjct: 125 IASIGNDGIMRMYDALDPSNLRSWT----MTAEVKVLPVAPANNL 165

>Scas_705.2
          Length = 571

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 64/147 (43%), Gaps = 12/147 (8%)

Query: 232 RFKVESNWRKGNCQVQEFKGHMDGVLTLQF--NYRLLFTGSYDSTVAIWDLCSNKLIRRL 289
           RF   SN +  N      +GH D +LT+    + + + TG  D  + +W   S   I+ +
Sbjct: 217 RFTPVSNQQYENTT----EGHYDEILTVAASPDGKYVVTGGRDRKLIVWSTESLAPIKVI 272

Query: 290 --SGHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAF--K 343
                   V +L F  +  +L     D  IR ++ K    + T  GH D V+ + A   +
Sbjct: 273 PTKDRRGEVLSLVFRKNSDELYASCADYKIRTYSIKQFSQLETLYGHHDIVVDISALSME 332

Query: 344 KIIVSGSADKTVKIWHVESRTCYTLRG 370
           + +  G+ D+T  +W +   T  T RG
Sbjct: 333 RCVTVGARDRTAMLWKIPDETRLTFRG 359

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/248 (19%), Positives = 95/248 (38%), Gaps = 58/248 (23%)

Query: 205 SICATNNTCTKDSNGKLMRPWKVIYRER----------FKVESNWRKGNCQVQEFKGHMD 254
           S+       TKD  G+++    +++R+           +K+ +   K   Q++   GH D
Sbjct: 265 SLAPIKVIPTKDRRGEVL---SLVFRKNSDELYASCADYKIRTYSIKQFSQLETLYGHHD 321

Query: 255 GVLTLQF--NYRLLFTGSYDSTVAIWDLCSN------------KLIRR-----LSGHTDG 295
            V+ +      R +  G+ D T  +W +               KL++R       G  DG
Sbjct: 322 IVVDISALSMERCVTVGARDRTAMLWKIPDETRLTFRGGDDPEKLLKRWLKNNAVGQEDG 381

Query: 296 V--------KTLYF-----------DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSV 336
                      L+F           D++  +TGS +  + +W+    + I   R     +
Sbjct: 382 ELKYPDKSEAPLFFTEGSIDVVSMIDDSHFITGSDNGNLSLWSLAKKKPIFIERAAHGLI 441

Query: 337 MSVDAFKKIIVSGSADKTVKIWHVESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTI 396
              D+ +   +SG A+K V+   ++ +          W+  +   P S    SGS + ++
Sbjct: 442 PLPDSTE---ISGEANKEVRERQLQEKKLL----QPFWITAIYAIPYSNVFISGSANGSL 494

Query: 397 RMWDIRTN 404
           ++W I+ N
Sbjct: 495 KVWKIKEN 502

>CAGL0C01441g complement(156930..159947) similar to tr|Q08924
           Saccharomyces cerevisiae YPL183c, start by similarity
          Length = 1005

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 52/97 (53%), Gaps = 4/97 (4%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE-AKLVTG-SLDKTIRVWNYKTGEC 325
            G+      +WDL   +LI  L+GH   +  +   E  KL+   S D++IR+W+ +TG+ 
Sbjct: 154 AGTVMGGAIVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKE 213

Query: 326 ISTYRGHTDSVMSVDAFK--KIIVSGSADKTVKIWHV 360
           +S    HT  + ++  F   + +VS S D T ++W++
Sbjct: 214 LSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNI 250

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 75/172 (43%), Gaps = 19/172 (11%)

Query: 292 HTDGVKTLYFDEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFK--KIIVSG 349
           ++  +K +   E ++  G++     VW+    E I    GH  S+  + + +  K+I S 
Sbjct: 138 YSGSIKVISESEVQINAGTVMGGAIVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASC 197

Query: 350 SADKTVKIWHVESRTCYTLR-GHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTN---- 404
           S D+++++W  E+    ++   HT  +  +K         S S+D T R+W+I  N    
Sbjct: 198 SDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISG 257

Query: 405 ---SCLKVFRGH---------VGQVQKVIPLTIIDAENLVVDNISGSNEGDD 444
                  +F GH         V   +++I  +  D    V+D  + +N GD+
Sbjct: 258 YELQISNIFEGHLLKNVWGVDVNDEKRIIATSGNDGRINVIDLNTDTNSGDE 309

 Score = 37.0 bits (84), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADN--FRIISGSHDGSIKIWDL 534
           + SCS D +I+LWD +TG+ +   + H   +W++   N    ++S S D + ++W++
Sbjct: 194 IASCSDDRSIRLWDRETGKELSIGWSHTARIWNLKFFNNDENLVSVSEDCTCRVWNI 250

 Score = 30.0 bits (66), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 491 LWDVQTGQCIRTQFGHVEGVWDIAAD--NFRIISGSHDGSIKIWDLQSGK 538
           +WD+   + I    GH   ++ I +   N  I S S D SI++WD ++GK
Sbjct: 163 VWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGK 212

>Sklu_1710.1 YDR267C, Contig c1710 17-739
          Length = 240

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 64/129 (49%), Gaps = 13/129 (10%)

Query: 284 KLIRRLSGHTDGVKTLYFDEAK--LVTGSLDKTIRVWNY----KTGECISTYRGHTDSVM 337
           +L+  + GH + VK++ +  +   L T S DK++ +W      +  ECIS  + H+  V 
Sbjct: 10  ELLAIVEGHENEVKSVSWSHSGYYLATCSRDKSVWIWEADEYGEEFECISVLQEHSQDVK 69

Query: 338 SV--DAFKKIIVSGSADKTVKIWHV---ESRTCYTLRGH--TEWVNCVKLHPKSFTCFSG 390
            V   +   ++ S S D T++IW     + +    L GH  T W +  +    S    SG
Sbjct: 70  HVVWHSVLSLLASSSYDDTIRIWKDFDDDWQCAAVLNGHEGTVWCSDFEKSESSLRLCSG 129

Query: 391 SDDTTIRMW 399
           SDDTT+R+W
Sbjct: 130 SDDTTVRIW 138

>Scas_605.18
          Length = 424

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 51/263 (19%), Positives = 103/263 (39%), Gaps = 30/263 (11%)

Query: 285 LIRRLSGHTDGVKTLYF-DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSV---- 339
           ++    GHT  +  + F D + ++T S D T  +W+    + +  Y  H   V+++    
Sbjct: 172 VVSIFKGHTCYISDIEFLDNSHIITSSGDMTCALWDIPKAKRVREYADHLGDVLALALPP 231

Query: 340 -----DAFKKIIVSGSADKTVKIWHVESRTCYTLR---GHTEWVNCVKLHPKSFTCFSGS 391
                +    I  S  +D    IW  ++RT   ++        VN ++      +  +G 
Sbjct: 232 PSADENTGANIFASCGSDGYTYIW--DTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGG 289

Query: 392 DDTTIRMWDIRTNSCLKVFRGHVGQVQKVIPLTIIDAENLVVDNISGSNEGDDEPXXXXX 451
           DD  I M+D+R++  +  +    G  +++   T + +      N+  S      P     
Sbjct: 290 DDGVINMFDLRSDCAIASYSLQQGIQKEIRDPTYMSS------NMEYSRGSPQSP----- 338

Query: 452 XXXXXXXXXXXNDEENQTLDKSIPYPTHLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVW 511
                      +++   +LD S      + +C  D    +WDV   + +    GH   V 
Sbjct: 339 -ISTAISSSYLDNQGVVSLDFS-NSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVS 396

Query: 512 DI--AADNFRIISGSHDGSIKIW 532
            +  + D   + +GS D +++IW
Sbjct: 397 SVRTSPDGLGVCTGSWDSTMRIW 419

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 255 GVLTLQFNY--RLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYF--DEAKLVTGS 310
           GV++L F+   RL+F    D    IWD+   +++ +L GH++ V ++    D   + TGS
Sbjct: 352 GVVSLDFSNSGRLMFACYTDLGCIIWDVLKAEIVGKLEGHSNRVSSVRTSPDGLGVCTGS 411

Query: 311 LDKTIRVWN 319
            D T+R+W+
Sbjct: 412 WDSTMRIWS 420

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 2/64 (3%)

Query: 482 SCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIA--ADNFRIISGSHDGSIKIWDLQSGKC 539
           SC  D    +WD +T   ++  F     V  I    D   I++G  DG I ++DL+S   
Sbjct: 245 SCGSDGYTYIWDTRTSAAVQKFFASDTDVNAIQFFKDGNSIVTGGDDGVINMFDLRSDCA 304

Query: 540 MHTF 543
           + ++
Sbjct: 305 IASY 308

>Sklu_675.1 YMR146C, Contig c675 761-1687
          Length = 308

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 480 LLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR--IISGSHDGSIKIWDLQSG 537
           + SC+ D+   +W    G+ + T  GH+  +W I  D F    ++GS D S+K+W +  G
Sbjct: 25  IFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDG 84

Query: 538 KCMHTFHGK 546
             ++T+  K
Sbjct: 85  SNVYTWKTK 93

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 4/74 (5%)

Query: 312 DKTIRVWNYKTGECISTYRGHTDSVMS--VDAFKKIIVSGSADKTVKIWHV-ESRTCYTL 368
           D    VW    GE + T+ GH  ++ S  VD F +  V+GSAD +VK+W V +    YT 
Sbjct: 31  DSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTEYAVTGSADFSVKLWKVCDGSNVYTW 90

Query: 369 RGHTEWVNCVKLHP 382
           +  T  V  V+  P
Sbjct: 91  KTKTP-VRRVEFSP 103

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 61/134 (45%), Gaps = 16/134 (11%)

Query: 249 FKGHMDGVLTLQFNYR--LLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDE--A 304
            KGH   +  +++N    L+F+ + DS  ++W   + + +    GH   + ++  D+   
Sbjct: 6   LKGHERSLTQVKYNREGDLIFSCAKDSVASVWYAINGERLGTFEGHMGTIWSIDVDQFTE 65

Query: 305 KLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKIW-----H 359
             VTGS D ++++W    G  + T++  T         +++  S + DK + +      +
Sbjct: 66  YAVTGSADFSVKLWKVCDGSNVYTWKTKT-------PVRRVEFSPAGDKILAVLDGVMGY 118

Query: 360 VESRTCYTLRGHTE 373
             S T Y +  +TE
Sbjct: 119 AGSVTVYDVVRNTE 132

>Scas_719.30
          Length = 940

 Score = 43.1 bits (100), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 86/225 (38%), Gaps = 35/225 (15%)

Query: 198 ARFVKNASICATNNTCTKDSNGKLMRPWKVIYRERFKVESNWRKGNCQVQEFKGHMDGVL 257
           A  ++NA I    N  T   + K  R W +    R K    W         F    DG +
Sbjct: 417 ALAIENARIGDWENVITAHKDEKFARTWDM----RTKRVGRW--------TFPTSDDGFV 464

Query: 258 ---TLQFNYRLLFTGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFD--EAKLVTGSLD 312
               L       F GS +  ++++++ S  L ++   H   V  +  D    K+V+  LD
Sbjct: 465 KSVALSQCGNFGFVGSSNGGISVFNMQSGILRKKYRLHKKTVTGIALDGMNRKMVSCGLD 524

Query: 313 KTIRVWNYKTGECISTYRGHTDSVMSVDA-FKKIIVSGSAD---------KTVKIWHVES 362
             +  +++      ST+ G     + +DA   K++   S+D           V I  V  
Sbjct: 525 GIVGFYDFNK----STFLGK----LQLDAPITKMVYHRSSDLFALILDDLSIVLIDAVTQ 576

Query: 363 RTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCL 407
           R      GH+  +  +   P      S S D+TIR WD+ T  C+
Sbjct: 577 RVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPTGGCI 621

 Score = 37.4 bits (85), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 480 LLSCSLDN-TIKLWDVQTGQCIRTQFGHVEGV--WDIAADNFRIISGSHDGSIKIWDLQS 536
           L +  LD+ +I L D  T + +R  +GH   +   D + D   I+S S D +I+ WDL +
Sbjct: 558 LFALILDDLSIVLIDAVTQRVVRQFWGHSNRITALDFSPDGRWIVSASLDSTIRTWDLPT 617

Query: 537 GKCM 540
           G C+
Sbjct: 618 GGCI 621

>Sklu_2332.7 YER107C, Contig c2332 14211-15314 reverse complement
          Length = 367

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 54/96 (56%), Gaps = 8/96 (8%)

Query: 268 TGSYDSTVAIWDLCSNKLIRRLSGHTDGVKTLYFDEAK------LVTGSLDKTIRVWNYK 321
           +G  D+ V ++D+ S +  +++  H   ++ L F +        LVTGS DKTI+ W+ +
Sbjct: 96  SGGCDNVVKLFDVQSGQA-QQVGAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIKYWDMR 154

Query: 322 TGECISTYRGHTDSVMSVDAFKKIIVSGSADKTVKI 357
             + +ST     D V ++D+ +K++V  +A++ + I
Sbjct: 155 QPQPVSTLM-MPDRVYAMDSKQKLLVVATAERHIAI 189

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 484 SLDNTIKLWDVQTGQCI-RTQFGHVEGVWDI--AADNFRIISGSHDGSIKIWDLQSGKCM 540
           S DN +++WDV  G    R Q+ H   V     + D  ++ SG  D  +K++D+QSG+  
Sbjct: 55  SWDNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQSGQAQ 114

Query: 541 H 541
            
Sbjct: 115 Q 115

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 37/77 (48%), Gaps = 17/77 (22%)

Query: 478 THLLSCSLDNTIKLWDVQTGQCIRTQFGHVEGVWDIAADNFR-----------IISGSHD 526
           T + S   DN +KL+DVQ+GQ  +       G  D A  + R           +++GS D
Sbjct: 92  TKVASGGCDNVVKLFDVQSGQAQQV------GAHDSAIRHLRFIQCGPTNTECLVTGSWD 145

Query: 527 GSIKIWDLQSGKCMHTF 543
            +IK WD++  + + T 
Sbjct: 146 KTIKYWDMRQPQPVSTL 162

 Score = 33.1 bits (74), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 13/103 (12%)

Query: 310 SLDKTIRVWNYKTG--ECISTYRGHTDSVMSV----DAFKKIIVSGSADKTVKIWHVESR 363
           S D  +R+W+   G  +  + Y  H   V++     D  K  + SG  D  VK++ V+S 
Sbjct: 55  SWDNKVRIWDVNGGMAQGRAQYE-HQAPVLTTRWSNDGTK--VASGGCDNVVKLFDVQSG 111

Query: 364 TCYTLRGHTEWVNCVKL---HPKSFTCF-SGSDDTTIRMWDIR 402
               +  H   +  ++     P +  C  +GS D TI+ WD+R
Sbjct: 112 QAQQVGAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIKYWDMR 154

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 47/104 (45%), Gaps = 12/104 (11%)

Query: 265 LLFTGSYDSTVAIWDLCSNKLIRRLS-GHTDGVKTLYF--DEAKLVTGSLDKTIRVWNYK 321
           L    S+D+ V IWD+       R    H   V T  +  D  K+ +G  D  +++++ +
Sbjct: 50  LFSVSSWDNKVRIWDVNGGMAQGRAQYEHQAPVLTTRWSNDGTKVASGGCDNVVKLFDVQ 109

Query: 322 TGECISTYRGHTDSVMSVDAF-------KKIIVSGSADKTVKIW 358
           +G+      G  DS +    F        + +V+GS DKT+K W
Sbjct: 110 SGQAQQV--GAHDSAIRHLRFIQCGPTNTECLVTGSWDKTIKYW 151

>YHR186C (KOG1) [2471] chr8 complement(475997..480670) Component of
            the TOR complex 1 (Tor1p or Tor2p-Kog1p-Lst8p), which is
            required for wild-type growth, maintenance of cell and
            vacuole size and morphology, protein synthesis,
            maintenance of glycogen homeostasis [4674 bp, 1557 aa]
          Length = 1557

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 74/173 (42%), Gaps = 28/173 (16%)

Query: 265  LLFTGSYDSTVAIW----DLCSNKLIRRLSGHTDGVKT----------LYFDEAKLVTGS 310
            LL TGS D  + I+    D+ + K++    G TD + T          L    + L TG 
Sbjct: 1270 LLLTGSSDGVIKIYRDYQDVDTFKIVSAWRGLTDMLLTPRSTGLLTEWLQIRGSLLTTGD 1329

Query: 311  LDKTIRVWNYKTGECISTYRGHTDSV---MSVDAFK-KIIVSGSADKTVKIW--HVESRT 364
            + K IRVW+  T          T S+   ++ D     I V+G AD +++++   ++ R 
Sbjct: 1330 V-KVIRVWDAHTETVEVDIPAKTSSLITSLTADQLAGNIFVAGFADGSLRVYDRRLDPRD 1388

Query: 365  CYTLR------GHTEWVNCVKLHPKSF-TCFSGSDDTTIRMWDIRTNSCLKVF 410
                R          W+N V L    +    SG+ +  + +WDIR+   ++ F
Sbjct: 1389 SMIRRWRAGNDKQGVWINNVHLQRGGYRELVSGATNGVVELWDIRSEDPVESF 1441

>Kwal_14.1235
          Length = 607

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/204 (21%), Positives = 84/204 (41%), Gaps = 27/204 (13%)

Query: 360 VESRTCYTLRGHTEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRTNSCLKVFRGHVGQVQK 419
           +E    +  + HT  VN +KL+       SGS D  +  WD+ +  C+  F+G   Q+  
Sbjct: 306 MEGHIAHYFKKHTSTVNQLKLNNDESRFISGSWDKQVLEWDLNSGECINEFKGSSAQISS 365

Query: 420 V--IPL----------------TIIDAENLVVDNISGSNEGDDEPXXXXXXXXXXXXXXX 461
           +   PL                  + A++  +D++ G  E +++                
Sbjct: 366 LEFRPLFSSVEIQDTSTEDDDDVQMKADDDDLDSLFGDEEEEEKRKAQEENTTAEESTKK 425

Query: 462 XNDEE--NQTLDKSIPYPTHLLSCSLDNTIKLWD--VQTGQCIRTQFGHVEGVWDIAA-- 515
             +EE    TL       T L SC+ + +I++WD  + +   ++   G     W ++A  
Sbjct: 426 SPEEEISRSTLRTVFDENTFLGSCT-NGSIQIWDRRIASRPAMKLMRGPQTPPWCMSACW 484

Query: 516 --DNFRIISGSHDGSIKIWDLQSG 537
             D  R+ +G  + +++ +DL+ G
Sbjct: 485 STDGDRVYAGRRNATVEEYDLKIG 508

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 292 HTDGVKTLYF--DEAKLVTGSLDKTIRVWNYKTGECISTYRGHTDSVMSVDAFKKIIVS 348
           HT  V  L    DE++ ++GS DK +  W+  +GECI+ ++G +  + S++ F+ +  S
Sbjct: 317 HTSTVNQLKLNNDESRFISGSWDKQVLEWDLNSGECINEFKGSSAQISSLE-FRPLFSS 374

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%)

Query: 516 DNFRIISGSHDGSIKIWDLQSGKCMHTFHGKRLQ 54