Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.3991688940630.0
YIL047C (SYG1)90294020630.0
Scas_700.25*93184920510.0
CAGL0L00737g91183818380.0
Kwal_23.578585679817400.0
ADL080W86380016100.0
KLLA0F27467g84480412981e-165
Kwal_47.187213832181302e-07
Sklu_2440.133811951043e-04
ADR289C80738960.003
Kwal_23.612981648940.006
Scas_625.1693253920.008
CAGL0F02871g368154890.016
YNR013C (PHO91)89452890.021
AFR628C86933870.038
Kwal_33.1361889136850.061
KLLA0C03454g90079830.097
KLLA0F06160g85960830.099
AAR127C381269810.13
CAGL0I05632g88631820.16
YCR037C (PHO87)923115810.18
KLLA0A02057g384225790.27
YDR414C (ERD1)362183770.40
YJL198W (PHO90)88182780.48
Scas_689.169187760.73
Scas_634.1591679760.82
CAGL0F02387g95279751.0
CAGL0L06622g113743703.4
YER094C (PUP3)20538675.4
Scas_609.1120538657.6
YGR233C (PHO81)117841679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.39
         (916 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.39                                                          1569   0.0  
YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein fo...   799   0.0  
Scas_700.25*                                                          794   0.0  
CAGL0L00737g complement(90349..93084) similar to sp|P40528 Sacch...   712   0.0  
Kwal_23.5785                                                          674   0.0  
ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH] complement(...   624   0.0  
KLLA0F27467g complement(2541110..2543644) similar to sp|P40528 S...   504   e-165
Kwal_47.18721                                                          55   2e-07
Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement      45   3e-04
ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH] (1193040.....    42   0.003
Kwal_23.6129                                                           41   0.006
Scas_625.16                                                            40   0.008
CAGL0F02871g complement(278122..279228) similar to sp|P16151 Sac...    39   0.016
YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member o...    39   0.021
AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C ...    38   0.038
Kwal_33.13618                                                          37   0.061
KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces c...    37   0.097
KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces c...    37   0.099
AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH] (568957..570...    36   0.13 
CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces c...    36   0.16 
YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of ...    36   0.18 
KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA Kluy...    35   0.27 
YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein ...    34   0.40 
YJL198W (PHO90) [2728] chr10 (60843..63488) Phosphate transporte...    35   0.48 
Scas_689.1                                                             34   0.73 
Scas_634.15                                                            34   0.82 
CAGL0F02387g complement(229207..232065) similar to sp|P25360 Sac...    33   1.0  
CAGL0L06622g complement(743602..747015) similar to sp|P17442 Sac...    32   3.4  
YER094C (PUP3) [1527] chr5 complement(348725..349342) Proteasome...    30   5.4  
Scas_609.11                                                            30   7.6  
YGR233C (PHO81) [2181] chr7 complement(954675..958211) Cyclin-de...    30   9.4  

>Scas_704.39
          Length = 916

 Score = 1569 bits (4063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 777/889 (87%), Positives = 777/889 (87%)

Query: 1   MKFGDHLRESIIPEWXXXXXXXXXXXXXXXHFRAKWENQSIYNDPVFQKKSTYSTTRDXX 60
           MKFGDHLRESIIPEW               HFRAKWENQSIYNDPVFQKKSTYSTTRD  
Sbjct: 1   MKFGDHLRESIIPEWKDKYIDYKSSKKRIKHFRAKWENQSIYNDPVFQKKSTYSTTRDLR 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVYSPLLIEIIHEFMENWIISIQLT 120
                                               VYSPLLIEIIHEFMENWIISIQLT
Sbjct: 61  SNNNSQSNLNLNRQASNGNIIRSTNSSSSSLASSLRVYSPLLIEIIHEFMENWIISIQLT 120

Query: 121 KCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDAANSISSSYGSLMTSATSDSVTTS 180
           KCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDAANSISSSYGSLMTSATSDSVTTS
Sbjct: 121 KCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDAANSISSSYGSLMTSATSDSVTTS 180

Query: 181 LIQSIKDTLHAHRLLPSYPQYSLKQLIFNNTTSDTESQPLMERETFNPEDQXXXXXXXXT 240
           LIQSIKDTLHAHRLLPSYPQYSLKQLIFNNTTSDTESQPLMERETFNPEDQ        T
Sbjct: 181 LIQSIKDTLHAHRLLPSYPQYSLKQLIFNNTTSDTESQPLMERETFNPEDQLLNNLNNNT 240

Query: 241 XXXXXXXXXXXXXXXXXILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMA 300
                            ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMA
Sbjct: 241 SSAKSSLDKSAKLLSDAILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMA 300

Query: 301 FAKQNFTIFKHIDPNIKLMTNKMKQISSYQPIIFDELIPSNEIDDPILWWESKVKDWYVN 360
           FAKQNFTIFKHIDPNIKLMTNKMKQISSYQPIIFDELIPSNEIDDPILWWESKVKDWYVN
Sbjct: 301 FAKQNFTIFKHIDPNIKLMTNKMKQISSYQPIIFDELIPSNEIDDPILWWESKVKDWYVN 360

Query: 361 QLTNSPKSMXXXXXXXXXXXXQYSLNEQMVHRNNRAIIQMTIAAWILGISSTSIANTIYL 420
           QLTNSPKSM            QYSLNEQMVHRNNRAIIQMTIAAWILGISSTSIANTIYL
Sbjct: 361 QLTNSPKSMKKNNKKLKKLIIQYSLNEQMVHRNNRAIIQMTIAAWILGISSTSIANTIYL 420

Query: 421 SFMSGYTSYTHKILFPIWGGWYMVLLISLLIISNCFIWHKSEINYRFIMFGEIKARSGTQ 480
           SFMSGYTSYTHKILFPIWGGWYMVLLISLLIISNCFIWHKSEINYRFIMFGEIKARSGTQ
Sbjct: 421 SFMSGYTSYTHKILFPIWGGWYMVLLISLLIISNCFIWHKSEINYRFIMFGEIKARSGTQ 480

Query: 481 FYNNDFATTRISLNLYFLSFFILPLSICALLSFHNENLFPYAIIYPLIATSLFIAPKAIS 540
           FYNNDFATTRISLNLYFLSFFILPLSICALLSFHNENLFPYAIIYPLIATSLFIAPKAIS
Sbjct: 481 FYNNDFATTRISLNLYFLSFFILPLSICALLSFHNENLFPYAIIYPLIATSLFIAPKAIS 540

Query: 541 KYILPYWNKLKEIRVWILTTFIRLSLSGLYPVEFGDFFLGDIICSLTYSMSDIAMFFCIY 600
           KYILPYWNKLKEIRVWILTTFIRLSLSGLYPVEFGDFFLGDIICSLTYSMSDIAMFFCIY
Sbjct: 541 KYILPYWNKLKEIRVWILTTFIRLSLSGLYPVEFGDFFLGDIICSLTYSMSDIAMFFCIY 600

Query: 601 FSDKPSTTCGSSHSITMGILSCLPNYWRMMQCFRRWADSADWFPHLLNAIKYGLGVAYNG 660
           FSDKPSTTCGSSHSITMGILSCLPNYWRMMQCFRRWADSADWFPHLLNAIKYGLGVAYNG
Sbjct: 601 FSDKPSTTCGSSHSITMGILSCLPNYWRMMQCFRRWADSADWFPHLLNAIKYGLGVAYNG 660

Query: 661 TLCAYRLSNHERGTTRNTFIIVAALNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGK 720
           TLCAYRLSNHERGTTRNTFIIVAALNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGK
Sbjct: 661 TLCAYRLSNHERGTTRNTFIIVAALNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGK 720

Query: 721 KDWETGQYSRARKSFYYIAMVWDVLIRFQWIVYAIAPQTIQQNAITSFILATTEXXXXXX 780
           KDWETGQYSRARKSFYYIAMVWDVLIRFQWIVYAIAPQTIQQNAITSFILATTE      
Sbjct: 721 KDWETGQYSRARKSFYYIAMVWDVLIRFQWIVYAIAPQTIQQNAITSFILATTEIIRRCI 780

Query: 781 XXXXXXENEHVANVHLFRVTGNAPLPYPVNVQTIALTKPTFQIGEEERMAENLDQQALGN 840
                 ENEHVANVHLFRVTGNAPLPYPVNVQTIALTKPTFQIGEEERMAENLDQQALGN
Sbjct: 781 WVIIRVENEHVANVHLFRVTGNAPLPYPVNVQTIALTKPTFQIGEEERMAENLDQQALGN 840

Query: 841 LSFNVSYDENAMWPPYXXXXXXXXXXFAEISKSIPWVHATDFQRPTTLL 889
           LSFNVSYDENAMWPPY          FAEISKSIPWVHATDFQRPTTLL
Sbjct: 841 LSFNVSYDENAMWPPYRTLARRRTTTFAEISKSIPWVHATDFQRPTTLL 889

>YIL047C (SYG1) [2620] chr9 complement(265114..267822) Protein for
           which truncation and overexpression can suppress
           lethality of Gpa1p deficiency, member of the divalent
           anion:Na+ (DASS) family of membrane transporters [2709
           bp, 902 aa]
          Length = 902

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/940 (44%), Positives = 552/940 (58%), Gaps = 113/940 (12%)

Query: 1   MKFGDHLRESIIPEWXXXXXXXXXXXXXXXHFRAKWENQ--------------SIYNDPV 46
           MKF DHL ES IPEW                ++ K + +              S+Y    
Sbjct: 1   MKFADHLTESAIPEWRDKYIDYKVGKKKLRRYKEKLDAEEEQSSSYRSWMPSVSVYQ-TA 59

Query: 47  FQKKSTYSTTRDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVYSPLLIEII 106
           FQ++    +  D                                       YS L  E +
Sbjct: 60  FQQREPGKSRSDGDYRSGPAFKKD---------------------------YSALQREFV 92

Query: 107 HEFMENWIISIQLTKCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDAANSISSS-- 164
            +F+E+W+IS QL+KCNEFY WLL +  KKF++LQ+Q+H +++QK    D  N  SS+  
Sbjct: 93  ADFIEDWLISFQLSKCNEFYLWLLKECDKKFEVLQSQLHYYSLQKNYERDNLNRSSSNVD 152

Query: 165 -----------------------------YGSLMTSATSDSVTTSLIQSIKDTLHAHRLL 195
                                        YGS+  +  +     SL+   +  L  +RLL
Sbjct: 153 MSTSLYAAGLAGRSDSRVNSIDSDSRSVMYGSMPCTKEAKKPRLSLLAYCQKVLKDNRLL 212

Query: 196 PSYPQYSLKQLIFNNTTSDTESQPLMERETFNPEDQXXXXXXXXTXXXXXXXXXXXXXXX 255
           PS+P+      +  +   D  S+    RETF             +               
Sbjct: 213 PSWPKRGFS--LLQDLRQDASSR---GRETF---------AFGASFLETMTTTQARNLLS 258

Query: 256 XXILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFKHIDPN 315
             I+E+YL+LQL+KS+RD+NVTGFRK+VKKFDKT  T EL  FM++A+ ++T+FKH D N
Sbjct: 259 NAIIEYYLYLQLVKSFRDINVTGFRKMVKKFDKTCHTRELTTFMSYARTHYTLFKHADAN 318

Query: 316 IKLMTNKMKQISSYQPIIFDELIPSNEIDDPILWWESKVKDWYVNQLTNSPKSMXXXXXX 375
           ++L+  KM+QI+S QP    EL  +    +PI W E+++ +W+   LTNSPK        
Sbjct: 319 VQLVAQKMQQITSSQPTPTSELSSAQRDKEPITWLETQITEWFTTALTNSPKDRKHNTHK 378

Query: 376 XXXXXXQYSLNEQMVHRNNRAIIQMTIAAWILGISSTSIANTIYLSFMSGYTSYTHKILF 435
                 QYS++EQMVHRNNR+I+QM +    +G+S T I  T+YL   S  TS+THKILF
Sbjct: 379 LKKLTIQYSISEQMVHRNNRSIVQMLVVGLGIGVSMTLITYTLYLGISSEETSFTHKILF 438

Query: 436 PIWGGWYMVLLISLLIISNCFIWHKSEINYRFIMFGEIKARSGTQFYNNDFATTRISLNL 495
           P+WGGWYMVLLI+ L + NCFIWH++ INYRFIM GEI++++GTQF+NNDFAT++I L L
Sbjct: 439 PLWGGWYMVLLIAFLFLVNCFIWHRTGINYRFIMLGEIQSKNGTQFFNNDFATSKIPLKL 498

Query: 496 YFLSFFILPLSICALLSFHNENLFPYAIIYPLIATSLFIAPKAISKYILPYWNKLKEIRV 555
           YFL+FFI+P ++C++LSF  E L P   +Y  I + LF+ P      ++PYW+K+   R 
Sbjct: 499 YFLTFFIVPCAVCSMLSFALEKLTPLGFLYIGIVSFLFLCPSG----LIPYWDKVVHTRK 554

Query: 556 WILTTFIRLSLSGLYPVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSSHSI 615
           W++ T IRL +SG +PVEFGDFFLGDIICSLTYS++DIAMFFC+Y S  P+  CGSSHS 
Sbjct: 555 WLVVTLIRLMMSGFFPVEFGDFFLGDIICSLTYSIADIAMFFCVY-SHTPNNLCGSSHSR 613

Query: 616 TMGILSCLPNYWRMMQCFRRWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTT 675
            MG+LSCLP+YWR MQC RR+ADS DWFPHLLNA KY LG+AYN TLCAYRLS+      
Sbjct: 614 AMGVLSCLPSYWRFMQCLRRFADSGDWFPHLLNAAKYTLGIAYNATLCAYRLSDRSE-QR 672

Query: 676 RNTFIIVAALNALITSVWDLTVDWSLLQ-PDSNNWLLRNDLYLAGKKDWETGQYSRARKS 734
           R  FI+ A LN+++TS WDL +DWS      S NWLLR+DLYLAGKK+WE G YS +RK 
Sbjct: 673 RTPFIVCATLNSILTSAWDLVMDWSFAHNTTSYNWLLRDDLYLAGKKNWENGSYSFSRKL 732

Query: 735 FYYIAMVWDVLIRFQWIVYAIAPQTIQQNAITSFILATTEXXXXXXXXXXXXENEHVANV 794
            YY AM+WD+LIRF+WIVYAIAPQTIQQ+A+TSFILA  E            ENEHVANV
Sbjct: 733 VYYFAMIWDILIRFEWIVYAIAPQTIQQSAVTSFILALLEVLRRFVWIIFRVENEHVANV 792

Query: 795 HLFRVTGNAPLPYPVNVQTIALTKPTFQIGEEERMAENLDQQA---LGNLSFNVSYDENA 851
           HLFRVTG+APLPYP+            Q+G++   + +L  +A   L ++    S+D N 
Sbjct: 793 HLFRVTGDAPLPYPIA-----------QVGDDSMDSSDLGSKAFSSLNDIPITPSHDNNP 841

Query: 852 M-----WPPYXXXXXXXXXXFAEISKSIPWVHATDFQRPT 886
                  P Y          F  IS+SIPW HATDFQRPT
Sbjct: 842 HSFAEPMPAYRGTFRRRSSVFENISRSIPWAHATDFQRPT 881

>Scas_700.25*
          Length = 931

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/849 (48%), Positives = 523/849 (61%), Gaps = 78/849 (9%)

Query: 98  YSPLLIEIIHEFMENWIISIQLTKCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDA 157
           YSP+  +I+ EF+++W+I  QL KCN+FY  L+ND RKK+ IL+NQ+  +NIQ+   ++ 
Sbjct: 82  YSPVKKKIVQEFVKDWLIGEQLNKCNDFYEELINDCRKKYNILENQIRFYNIQRHSIDNK 141

Query: 158 ANS----ISSS---------------------YGSLMTSATSDSVTTS---------LIQ 183
                  +SSS                      G ++T     +V  +           Q
Sbjct: 142 KTRNLLIVSSSESVDVENTPIDSTIQHPYAPNRGRVITLNGQQNVANANKNFASHFLYFQ 201

Query: 184 SIKDTLHAHRLLPSYPQYSLKQLIFNNTTSDTESQPLMERETFNPEDQXXXXXXXXTXXX 243
            +K  L  + +LPS P   +      N         +   E                   
Sbjct: 202 KLKTILKNNNVLPSLPAKGITSYFHQNGRGSQGEGNINASEN--------------DMLS 247

Query: 244 XXXXXXXXXXXXXXILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAK 303
                         ILEFYLFLQL+K+YRDLN+TGFRKI KKFDKT +T E  KFM +AK
Sbjct: 248 EITVEKAQKLLTEAILEFYLFLQLVKTYRDLNLTGFRKIAKKFDKTCETKECLKFMNYAK 307

Query: 304 QNFTIFKHIDPNIKLMTNKMKQISSYQPIIFDELIPSNEIDDPILWWESKVKDWYVNQLT 363
           +N+TIF HIDPNI LMT++MK+ S+YQP++F+++ P NE DDP+LWWESKV+ WY+  LT
Sbjct: 308 ENYTIFSHIDPNIALMTDRMKKTSTYQPLVFEDITPENESDDPLLWWESKVRGWYIKDLT 367

Query: 364 NSPKSMXXXXXXXXXXXXQYSLNEQMVHRNNRAIIQMTIAAWILGISSTSIANTIYLSFM 423
           NS   M            QYSLNE+++HR N +I+QMTI+ + +G + + I  T+YL F 
Sbjct: 368 NSLTEMKRNNDKLRKFGIQYSLNERIIHRINISILQMTISGFFIGAAFSLIIYTLYLIFT 427

Query: 424 SGYTSYTHKILFPIWGGWYMVLLISLLIISNCFIWHKSEINYRFIMFGEIKARSGTQFYN 483
           S   +Y H+ILFP+WGGWYMVLLIS L I NCFIWH+S INYRFIMFGEI+ARSGTQF+N
Sbjct: 428 SDDKAYIHRILFPLWGGWYMVLLISFLFIGNCFIWHRSGINYRFIMFGEIQARSGTQFFN 487

Query: 484 NDFATTRISLNLYFLSFFILPLSICALLSFHNENLFPYAIIYPLIATSLFIAPKAISKYI 543
           NDFATT+ISL  YF+S FIL  SI A++SF  E L P   I+P I  +LF+AP     ++
Sbjct: 488 NDFATTKISLKYYFISLFILACSILAIISFQLEKLTPLGFIFPGIVITLFLAP----SWM 543

Query: 544 LPYWNKLKEIRVWILTTFIRLSLSGLYPVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSD 603
           +P+W+KL E R W+  + IRL  SG YPVEFGDFFLGDI+CSLTYS+SD+AMFFC+Y   
Sbjct: 544 IPFWDKLVETRKWLFCSGIRLIFSGFYPVEFGDFFLGDIVCSLTYSISDLAMFFCVYVRS 603

Query: 604 KPSTTCGSSHSITMGILSCLPNYWRMMQCFRRWADSADWFPHLLNAIKYGLGVAYNGTLC 663
             + TC SSH  +MG+L CLP++WR MQC RR+ADS DWFPHLLNA KY LGVAYN TLC
Sbjct: 604 D-NATCSSSHLRSMGVLGCLPSFWRFMQCLRRFADSGDWFPHLLNAAKYTLGVAYNATLC 662

Query: 664 AYRLSNHERGTTRNTFIIVAALNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDW 723
            YR+S  +   +R  FI+ A LNA  TS+WDL +DWSLLQP  NN  LR+DLYLAGKK+W
Sbjct: 663 VYRIS-PKSFHSRQIFIVFATLNATYTSIWDLVMDWSLLQPSQNNTFLRDDLYLAGKKNW 721

Query: 724 ETGQYSRARKSFYYIAMVWDVLIRFQWIVYAIAPQTIQQNAITSFILATTEXXXXXXXXX 783
           +TG+YS  RKS YY AM+W+V++RF+WIVYAIAPQTIQQ+A TSFILAT E         
Sbjct: 722 KTGKYSNKRKSIYYFAMIWNVIVRFEWIVYAIAPQTIQQSADTSFILATAEVLRRFVWII 781

Query: 784 XXXENEHVANVHLFRVTGNAPLPYPVNVQTIALTKPT------------FQIGEEERMAE 831
              ENEHVANV+LFRV+G APLPYP+N+ +I     +               G +     
Sbjct: 782 FRVENEHVANVNLFRVSGTAPLPYPINITSITPLGSSDSDEATNIIVLESNSGNDNLSVT 841

Query: 832 NLDQQ------------ALGNLSFNVSYDENAMWPPYXXXXXXXXXXFAEISKSIPWVHA 879
           N  QQ            A+ N+            P Y          F  ISKSIPW H 
Sbjct: 842 NEPQQTSNRINRFDTVGAVPNVDITRETRIEEPMPAYHPPLERRTTTFGSISKSIPWAHT 901

Query: 880 TDFQRPTTL 888
           +DFQRP+ +
Sbjct: 902 SDFQRPSIV 910

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 13/15 (86%), Positives = 14/15 (93%)

Query: 1  MKFGDHLRESIIPEW 15
          MKFGDHL ES+IPEW
Sbjct: 1  MKFGDHLNESMIPEW 15

>CAGL0L00737g complement(90349..93084) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1, start by
           similarity
          Length = 911

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/838 (46%), Positives = 502/838 (59%), Gaps = 53/838 (6%)

Query: 98  YSPLLIEIIHEFMENWIISIQLTKCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFND- 156
           Y+   +E I++F+E+W+I  QL KCNEFY WLL+  ++K+ IL  Q+  +   K+ F + 
Sbjct: 57  YNDFQVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQLDCYREHKKEFREI 116

Query: 157 --------AANSISSSYGSLMTSATSDSVTTSLIQ----------SIKDTLHAHRLLPSY 198
                   ++ S+  +YGS+  +   D      +           ++K  L+ H L+PS+
Sbjct: 117 SSRVTYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQMTLKHFLNEHDLMPSW 176

Query: 199 PQY-------SLKQLIFNNTTSDTESQPLMERETFNPEDQXXXXXXXXTXXXXXXXXXXX 251
           P+        +LK    N    +T +         N                        
Sbjct: 177 PKMFIETIPEALKPKSINTKLKETFAYSNKLNLNLNLMRNKDEHGNKILKNPHKELKHAR 236

Query: 252 XXXXXXILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFKH 311
                 +LEFYLFLQL+KSYRD+NV GFRKIVKKFDKT +T EL  FM F + N+TIFKH
Sbjct: 237 ALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCKTQELAGFMRFVRANYTIFKH 296

Query: 312 --IDPNIKLMTNKMK-----QISSYQPIIFDELIP-SNEIDDPILWWESKVKDWYVNQLT 363
             +     +  +K K      I      I D  +  ++   DP+  WE+K+  WY   + 
Sbjct: 297 DAVSTEATIKASKAKTLTDDDIGEDSSTITDTNVSLTSTTIDPLRAWEAKLTKWYTVDVV 356

Query: 364 NSPKSMXXXXXXXXXXXXQYSLNEQMVHRNNRAIIQMTIAAWILGISSTSIANTIYLSFM 423
           NS                QYSLNEQM+HRNNRAI+QMT+     GI+ T IA T+YL+F+
Sbjct: 357 NSLSEKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQMTVFGVFTGIAVTLIAYTLYLAFL 416

Query: 424 SGYTSYTHKILFPIWGGWYMVLLISLLIISNCFIWHKSEINYRFIMFGEIKARSGTQFYN 483
           S   +  HKILFPIWGGWYM+LLISL  + +CFIWH++ INYRFIMFGE++A+SGTQF+N
Sbjct: 417 SPLNTKRHKILFPIWGGWYMILLISLFFLIDCFIWHRTGINYRFIMFGEVQAKSGTQFFN 476

Query: 484 NDFATTRISLNLYFLSFFILPLSICALLSFHNENLFPYAIIYPLIATSLFIAPKAISKYI 543
           NDFATT I L LYFL+FFI+  +I + LSFH ++L PY  IY ++   LFI P      +
Sbjct: 477 NDFATTGIPLRLYFLAFFIISCAIISALSFHFDHLTPYGYIYFIVVGLLFITPYD----L 532

Query: 544 LPYWNKLKEIRVWILTTFIRLSLSGLYPVEFGDFFLGDIICSLTYSMSDIAMFFCIYF-- 601
           +PYW+KL E R +++TT IRL LSGLYPVEF DFFLGDIICSLTY++SD+A+F C Y   
Sbjct: 533 IPYWDKLVETRKFLVTTTIRLVLSGLYPVEFKDFFLGDIICSLTYTLSDLAIFACYYAPK 592

Query: 602 -SDKPSTTCGSSHSITMGILSCLPNYWRMMQCFRRWADSADWFPHLLNAIKYGLGVAYNG 660
               P   CGSSHS  MG+LSCLP++WR MQC RR+ DS DWFPHL NA KY LGVAYN 
Sbjct: 593 TRKDPLGMCGSSHSKAMGVLSCLPSFWRFMQCVRRFFDSNDWFPHLPNAAKYLLGVAYNA 652

Query: 661 TLCAYRLSNHERGTTRNTFIIVAALNALITSVWDLTVDWSLLQPD--SNNWLLRNDLYLA 718
           TLCAYRLSNH     RN FII A LN++ TS+WDL +DWS+LQ    + N  LR DLYLA
Sbjct: 653 TLCAYRLSNHSPA-KRNPFIIFATLNSISTSIWDLVMDWSVLQSSIGNENLFLRKDLYLA 711

Query: 719 GKKDWETGQYSRARKSFYYIAMVWDVLIRFQWIVYAIAPQTIQQNAITSFILATTEXXXX 778
           GK++WETG+Y  +RK+ YYIAMV DV+IRFQWIVYA+APQTIQQ+A+TSF LA TE    
Sbjct: 712 GKRNWETGKYDWSRKAVYYIAMVLDVVIRFQWIVYAVAPQTIQQSAVTSFALAVTEVCRR 771

Query: 779 XXXXXXXXENEHVANVHLFRVTGNAPLPYPVNVQTIALTKPTFQIGEEERMAENLDQ--- 835
                   ENEHVANVHLFRVTG A LPYP         K T  + +++   +  D    
Sbjct: 772 FIWVIFRVENEHVANVHLFRVTGEALLPYPNQDVVDFSGKATTDLYDDQHFQQGRDSIES 831

Query: 836 ---QALGNLSFNVSYDENAMWPP---YXXXXXXXXXXFAEISKSIPWVHATDFQRPTT 887
                L +L  ++S   N    P   Y          F  IS+SIPW HA DFQRP T
Sbjct: 832 SRPSHLHDLDLSLSDINNKFEEPTATYHSIVRRRTAIFDNISRSIPWAHAKDFQRPLT 889

>Kwal_23.5785
          Length = 856

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/798 (43%), Positives = 477/798 (59%), Gaps = 42/798 (5%)

Query: 98  YSPLLIEIIHEFMENWIISIQLTKCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDA 157
           Y+P+    +  F+E W+I  +L KCN+FY W L    ++F +LQ Q+  F   +      
Sbjct: 70  YTPVQQRFVQSFVEKWVIDQELEKCNDFYLWELKRCGRRFAVLQEQIEKFEADQAQ-QSI 128

Query: 158 ANSISSSYGSLMTSATSDSVTTSLIQSIKD----TLHAHRLLPSYPQYSLKQLIFNNTTS 213
           A++ S  YG++    T   +T     +++      +    L+PS+P+ +  + + + +  
Sbjct: 129 ADTDSKYYGAVDRDETIQPITAGKDSTLRSRFFRVVQDLELVPSFPRMAPFKRLLDQSPE 188

Query: 214 DTESQPLMERETFNPEDQXXXXXXXXTXXXXXXXXXXXXXXXXXILEFYLFLQLIKSYRD 273
           D  +  +   ETF P                             ++EFYL LQL+K YR+
Sbjct: 189 DN-NLSVSHGETFAP--------------TTLSTNQIQHRLSDALIEFYLLLQLMKGYRE 233

Query: 274 LNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFKHIDPNIKLMTNKMKQIS--SYQP 331
           +NVTGFRKIVKKFDKT  T EL  F+ +AK  + IF+H + N +++ ++M   +    + 
Sbjct: 234 VNVTGFRKIVKKFDKTCGTRELVPFIEYAKSTYPIFQHAEANARVVAHQMHDSALLGERS 293

Query: 332 IIFDELIPSNEIDDPILWWESKVKDWYVNQLTNSPKSMXXXXXXXXXXXXQYSLNEQMVH 391
               EL     ++DP+L WE +   WY + L++S K              +YSLNEQ VH
Sbjct: 294 SFATEL----NVEDPLLSWEQQTTKWYTDVLSSSSKDRKRKTARLKNLSLEYSLNEQKVH 349

Query: 392 RNNRAIIQMTIAAWILGISSTSIANTIYLSFMSGYTSYTHKILFPIWGGWYMVLLISLLI 451
           R NR+I+QM ++  +LG S   +  T+Y  F++  +S  H +L P+WGGWYMV LI+ L 
Sbjct: 350 RFNRSILQMFVSGVLLGGSLALVGYTLYRGFVASNSSEIHSLLLPLWGGWYMVFLITFLF 409

Query: 452 ISNCFIWHKSEINYRFIMFGEIKARSGTQFYNNDFATTRISLNLYFLSFFILPLSICALL 511
           + NCFIWH+S INYRFIMFGE+ +R G   +NNDF+TT+I +  YF S    P+++ + +
Sbjct: 410 LLNCFIWHRSNINYRFIMFGEMHSRRGAVLFNNDFSTTKIPILFYFASVLAFPMALLSSI 469

Query: 512 SFHNENLFPYAIIYPLIATSLFIAP--KAISKYILPYWNKLKEIRVWILTTFIRLSLSGL 569
           SF+  NL P+AII+  +   LF +P    +    +PYWNKL +   WIL +F+RL  SG 
Sbjct: 470 SFNEVNLNPWAIIWIALVVVLFFSPVLGELPLLSIPYWNKLTKSVRWILVSFVRLIFSGF 529

Query: 570 YPVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSSHSITMGILSCLPNYWRM 629
           YPV+FGDFFLGDI CSLTYS++DIAMFFCIY S  P+  CGSSHS  MG ++CLPN+WR 
Sbjct: 530 YPVQFGDFFLGDIFCSLTYSLADIAMFFCIY-SPTPNGRCGSSHSKAMGAMTCLPNFWRF 588

Query: 630 MQCFRRWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTRNTFIIVAALNALI 689
           MQC RR++DS DWFPHLLN +KY L V Y  +LCAYR+S H R + RN FII A LN + 
Sbjct: 589 MQCLRRFSDSGDWFPHLLNGLKYSLSVVYYASLCAYRIS-HTR-SRRNVFIIFATLNGVC 646

Query: 690 TSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETGQYSRARKSFYYIAMVWDVLIRFQ 749
           TS+WD+ +DWSLLQ  S NWLLR+DLYLAG+K+W+TG YS+ RKS YY+AM+WDV +RFQ
Sbjct: 647 TSIWDIIMDWSLLQSGSRNWLLRDDLYLAGRKNWKTGAYSKRRKSVYYLAMIWDVAMRFQ 706

Query: 750 WIVYAIAPQTIQQNAITSFILATTEXXXXXXXXXXXXENEHVANVHLFRVTGNAPLPYPV 809
           W+VYAIAP TIQQ+AITSFILA  E            ENEHVANVHLF+V+G   LPYP 
Sbjct: 707 WVVYAIAPATIQQSAITSFILAALEVTRRFVWIIFRVENEHVANVHLFKVSGEISLPYPT 766

Query: 810 NVQTIALTKPTFQIGEEERMAENLDQQALGNLSFNVSYDENAMWPPYXXXXXXXXXXFAE 869
            V   + T+ +           + +  A+  +SF        M+                
Sbjct: 767 TVNEESETEASV----------SSNHYAMSEMSFPTMAAPTPMYRGESTQKSTGSNGLLR 816

Query: 870 -ISKSIPWVHATDFQRPT 886
            +S SIPW HA DFQRPT
Sbjct: 817 TLSSSIPWAHAQDFQRPT 834

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 13/15 (86%)

Query: 1  MKFGDHLRESIIPEW 15
          MKF +HLRES +PEW
Sbjct: 1  MKFAEHLRESAVPEW 15

>ADL080W [1661] [Homologous to ScYIL047C (SYG1) - SH]
           complement(542124..544715) [2592 bp, 863 aa]
          Length = 863

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/800 (41%), Positives = 477/800 (59%), Gaps = 60/800 (7%)

Query: 104 EIIHEFMENWIISIQLTKCNEFYNWLLNDSRKKFKILQNQVHLFNIQKRLFNDAANSISS 163
           + ++EF+  W+I  +L KC+EFY W L+   +K+++L+ Q+ ++ +QK   N A  S  +
Sbjct: 63  DAVYEFVMGWVIGTELAKCDEFYQWQLDQCERKYQLLKQQIEMYCLQKDE-NGAGLSYGA 121

Query: 164 SY--------GSLMTSATSDSVTTS-----LIQSIKDTLHAHRLLPSYP-QYSLKQLIFN 209
           +Y         + +++  S S + +       + +K  L    L+PS P ++S +Q    
Sbjct: 122 TYEGQEETGLAAQLSAGRSPSPSRAGRLDRAQEGVKRWLQERDLMPSLPARWSREQGPAR 181

Query: 210 NTTSDTESQPLMERETFNPEDQXXXXXXXXTXXXXXXXXXXXXXXXXXILEFYLFLQLIK 269
                  ++  M      P  +                          +LE+YL LQL+K
Sbjct: 182 VKKYSANTETFMH---ICPSKRQAQLQLGHA-----------------LLEYYLTLQLLK 221

Query: 270 SYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFKHIDPNIKLMTNKMKQISSY 329
           +YRDLNVTGFRKIVKKFDKT  T EL+KFM++A ++  +F+H+  N++L  N  K  +S 
Sbjct: 222 NYRDLNVTGFRKIVKKFDKTCDTEELSKFMSYANEHSPLFEHMGQNLRLYANSFKASNSL 281

Query: 330 -QPIIFDELIPSNEIDDPILWWESKVKDWYVNQLTNSPKSMXXXXXXXXXXXXQYSLNEQ 388
            QP      + S+   DP+ +WE +V  WY   LT S ++             QYS+NEQ
Sbjct: 282 CQPA---ARMNSSPEKDPVTYWEDQVFQWYTEALTESTQARKHHVQKLRSLSLQYSMNEQ 338

Query: 389 MVHRNNRAIIQMTIAAWILGISSTSIANTIYLSFMSGYTSYTHKILFPIWGGWYMVLLIS 448
           +VHRNN  ++QM  A  +LG++   +   + L   +  +SY H ILFP+WGGWY+VLL+S
Sbjct: 339 IVHRNNTCVVQMFTAGSLLGVAVVLVIIALMLGIRADISSYRHLILFPVWGGWYLVLLMS 398

Query: 449 LLIISNCFIWHKSEINYRFIMFGEIKARSGTQFYNNDFATTRISLNLYFLSFFILPLSIC 508
           LL   +C+IW + ++NY+FIMFGEI +R G   +NNDF+TT+IS +LY +S   + +   
Sbjct: 399 LLFCLDCYIWFRGKVNYQFIMFGEIHSRKGNTVFNNDFSTTKISGHLYMVSLAFITVGAV 458

Query: 509 ALLSFHNENLFPYAIIYPLIATSLFIAPKAISKYILPYWNKLKEIRVWILTTFIRLSLSG 568
           +L S     L P+  +  L    LF    ++S +ILPYW +L++ R W++ T IRL  SG
Sbjct: 459 SLCSMVRATLAPWLWLCAL----LFALGFSMSSFILPYWRELRKTRQWLIVTAIRLVFSG 514

Query: 569 LYPVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSSHSITMGILSCLPNYWR 628
            YPV+FGDFFLGDI+CSLTYSM+D+A  FC+ FS +    CGSS+ I+MG+LSC+P+YWR
Sbjct: 515 AYPVQFGDFFLGDIVCSLTYSMADVASVFCV-FSGQKYNMCGSSNLISMGVLSCIPSYWR 573

Query: 629 MMQCFRRWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTRNTFIIVAALNAL 688
           +MQC RR+ DS D FPHLLN  KY + + YN  LCAYR+ N    + R+ FI    +N++
Sbjct: 574 LMQCLRRYLDSNDRFPHLLNGAKYAVAILYNACLCAYRI-NKLHHSYRSWFIAAGIINSV 632

Query: 689 ITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETGQYSRARKSFYYIAMVWDVLIRF 748
            +S+WDL +DWSL Q  S N+LLR+DLYLAGK++W+TGQYS+ RK+ YY++M+ DV IRF
Sbjct: 633 FSSIWDLVMDWSLFQFQSTNFLLRDDLYLAGKRNWQTGQYSKRRKAMYYVSMISDVAIRF 692

Query: 749 QWIVYAIAPQTIQQNAITSFILATTEXXXXXXXXXXXXENEHVANVHLFRVTGNAPLPYP 808
           QWIVYAIAP+ IQQ+A+TSFIL   E            ENEHVANVHLF++TG  PLPYP
Sbjct: 693 QWIVYAIAPRVIQQSAVTSFILGILEVVRRFIWIIFRVENEHVANVHLFKITGETPLPYP 752

Query: 809 VNVQTIALTKPTFQIGEEERMAENLDQQALGNLSFNVSYDENAMWPPYXXXXXXXXXXFA 868
           ++  + AL+  T             D+ AL   S   S+++  ++              A
Sbjct: 753 IS-PSRALSTSTVH-----------DKHALP--STKNSHEDLVLYASVRHPEVLHMRHRA 798

Query: 869 -EISKSIPWVHATDFQRPTT 887
             I  +IPW HA DFQRP+T
Sbjct: 799 PSILSNIPWAHAKDFQRPST 818

>KLLA0F27467g complement(2541110..2543644) similar to sp|P40528
           Saccharomyces cerevisiae YIL047c SYG1 member of the
           major facilitator superfamily singleton, start by
           similarity
          Length = 844

 Score =  504 bits (1298), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 311/804 (38%), Positives = 438/804 (54%), Gaps = 52/804 (6%)

Query: 105 IIHEFMENWIISIQLTKCNEFYNWLLNDSRKKFKILQNQVHLFNIQ--KRLFNDAANS-- 160
           I+ EF+++W++  QL  C+EFY W L+  R K+  LQ Q+HL+ ++  KR   D+ +   
Sbjct: 48  IVREFIDDWLVRDQLKNCDEFYEWQLSKYRAKYHKLQRQIHLYVLEADKRSRLDSLDEYR 107

Query: 161 ISS------SYGSLMTS----ATSDSVTTSLIQSIKDTLHAHRLLPSYPQYSLKQLIFNN 210
           I+S      SYGS+  +    A  D+V   +   +K  L  H L PS P           
Sbjct: 108 IASLSRAPDSYGSIFPNFSPIALKDTVKKKIWYDLKRWLVTHNLCPSMP----------- 156

Query: 211 TTSDTESQPLMERETFNPEDQXXXXXXXXTXXXXXXXXXXXXXXXXXILEFYLFLQLIKS 270
             S     PL+ ++  + +          T                 IL+FYL+LQL+K+
Sbjct: 157 -VSWKNRDPLLAKK--DRKRASRGQETFQTETSPLSLSQIRQQLSDAILDFYLYLQLLKN 213

Query: 271 YRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFKHIDPNIKLMTNKMKQISSYQ 330
           YRDLNV GFRKIVKKFDK    ++L  FM +AK+   +F   D  +KL+ + ++      
Sbjct: 214 YRDLNVNGFRKIVKKFDKVLHQDQLKTFMPYAKKYSIMFSQYDEYLKLIKDNVEHAEVIN 273

Query: 331 PIIFDELIPSNEID----DPILWWESKVKDWYVNQLTNSPKSMXXXXXXXXXXXXQYSLN 386
             +F  L   N++D    DP+ +WE     WY   LT+S K              QYS+N
Sbjct: 274 VNLF--LGSDNDVDRLKKDPLTFWEQTAIKWYTMTLTSSSKDKKHNLERIKNLSLQYSVN 331

Query: 387 EQMVHRNNRAIIQMTIAAWILGISST-SIANTIYLSFMSGYTSYTHKILFPIWGGWYMVL 445
           EQ +HRNN ++ QM + +  LGIS T  I  TI L+     +      L PIW  ++ + 
Sbjct: 332 EQTIHRNNASMFQMFLGSAQLGISVTLVILMTIILA--KNSSDEVRSALLPIWSSFHYLT 389

Query: 446 LISLLIISNCFIWHKSEINYRFIMFGEIKARSGTQFYNNDFATTRISLNLYFLSFFILPL 505
            + LL I +CFIW+K +INYRFIMFGEI +R+G   +NNDF  T I L  +  + F+   
Sbjct: 390 FMGLLFIIDCFIWYKVKINYRFIMFGEIHSRNGPVLFNNDFGMTHIPLQFFHATTFLCIC 449

Query: 506 SICALLSFHNENLFPYAIIYPLIATSLFIAP-KAISKYILPYWNKLKEIRVWILTTFIRL 564
           SI A  S   E L P+ I +  IA +LF    + I  +  PYW +  + R +I T+FIRL
Sbjct: 450 SILAFCSLMLEKLEPWMITWLCIAVALFFWKFQVIQPW--PYWYETFQSRKYIFTSFIRL 507

Query: 565 SLSGLYPVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSSHSITMGILSCLP 624
             SG +PV+FGDFFLGDI+CSLTYSMS  A   C+ F+D     C     + +GILSCLP
Sbjct: 508 VFSGFFPVQFGDFFLGDIVCSLTYSMSQFATLGCLTFNDSKEDKCRYEKLMWIGILSCLP 567

Query: 625 NYWRMMQCFRRWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTRNTFIIVAA 684
           +YWR +QC RR+ DS DWFPHLLNA KY LG+++N +L  Y+ S  +    +   I+   
Sbjct: 568 SYWRFVQCVRRYFDSYDWFPHLLNAFKYLLGISFNASLYWYK-SWPQMQKFKVLLIVFGC 626

Query: 685 LNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETGQYSRARKSFYYIAMVWDV 744
           LN+ +TS+WDL +DWSLLQ  S N+LLR+DLYL GKK+W++G+YS  +K  YY  MV+DV
Sbjct: 627 LNSTLTSIWDLIMDWSLLQTKSKNFLLRDDLYLCGKKNWKSGKYSSKKKCIYYFIMVFDV 686

Query: 745 LIRFQWIVYAIAPQT-IQQNAITSFILATTEXXXXXXXXXXXXENEHVANVHLFRVT-GN 802
           ++R++W+ Y +   T   ++ + +  +AT E            ENEHVANVHLF+VT  N
Sbjct: 687 VVRYEWVFYMVKNNTDYVRHPLIALAMATLEILRRFVWVILRVENEHVANVHLFKVTDDN 746

Query: 803 APLPYPVNVQTIALTKPTFQIGEE-ERMAENLDQQALGNLSFNVSYDENAMWPPYXXXXX 861
             LP+P       +      + E+    AEN+D  A+  LS   S  E+    P      
Sbjct: 747 WQLPFP------TIEDSELHMEEDYSAAAENMDNIAM--LSVMKSDLESQQQRPRSTSAV 798

Query: 862 XXXXXFAEISKSIPWVHATDFQRP 885
                 A + + IPW HATDFQRP
Sbjct: 799 PKLNRKASVFEIIPWAHATDFQRP 822

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 11/15 (73%), Positives = 14/15 (93%)

Query: 1  MKFGDHLRESIIPEW 15
          MKF +HLRES++PEW
Sbjct: 1  MKFAEHLRESVVPEW 15

>Kwal_47.18721
          Length = 383

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 85/218 (38%), Gaps = 29/218 (13%)

Query: 571 PVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSSHSITMG-------ILSCL 623
           P+      + D + S +  + D   + C    D  S  C  S +  MG       ++   
Sbjct: 154 PLRNNYILISDSLTSYSKPLIDFGFYLCHLVVDPISENCIISRT-AMGSAINLDLMIGTA 212

Query: 624 PNYWRMMQCFRRWADS---ADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTRNTFI 680
           P   R++QC R W  S    D    + NA+KY L +     +CA    +       N   
Sbjct: 213 PVIIRLLQCLREWRRSRTLGDARSSIFNALKYSLHLPI--VMCAVYSRSFPDVKPGNYVY 270

Query: 681 IVAALNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETGQYSRARKSF----Y 736
               LN+  +  WDLT+DW+L             ++  G+      +  RAR+ F    Y
Sbjct: 271 WFMLLNSFYSFWWDLTMDWNL------------GVFNFGRSGMGRNEVLRARRHFPSYMY 318

Query: 737 YIAMVWDVLIRFQWIVYAIAPQTIQQNAITSFILATTE 774
           ++AM  D  +RF W+   +A ++  +     F L   E
Sbjct: 319 FLAMSADFTLRFMWLWELLAGRSAFEGEANIFFLQILE 356

>Sklu_2440.13 YDR414C, Contig c2440 19959-21104 reverse complement
          Length = 381

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/195 (24%), Positives = 80/195 (41%), Gaps = 29/195 (14%)

Query: 571 PVEFGDFFLGDIICSLTYSMSDIAMFFCIYFSDKPSTTC-------GSSHSITMGILSCL 623
           P+      + D + S    M D  ++ C   ++   T C       G S ++ + ++   
Sbjct: 150 PLRTNYILISDTLTSYGKPMIDYGLYLCQLLTNPVGTDCIIRKDPLGISLNLDL-MIGIT 208

Query: 624 PNYWRMMQCFR---RWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTRNTFI 680
           P   R++QC R   R   SAD    L NA+KY             R    E  +    ++
Sbjct: 209 PATIRLIQCLREYKRSTSSADARAALFNALKYSCQFPILVYTVVTRAYPGETPSANIYWL 268

Query: 681 IVAALNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETGQYSRARKSF----Y 736
           ++  LN++ T  WDLT+DW     +  N         +G K     + SRA++ F     
Sbjct: 269 LL--LNSMYTFWWDLTMDWKFGFFNFTN---------SGMK---LNEVSRAQRHFSIKTC 314

Query: 737 YIAMVWDVLIRFQWI 751
           Y A+  D ++RF W+
Sbjct: 315 YCAIFVDFILRFAWL 329

>ADR289C [2030] [Homologous to ScYNR013C (PHO91) - SH]
           (1193040..1195463) [2424 bp, 807 aa]
          Length = 807

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 262 YLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFM 299
           Y  L  +KSY +LN TGF KI KKFDK+ +TN    +M
Sbjct: 180 YTRLAELKSYFELNHTGFSKICKKFDKSLETNIRGNYM 217

>Kwal_23.6129
          Length = 816

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 262 YLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIF 309
           Y  L  +KS+ +LN TGF KI KKFDK+   N  +++MA       +F
Sbjct: 182 YTQLSELKSFIELNQTGFSKICKKFDKSLDANIKSEYMAKLSSRVRVF 229

>Scas_625.16
          Length = 932

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFK 310
           ++  Y  L  +K + +LN TGF KI KKFDK+  T+  + ++   K+  ++FK
Sbjct: 281 LVAIYTQLSELKEFIELNQTGFSKICKKFDKSLNTSIKSSYLETIKKKSSVFK 333

>CAGL0F02871g complement(278122..279228) similar to sp|P16151
           Saccharomyces cerevisiae YDR414c ERD1 required for
           retention of luminal ER proteins, hypothetical start
          Length = 368

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 66/154 (42%), Gaps = 23/154 (14%)

Query: 620 LSCLPNYWRMMQCFRRWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTR--N 677
           L+ +P   R+ QC + +  + + F  L NA+KY   +     L   R+   +  T R  N
Sbjct: 193 LAVIPPLIRLCQCLKEYKTTKE-FTLLANALKYSCHLPVVLCLWYSRVYGDDSLTIRDYN 251

Query: 678 TFIIVAALNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETGQYSRAR--KSF 735
              ++  + +  + +WD+  DW++    S  +                 Q SR    K +
Sbjct: 252 ILKVMMFIQSTYSYIWDVRKDWTITSISSIRY-----------------QKSRVLFPKFY 294

Query: 736 YYIAMVWDVLIRFQWI-VYAIAPQTIQQNAITSF 768
           Y+IA+V D ++R+ W+ +  +AP  +       F
Sbjct: 295 YHIAIVMDGIMRYWWLWIIILAPYDVSGKPTALF 328

>YNR013C (PHO91) [4596] chr14 complement(649027..651711) Member of
           the phosphate permease family of membrane transporters,
           has similarity to Pho87p and Pho90p [2685 bp, 894 aa]
          Length = 894

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIF 309
           ++  Y  L  +K + +LN TGF KI KKFDK+  TN    ++ + K +  +F
Sbjct: 214 LISIYTQLSELKDFIELNQTGFSKICKKFDKSLNTNLKQNYLNYIKFHSHVF 265

>AFR628C [3820] [Homologous to ScYJL198W (PHO90) - SH; ScYCR037C
           (PHO87) - SH] (1576713..1579322) [2610 bp, 869 aa]
          Length = 869

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTF 290
           I++ Y+ L  +KSY +LN  GF KI KKFDKT 
Sbjct: 237 IIDLYVELSQLKSYIELNRIGFFKITKKFDKTL 269

>Kwal_33.13618
          Length = 891

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTN 293
           +++ Y+ L  +KS+ +LN  GF KI KKFDKT   N
Sbjct: 259 LVDLYVDLAQLKSFIELNRIGFLKITKKFDKTLDCN 294

>KLLA0C03454g 311611..314313 similar to sp|P25360 Saccharomyces
           cerevisiae YCR037c PHO87 member of the phosphate
           permease family, start by similarity
          Length = 900

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 38/79 (48%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMAFAKQNFTIFKHIDPNIK 317
           +++ Y+ L  +KS+ +LN  GF KI KKFDK    +     +   +        +   I 
Sbjct: 267 VIDLYVDLAQLKSFIELNRIGFSKISKKFDKVLSCSIKRDLIESGEFFHDAHIFLPDTIT 326

Query: 318 LMTNKMKQISSYQPIIFDE 336
            + NK+  + SY  +I D+
Sbjct: 327 ELDNKISHLISYYAVITDQ 345

>KLLA0F06160g 598549..601128 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 859

 Score = 36.6 bits (83), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFM-AFAKQNFTIFKHIDPNI 316
           I+  +  L  +KS+ +LN TGF KI KKFDK+  +N    ++ + +K++    +H   N+
Sbjct: 215 IVACFTQLSELKSFIELNQTGFAKICKKFDKSLDSNIKTDYLKSLSKKSHVFNEHTIENL 274

>AAR127C [314] [Homologous to ScYDR414C (ERD1) - SH]
           (568957..570102) [1146 bp, 381 aa]
          Length = 381

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 56/269 (20%), Positives = 104/269 (38%), Gaps = 60/269 (22%)

Query: 523 IIYPLIATSLFIAPKAISKYILPYWNKLKE---------IRVWIL--------TTFIRLS 565
           I+ P+   + ++A +A     LP+W  L             VW++            R+ 
Sbjct: 87  IVVPMYIGASYVAYRAALGAELPWWQVLAANTAALVQLAALVWVILRSSRMVRRCVARML 146

Query: 566 LSGLY---PVEFGDFFLGDIICSLTYSMSDIAMFFCIYFS----------DKPSTTCGSS 612
           L G     P+      L D + S    + D   +  + F           D PS    ++
Sbjct: 147 LGGGIEGKPLRTNYILLADTLTSYGKPLMDFTAYLVLLFRTPLADPLAVRDLPSN---AA 203

Query: 613 HSITMGILSCLPNYWRMMQCFRRWADSAD-WFPH---LLNAIKYG--LGVAYNGTLCAYR 666
             I + ++  +P+  R++QC R +    D W      L NA+KY   L +  +  L    
Sbjct: 204 LHIDL-VVGAIPSVIRLVQCLREYRRKEDAWAARRASLFNALKYSSQLPILVHALLSRSG 262

Query: 667 LSNHERGTTRNTFIIVAALNALITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETG 726
            ++  +   R   +    LN++ +  WD+T+DW L             L+       E  
Sbjct: 263 AAHGGQRWVRWAML----LNSVYSFWWDVTMDWKL------------GLFNFSSAGMERD 306

Query: 727 QYSRARK----SFYYIAMVWDVLIRFQWI 751
           +  R R+     +YY A+++D +++F W+
Sbjct: 307 EVLRHRRLYSVKYYYGAVLYDFVMKFMWL 335

>CAGL0I05632g 531308..533968 similar to sp|P27514 Saccharomyces
           cerevisiae YNR013c, start by similarity
          Length = 886

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 20/31 (64%)

Query: 262 YLFLQLIKSYRDLNVTGFRKIVKKFDKTFQT 292
           Y  L  +K + DLN TGF KI KKFDK+  T
Sbjct: 217 YTQLSELKDFIDLNKTGFTKICKKFDKSLDT 247

>YCR037C (PHO87) [571] chr3 complement(194409..197180) Member of the
           phosphate permease family of membrane transporters,
           appears to play a supporting role in phosphate uptake
           under high phosphate growth conditions [2772 bp, 923 aa]
          Length = 923

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTN---ELNKFMAFAKQNFTIFKHIDP 314
           I+  Y+ L  +KS+ +LN  GF KI KK DK    N   EL +   F K  + IF+H   
Sbjct: 292 IINLYIDLCQLKSFIELNRMGFSKITKKSDKVLHMNTRQELIESEEFFKDTY-IFQH--E 348

Query: 315 NIKLMTNKMKQISSYQPIIFDELIPSNEIDDPILWWESKVKDWYVNQLTNSPKSM 369
            +  + +K+ Q+  +  ++  +  P N +D      +S + D  V + +N+ K M
Sbjct: 349 TLSSLNSKIAQLIEFYAVLMGQ--PGN-VDSCKQELKSYLHDHIVWERSNTWKDM 400

>KLLA0A02057g 186220..187374 gi|1169545|sp|P41771|ERD1_KLULA
           Kluyveromyces lactis ERD1 PROTEIN, start by similarity
          Length = 384

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 86/225 (38%), Gaps = 14/225 (6%)

Query: 579 LGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSS---HSITMGI---LSCLPNYWRMMQC 632
           + D + S +  + D+A++    F D  +  C      ++I++ I   +  LP+  RM+Q 
Sbjct: 154 ISDTLTSYSKPLVDLAIYATFLFHDPTNVKCQVERYENAISLNIDVLVGVLPSLVRMIQS 213

Query: 633 FR---RWADSADWFPHLLNAIKYGLGVAYNGTLCAYRLSNHERGTTRNTFIIVAALNALI 689
            R   R          L NA KY   +         R  N         F+     N+  
Sbjct: 214 LREFTRGRSQKKDGSQLFNAFKYAGNIPIMLVTVYTRYYNLGPLGMMYWFMF---WNSAY 270

Query: 690 TSVWDLTVDWSLLQPD-SNNWLLRNDLYLAGKKDWETGQYSRARK-SFYYIAMVWDVLIR 747
           +  WD+T+DW L   D  N     N+   + K D         RK ++YY AM  D ++R
Sbjct: 271 SFWWDVTMDWKLELFDFVNGDTSVNNNNSSNKADGLLRSILLYRKNAWYYSAMALDFILR 330

Query: 748 FQWIVYAIAPQTIQQNAITSFILATTEXXXXXXXXXXXXENEHVA 792
           F W    I+  ++    +  F L   E            E E++A
Sbjct: 331 FVWFWEYISGHSVFYGELNIFWLQILEIIRRWIWLFFKVEVEYIA 375

>YDR414C (ERD1) [1239] chr4 complement(1295586..1296674) Protein
           required for retention of luminal ER proteins [1089 bp,
           362 aa]
          Length = 362

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 76/183 (41%), Gaps = 41/183 (22%)

Query: 579 LGDIICSLTYSMSDIAMFFCIYFSDKPSTTCGSSHSITMGILSCLPNYWRMMQCFRRWAD 638
           + D + S    + D  +F  + F + P T    S       ++ LP   R++QC R +  
Sbjct: 160 ISDTLTSFGKPLIDFTLFTSLIFRE-PFTHFDLS-------VALLPVLVRLLQCLREYRL 211

Query: 639 SADWFPHLLNAIKYGLGV----------AYNGTLCAYRLSNHERGTTRNTFIIVAALNAL 688
             +    L NA+KY   +           Y G++   RL + +R      F+++   N+ 
Sbjct: 212 LHE-ATLLFNALKYSCNLPILFCTWRSRVYEGSINEERLHHVQRW-----FMLI---NSS 262

Query: 689 ITSVWDLTVDWSLLQPDSNNWLLRNDLYLAGKKDWETGQYSRARKSFYYIAMVWDVLIRF 748
            T  WD+ +DWSL    S    LR+           +      +K  Y+ A++ D L+RF
Sbjct: 263 YTLFWDVRMDWSLDSLTS----LRS----------RSKSAVTLKKKMYHSAILVDFLLRF 308

Query: 749 QWI 751
            W+
Sbjct: 309 WWL 311

>YJL198W (PHO90) [2728] chr10 (60843..63488) Phosphate transporter,
           low affinity, has strong similarity to Pho87p and
           Ynr013p, member of the phosphate permease family of
           membrane transporters [2646 bp, 881 aa]
          Length = 881

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTN---ELNKFMAFAKQNFTIFKHIDP 314
           I+  Y+ L  +KS+ +LN  GF KI KK DK    N   EL +   F K  +        
Sbjct: 246 IVNLYIDLCQLKSFIELNRIGFAKITKKSDKVLHLNTRTELIESEQFFKDTYAFQAE--- 302

Query: 315 NIKLMTNKMKQISSYQPIIFDE 336
            I+L+ +K+ Q+ ++   I D 
Sbjct: 303 TIELLNSKISQLVTFYARITDR 324

>Scas_689.1
          Length = 691

 Score = 33.9 bits (76), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 46/87 (52%), Gaps = 8/87 (9%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTN---ELNKFMAFAKQNFTIFKHIDP 314
           I+  ++ L  +KS+ +LN  GF KI KK DK    +   EL +  +F +  + IFK    
Sbjct: 49  IVNLFIDLSQLKSFIELNKMGFSKITKKGDKVLHLHTRTELIESNSFYEDTY-IFKQ--E 105

Query: 315 NIKLMTNKMKQISSYQPIIFDELIPSN 341
            + ++ +K+ Q+  +  II  +  PSN
Sbjct: 106 TLDILNSKISQLIKFYAIIKGQ--PSN 130

>Scas_634.15
          Length = 916

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 41/79 (51%), Gaps = 6/79 (7%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTN---ELNKFMAFAKQNFTIFKHIDP 314
           I   Y+ L  +KS+ +LN  GF KI KK DK    N   E+ +   F K  + IF+  D 
Sbjct: 281 ITNLYIDLCQLKSFIELNRLGFNKITKKCDKVLHLNIRDEMIQTEEFFKDTY-IFQK-DT 338

Query: 315 NIKLMTNKMKQISSYQPII 333
            +KL + K+ Q+  +  II
Sbjct: 339 TLKL-SKKITQLVEFYAII 356

>CAGL0F02387g complement(229207..232065) similar to sp|P25360
           Saccharomyces cerevisiae YCR037c PHO87 or sp|P39535
           Saccharomyces cerevisiae YJL198w, start by similarity
          Length = 952

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 6/79 (7%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTN---ELNKFMAFAKQNFTIFKHIDP 314
           I+  Y+ L  +KS+ +LN  GF KI KK DK    N   EL     F K  + +F+  D 
Sbjct: 314 IINLYVDLCQLKSFIELNRMGFSKITKKSDKVLLLNTREELIHSGEFFKDTY-VFQ--DS 370

Query: 315 NIKLMTNKMKQISSYQPII 333
            + ++  K+ Q+  +  +I
Sbjct: 371 TLMILNGKIAQLVEFYAMI 389

>CAGL0L06622g complement(743602..747015) similar to sp|P17442
           Saccharomyces cerevisiae YGR233c PHO81 cyclin-dependent
           kinase inhibitor, start by similarity
          Length = 1137

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 28/43 (65%)

Query: 258 ILEFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMA 300
           I +F   ++ ++ Y +LN TGF K++KK+DK   +NE   ++A
Sbjct: 131 IKKFLKDVRNLEQYVELNRTGFAKVLKKWDKRSHSNEKEFYLA 173

>YER094C (PUP3) [1527] chr5 complement(348725..349342) Proteasome
           subunit beta3_sc [618 bp, 205 aa]
          Length = 205

 Score = 30.4 bits (67), Expect = 5.4,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 549 KLKEIRVWILTTFIRLSLSGLYPVEFGDFFLGDIICSL 586
           KLKE R     TF +L  S LY   FG +F+G ++  +
Sbjct: 75  KLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGI 112

>Scas_609.11
          Length = 205

 Score = 29.6 bits (65), Expect = 7.6,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 549 KLKEIRVWILTTFIRLSLSGLYPVEFGDFFLGDIICSL 586
           KLKE R     TFI+L  + LY   FG +F+G ++  +
Sbjct: 75  KLKEDRPIEPDTFIQLVSTTLYEKRFGPYFVGPVVAGI 112

>YGR233C (PHO81) [2181] chr7 complement(954675..958211)
           Cyclin-dependent kinase (CDK) inhibitor for
           Pho80p-Pho85p cyclin-dependent protein kinase complex,
           positive regulator of phosphate pathway [3537 bp, 1178
           aa]
          Length = 1178

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 28/41 (68%)

Query: 260 EFYLFLQLIKSYRDLNVTGFRKIVKKFDKTFQTNELNKFMA 300
           +F   L+ ++ Y +LN TGF K +KK+DK  Q+++ + ++A
Sbjct: 129 KFQKDLRNLEQYVELNKTGFSKALKKWDKRSQSHDKDFYLA 169

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.136    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 25,994,072
Number of extensions: 1043037
Number of successful extensions: 3858
Number of sequences better than 10.0: 38
Number of HSP's gapped: 3923
Number of HSP's successfully gapped: 49
Length of query: 916
Length of database: 16,596,109
Length adjustment: 111
Effective length of query: 805
Effective length of database: 12,753,511
Effective search space: 10266576355
Effective search space used: 10266576355
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 66 (30.0 bits)