Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.381161116160860.0
YIL048W (NEO1)1151116747360.0
Sklu_2193.11143117045350.0
CAGL0L00715g1144116144790.0
Kwal_23.57891133116442200.0
KLLA0C08393g1148118441830.0
ADL079C1166115141230.0
Scas_89.127125712181e-159
KLLA0A04015g1343105811301e-133
CAGL0G06270g1328106511221e-132
Kwal_26.70701315107811071e-130
YAL026C (DRS2)1355106510831e-127
ADR350W1311106710401e-121
CAGL0L11814g15768658795e-98
Scas_576.815919458681e-96
YER166W (DNF1)15718948672e-96
AGR120C154710288564e-95
Scas_636.16155410278556e-95
CAGL0G08085g15788898503e-94
YDR093W (DNF2)16128838479e-94
KLLA0C17644g15768718461e-93
CAGL0H04477g16264735373e-55
KLLA0E01650g15503665231e-53
AFL191W15754265113e-52
Kwal_23.355615974335114e-52
YMR162C (DNF3)16564635008e-51
Scas_669.316384624722e-47
Scas_505.410253483532e-33
KLLA0A08910g12807692405e-20
YDR039C (ENA2)10917952396e-20
YDR038C (ENA5)10917952397e-20
CAGL0K12034g10877902342e-19
YDR040C (ENA1)10917732315e-19
Kwal_23.316011008122307e-19
AFR567W14497122291e-18
KLLA0B08217g14397022244e-18
Scas_665.3014397502154e-17
CAGL0A00517g11227732155e-17
AFL011W12427952146e-17
Scas_707.48*7416922055e-16
Kwal_14.14989397972056e-16
CAGL0I04312g9516872002e-15
YGL167C (PMR1)9506911975e-15
KLLA0F20658g10824921941e-14
YOR291W14725301923e-14
AEL301W9576921894e-14
AGL097C10967641861e-13
CAGL0M11308g14525251852e-13
Kwal_26.920714695561842e-13
KLLA0A03157g9387001814e-13
KLLA0E14630g10825071797e-13
CAGL0J01870g9467471715e-12
Kwal_47.1754712403581726e-12
YGL006W (PMC1)11733541709e-12
YGL008C (PMA1)9181571224e-06
AFR354C12102841215e-06
Scas_583.14*8753001101e-04
AGL085C9091511101e-04
YPL036W (PMA2)9471451082e-04
KLLA0E22352g12062891072e-04
CAGL0L01419g12144261045e-04
YEL031W (SPF1)1215424970.003
KLLA0A09031g899319960.004
Scas_688.1913315950.005
KLLA0F07447g97590940.008
Kwal_47.17522899157940.008
Scas_297.1800193910.014
Scas_227.0d30780890.018
CAGL0A00495g902151900.024
Scas_710.41904270880.034
AGL041C123387880.039
Scas_569.0d468124830.12
KLLA0D04092g115241840.12
CAGL0M08602g101283810.28
AER067C128295800.39
YBR295W (PCA1)121644732.3
Kwal_55.2157598948732.4
YDR270W (CCC2)100452722.6
Scas_657.21*73756704.4
Scas_615.9942112688.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.38
         (1161 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.38                                                          2348   0.0  
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...  1828   0.0  
Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement        1751   0.0  
CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomy...  1729   0.0  
Kwal_23.5789                                                         1630   0.0  
KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharo...  1615   0.0  
ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..54...  1592   0.0  
Scas_89.1                                                             473   e-159
KLLA0A04015g complement(355624..359655) similar to sp|P39524 Sac...   439   e-133
CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharo...   436   e-132
Kwal_26.7070                                                          431   e-130
YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spann...   421   e-127
ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH] complement(...   405   e-121
CAGL0L11814g 1262124..1266854 highly similar to sp|P32660 Saccha...   343   5e-98
Scas_576.8                                                            338   1e-96
YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloac...   338   2e-96
AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (...   334   4e-95
Scas_636.16                                                           333   6e-95
CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharo...   332   3e-94
YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloaci...   330   9e-94
KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces...   330   1e-93
CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces c...   211   3e-55
KLLA0E01650g complement(155975..160627) similar to sp|Q12674 Sac...   206   1e-53
AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH] complement(...   201   3e-52
Kwal_23.3556                                                          201   4e-52
YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of...   197   8e-51
Scas_669.3                                                            186   2e-47
Scas_505.4                                                            140   2e-33
KLLA0A08910g complement(779526..783368) similar to sp|P38929 Sac...    97   5e-20
YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of t...    97   6e-20
YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of t...    97   7e-20
CAGL0K12034g complement(1161299..1164562) highly similar to sp|P...    95   2e-19
YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPa...    94   5e-19
Kwal_23.3160                                                           93   7e-19
AFR567W [3759] [Homologous to ScYOR291W - SH] complement(1455295...    93   1e-18
KLLA0B08217g complement(724364..728683) similar to sp|Q12697 Sac...    91   4e-18
Scas_665.30                                                            87   4e-17
CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces cer...    87   5e-17
AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH] complement(...    87   6e-17
Scas_707.48*                                                           84   5e-16
Kwal_14.1498                                                           84   6e-16
CAGL0I04312g complement(382354..385209) highly similar to sp|P13...    82   2e-15
YGL167C (PMR1) [1823] chr7 complement(187620..190472) Ca2+-trans...    80   5e-15
KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces...    79   1e-14
YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the ca...    79   3e-14
AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH] complement(...    77   4e-14
AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH] (520915.....    76   1e-13
CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces...    76   2e-13
Kwal_26.9207                                                           75   2e-13
KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476....    74   4e-13
KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896 S...    74   7e-13
CAGL0J01870g 181666..184506 highly similar to sp|P13586 Saccharo...    70   5e-12
Kwal_47.17547                                                          71   6e-12
YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar Ca2+-transp...    70   9e-12
YGL008C (PMA1) [1965] chr7 complement(479913..482669) H+-transpo...    52   4e-06
AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH] (1078275..1...    51   5e-06
Scas_583.14*                                                           47   1e-04
AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W (...    47   1e-04
YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting P...    46   2e-04
KLLA0E22352g 1984522..1988142 highly similar to sp|P39986 Saccha...    46   2e-04
CAGL0L01419g 156123..159767 highly similar to sp|P39986 Saccharo...    45   5e-04
YEL031W (SPF1) [1394] chr5 (90258..93905) Putative Ca2+-transpor...    42   0.003
KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA Kluy...    42   0.004
Scas_688.1                                                             41   0.005
KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces c...    41   0.008
Kwal_47.17522                                                          41   0.008
Scas_297.1                                                             40   0.014
Scas_227.0d                                                            39   0.018
CAGL0A00495g complement(55014..57722) highly similar to sp|P0503...    39   0.024
Scas_710.41                                                            39   0.034
AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) ...    39   0.039
Scas_569.0d                                                            37   0.12 
KLLA0D04092g complement(344666..348124) some similarities with s...    37   0.12 
CAGL0M08602g complement(856349..859387) similar to sp|P38995 Sac...    36   0.28 
AER067C [2572] [Homologous to ScYLR398C (SKI2) - SH] (757163..76...    35   0.39 
YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transpo...    33   2.3  
Kwal_55.21575                                                          33   2.4  
YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transportin...    32   2.6  
Scas_657.21*                                                           32   4.4  
Scas_615.9                                                             31   8.5  

>Scas_704.38
          Length = 1161

 Score = 2348 bits (6086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1134/1161 (97%), Positives = 1134/1161 (97%)

Query: 1    MPFSPSLNPDRQKSNSIGPRNSADSFDLQFEDSFDAVLDNIELNTDTRXXXXXXXXXXXX 60
            MPFSPSLNPDRQKSNSIGPRNSADSFDLQFEDSFDAVLDNIELNTDTR            
Sbjct: 1    MPFSPSLNPDRQKSNSIGPRNSADSFDLQFEDSFDAVLDNIELNTDTRNQNNTLPNNQNI 60

Query: 61   XKASSENKDKLQESFEMKSLNARNGGLGHSRNSSNGDRQPLMHDSASNPDGSPYKYTNVS 120
             KASSENKDKLQESFEMKSLNARNGGLGHSRNSSNGDRQPLMHDSASNPDGSPYKYTNVS
Sbjct: 61   NKASSENKDKLQESFEMKSLNARNGGLGHSRNSSNGDRQPLMHDSASNPDGSPYKYTNVS 120

Query: 121  ESALNLHSNNRFSNWITKLKMVGAQKWKKFHTMGSVELDDRHMEREIHPSTTPVYDRNRY 180
            ESALNLHSNNRFSNWITKLKMVGAQKWKKFHTMGSVELDDRHMEREIHPSTTPVYDRNRY
Sbjct: 121  ESALNLHSNNRFSNWITKLKMVGAQKWKKFHTMGSVELDDRHMEREIHPSTTPVYDRNRY 180

Query: 181  PGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFVL 240
            PGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFVL
Sbjct: 181  PGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFVL 240

Query: 241  TVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVL 300
            TVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVL
Sbjct: 241  TVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVL 300

Query: 301  LQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLG 360
            LQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLG
Sbjct: 301  LQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLG 360

Query: 361  KVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELE 420
            KVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELE
Sbjct: 361  KVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELE 420

Query: 421  INSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVY 480
            INSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVY
Sbjct: 421  INSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVY 480

Query: 481  AHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL 540
            AHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL
Sbjct: 481  AHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL 540

Query: 541  DIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTY 600
            DIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTY
Sbjct: 541  DIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTY 600

Query: 601  QAASPDEIAIVKFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGII 660
            QAASPDEIAIVKFTESVGLSLFKRDR              TYEILQVFPFNSDSKRMGII
Sbjct: 601  QAASPDEIAIVKFTESVGLSLFKRDRHSISLLHGHSGSILTYEILQVFPFNSDSKRMGII 660

Query: 661  VHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQF 720
            VHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQF
Sbjct: 661  VHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQF 720

Query: 721  KKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKI 780
            KKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKI
Sbjct: 721  KKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKI 780

Query: 781  WMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGES 840
            WMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGES
Sbjct: 781  WMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGES 840

Query: 841  LGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMI 900
            LGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMI
Sbjct: 841  LGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMI 900

Query: 901  QCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVI 960
            QCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVI
Sbjct: 901  QCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVI 960

Query: 961  AICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYPELYKDL 1020
            AICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYPELYKDL
Sbjct: 961  AICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYPELYKDL 1020

Query: 1021 TEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALILNELIMVA 1080
            TEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALILNELIMVA
Sbjct: 1021 TEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALILNELIMVA 1080

Query: 1081 LEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVSVFPVWAA 1140
            LEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVSVFPVWAA
Sbjct: 1081 LEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVSVFPVWAA 1140

Query: 1141 KAIHRRLHPPSYAKVQEFSTV 1161
            KAIHRRLHPPSYAKVQEFSTV
Sbjct: 1141 KAIHRRLHPPSYAKVQEFSTV 1161

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-like
            ATPases family in the superfamily of P-type ATPases,
            overproduction confers neomycin resistance [3456 bp, 1151
            aa]
          Length = 1151

 Score = 1828 bits (4736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 899/1167 (77%), Positives = 1012/1167 (86%), Gaps = 24/1167 (2%)

Query: 1    MPFSPSLNPDRQK---SNSIGPRNSADSFDLQFEDSFDAVLDNIELNTDTRXXXXXXXXX 57
            MP  PS    +Q    SN+    NS DSFDL  +DSFDA LD++++N +           
Sbjct: 1    MPNPPSFKSHKQNLFNSNNNQHANSVDSFDLHLDDSFDAALDSLQINNNPE--------- 51

Query: 58   XXXXKASSENKDKLQESFEMKSLNARNGGLGHS----RNSSNGDRQPLMHDSASNPDGSP 113
                  S  N    +ESFEM++++  +    HS    R SSN D  PLM+D+  + D + 
Sbjct: 52   ----PLSKHNTVGDRESFEMRTVDDLDNFSNHSSDSHRKSSNTDTHPLMYDNRLSQDDN- 106

Query: 114  YKYTNVSESALNLHSNNRFSNWITKLKMVGAQKWKKFHTMGSVELDDRHMEREIHPSTTP 173
            +K+TN++ S  +  SNN FS  ++ LK+   + W KF +   +EL D+H+EREIHP TTP
Sbjct: 107  FKFTNIASSPPSS-SNNIFSKALSYLKVSNTKNWSKFGS--PIELSDQHIEREIHPDTTP 163

Query: 174  VYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYV 233
            VYDRNRY  NE+SNAKYNA TF+PTLLYEQFKFFYNLYFLVVALSQA+PALRIGYLSSY+
Sbjct: 164  VYDRNRYVSNELSNAKYNAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYI 223

Query: 234  VPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDR 293
            VPLAFVLTVTM+KEA+DDIQRRRRD ESN+ELYHV+ +++ +PSKDLKVGDLIK+ KGDR
Sbjct: 224  VPLAFVLTVTMAKEAIDDIQRRRRDRESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDR 283

Query: 294  LPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEK 353
            +PADLVLLQSSEPSGE+FIKTDQLDGETDWKLR+A  LTQNL+E DL+N++SITASAPEK
Sbjct: 284  IPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEK 343

Query: 354  AIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVK 413
            +IH FLGKVTYKD++SNPLS+DNTLWANTVLAS+GFCI CVVYTGRDTRQAMNTTTA VK
Sbjct: 344  SIHKFLGKVTYKDSTSNPLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVK 403

Query: 414  TGLLELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNL 473
            TGLLELEINSISKILCA VFALSI+LV FAGFHN DWY+D++RYLILFSTIIPVSLRVNL
Sbjct: 404  TGLLELEINSISKILCACVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNL 463

Query: 474  DLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTV 533
            DLAKSVYAHQIEHD TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTV
Sbjct: 464  DLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTV 523

Query: 534  SYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTF 593
            SYTSETLDIVSDYV +LV+S N +  + K   ST+RKD+S RVRDM++TLAICHNVTPTF
Sbjct: 524  SYTSETLDIVSDYVQSLVSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTF 583

Query: 594  EDDELTYQAASPDEIAIVKFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSD 653
            EDDELTYQAASPDEIAIVKFTESVGLSLFKRDR               YEILQVFPFNSD
Sbjct: 584  EDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSD 643

Query: 654  SKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLS 713
            SKRMGIIV DEQ DEYWFMQKGADTVM++IVE+NDWLEEETGNMAREGLRTLV+GRKKL+
Sbjct: 644  SKRMGIIVRDEQLDEYWFMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLN 703

Query: 714  RNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELL 773
            + IY+QF+K+Y+DASLSM+NRDQQM+ VITKYLE+DLELLGLTGVEDKLQ DVKSSIELL
Sbjct: 704  KKIYEQFQKEYNDASLSMLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELL 763

Query: 774  RNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGAC 833
            RNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH ITK+T+PEGA NQLEYLK+N+ AC
Sbjct: 764  RNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNAC 823

Query: 834  LLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDG 893
            LLIDGESLGMFL++Y++EFFDVV+ LPTV+ACRCTPQQKADVALVIR+ TGKRVCCIGDG
Sbjct: 824  LLIDGESLGMFLKHYEQEFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDG 883

Query: 894  GNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFI 953
            GNDVSMIQCADVGVGIVGKEGKQASLAADFSIT+FCHLTELLLWHGRNSYKRSAKLAQF+
Sbjct: 884  GNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFV 943

Query: 954  MHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIY 1013
            MHRGL+IAICQAVYSICS FEPI LYQG+LMVGYATCYTMAPVFS+TLDHDIEESLTKIY
Sbjct: 944  MHRGLIIAICQAVYSICSLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIY 1003

Query: 1014 PELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALIL 1073
            PELYK+LTEGKSLSYKTFFVW  LSLFQG VIQ  SQ F+SLL+ DFT+MVAI FTAL++
Sbjct: 1004 PELYKELTEGKSLSYKTFFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVV 1063

Query: 1074 NELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVS 1133
            NELIMVALEIYTWNK M+ TEI T L Y++SVPFLG+YFDL YM T+ +Y  LL ILL+S
Sbjct: 1064 NELIMVALEIYTWNKTMLVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLIS 1123

Query: 1134 VFPVWAAKAIHRRLHPPSYAKVQEFST 1160
            +FPVW AKAI+RRLHPPSYAKVQEF+T
Sbjct: 1124 IFPVWTAKAIYRRLHPPSYAKVQEFAT 1150

>Sklu_2193.1 YIL048W, Contig c2193 334-3765 reverse complement
          Length = 1143

 Score = 1751 bits (4535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 855/1170 (73%), Positives = 982/1170 (83%), Gaps = 36/1170 (3%)

Query: 1    MPFSPSLNPDR--QKSNSIGPRNSADSFDLQFEDSFDAVLDNIELNTDTRXXXXXXXXXX 58
            M FSP    ++  Q  +S   R+S DSFDLQFEDS DA L+++++N              
Sbjct: 1    MSFSPPPGSNKLNQAPSSNNGRSSIDSFDLQFEDSLDAALESLQINNS------------ 48

Query: 59   XXXKASSENKDKLQESFEMKSLNARNG----GLGHSRNSSNGDRQPLMHDSASNPDGSPY 114
                 S EN       FEM++++ ++G       HSR SS  D     H S S  D  P 
Sbjct: 49   --LNTSGEN-------FEMRTID-QDGDDTQSFKHSRVSSLNDSAKNTHLS-SGRDTQPL 97

Query: 115  KYTNVSESALNLHSNNR--FSNWITKLKMVGAQKWKKFH-TMGSVELDDRHMEREIHPST 171
              T     + N   +N+  +S +I  +K        K+  T  S+EL D+H+EREIHP T
Sbjct: 98   IGTTQEPWSNNQQGSNQSPWSKFIRLIKTPTTTDLSKYRSTNSSIELTDQHVEREIHPDT 157

Query: 172  TPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSS 231
            TP+YD+N+YP N ISNAKYN  TFIP +LYEQFKFF+NLYFL+VALSQAIPALRIGYLSS
Sbjct: 158  TPIYDKNKYPSNAISNAKYNPITFIPIILYEQFKFFFNLYFLLVALSQAIPALRIGYLSS 217

Query: 232  YVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKG 291
            Y+VPLAFVL VTMSKEAMDDIQRR+RD ESN+ELY VLN+++LVPSKDLKVGDLIKI KG
Sbjct: 218  YIVPLAFVLMVTMSKEAMDDIQRRQRDKESNNELYEVLNKAQLVPSKDLKVGDLIKIHKG 277

Query: 292  DRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAP 351
             R+PADLVLLQSSEPSGE+FIKTDQLDGETDWKLR+A +LTQNL+  DL+NK+SITAS+P
Sbjct: 278  TRIPADLVLLQSSEPSGESFIKTDQLDGETDWKLRVACSLTQNLSTDDLLNKISITASSP 337

Query: 352  EKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTAT 411
            EK+IH FLGK+TYKD+SSN LS+DNT+WANTVLAS G CIGCVVYTG DTRQAMNTT ++
Sbjct: 338  EKSIHRFLGKLTYKDSSSNALSVDNTMWANTVLASVGSCIGCVVYTGTDTRQAMNTTMSS 397

Query: 412  VKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRV 471
            VKTGLLELEINS+SKILCA VF LSI+LV FAGF N DWY+D+MRYLILFSTIIPVSLRV
Sbjct: 398  VKTGLLELEINSLSKILCACVFVLSIVLVAFAGFGNKDWYVDIMRYLILFSTIIPVSLRV 457

Query: 472  NLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLG 531
            NLDL KSVYA QIEHD TIP+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG
Sbjct: 458  NLDLGKSVYARQIEHDATIPDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKLHLG 517

Query: 532  TVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTP 591
            TVSYT +T+DIV+DYV  LV+SS +  P  +S   T++KDL  RVRD+VVTLAICHNVTP
Sbjct: 518  TVSYTMDTMDIVTDYVQELVSSSTTT-PMPQS---TAKKDLPNRVRDLVVTLAICHNVTP 573

Query: 592  TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFN 651
            TFED ELTYQAASPDEIAIVKFTESVGLSLFKRDR               Y+ILQVFPFN
Sbjct: 574  TFEDGELTYQAASPDEIAIVKFTESVGLSLFKRDRHSVSLFHQHSATNFEYDILQVFPFN 633

Query: 652  SDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKK 711
            SD+KRMGIIV+D+ K E+WFMQKGADTVMARIV++NDWL+EE GNMAREGLRTLV+GRKK
Sbjct: 634  SDTKRMGIIVYDKVKGEHWFMQKGADTVMARIVQSNDWLDEEVGNMAREGLRTLVIGRKK 693

Query: 712  LSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIE 771
            LS   Y+QF+K+Y DASLSM+NRD+ M++VI K+LE++LELLGLTGVEDKLQNDVKSSIE
Sbjct: 694  LSPKSYEQFRKEYHDASLSMLNRDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIE 753

Query: 772  LLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKG 831
            LLRNAG+KIWMLTGDKVETARCVSISAKLISRGQYVH +TKL++PEGALN LEYLK+NK 
Sbjct: 754  LLRNAGVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKS 813

Query: 832  ACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIG 891
            +CLLIDGESLGMFL YYK+EFFD+V+ LP V+ACRCTPQQKADVAL+IRE TGKRVCCIG
Sbjct: 814  SCLLIDGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIG 873

Query: 892  DGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQ 951
            DGGNDVSMIQCADVGVGIVGKEGKQASLAADFS+T+FCHLT+LLLWHGRNSYKRSAKLAQ
Sbjct: 874  DGGNDVSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQ 933

Query: 952  FIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTK 1011
            F++HRGL+I++CQAVYS+CSKFEPI LYQG+LMVGYATCYTMAPVFS+TLDHDI+ESLTK
Sbjct: 934  FVIHRGLIISVCQAVYSVCSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTK 993

Query: 1012 IYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTAL 1071
            IYPELYK+LT G SLSYKTFFVW  LSLFQGC IQG SQ F+SL EVDF K+VA+ FTAL
Sbjct: 994  IYPELYKELTAGTSLSYKTFFVWVILSLFQGCAIQGISQYFTSLDEVDFKKLVALSFTAL 1053

Query: 1072 ILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILL 1131
            ++NELIMVALEIYTWNK MV TEI+TFL YV+SVPFL EYFDL ++  L FY +L+FIL 
Sbjct: 1054 VINELIMVALEIYTWNKTMVITEIVTFLIYVVSVPFLSEYFDLTFVSQLPFYAKLIFILA 1113

Query: 1132 VSVFPVWAAKAIHRRLHPPSYAKVQEFSTV 1161
            VSVFPVWAAKAIHR+++PP+YAKVQ+FST+
Sbjct: 1114 VSVFPVWAAKAIHRKINPPNYAKVQQFSTI 1143

>CAGL0L00715g 86810..90244 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, hypothetical start
          Length = 1144

 Score = 1729 bits (4479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 860/1161 (74%), Positives = 971/1161 (83%), Gaps = 36/1161 (3%)

Query: 15   NSIGPRNSADSFDLQFEDSFDAVLDNIELNTDTRXXXXXXXXXXXXXKASSENKDKL--- 71
            +++  RNS  S D  FE+SFD  LDNIE+N                   S  N +++   
Sbjct: 6    HNLNSRNSV-SLD-SFENSFDEALDNIEINP----------VRGYHIDNSLNNSNRITDF 53

Query: 72   --QESFEMKSLNARNGGLGHSRNSSNGDRQPLMHD----SASNPDGSPYKYTNVSES-AL 124
               E+FEM+S+      L    +  N D  PLM D    +AS  +    KY NVS S ++
Sbjct: 54   DIDENFEMRSV------LEDEEHFDN-DGHPLMRDRTRSNASTLNSRYNKYNNVSGSRSV 106

Query: 125  NLHSNNR----FSNWITKLKMVGAQKWKKFHTMGSVELDDRHMEREIHPSTTPVYDRNRY 180
              ++ +        W   +K   +  WK + T  SV L D H ERE+HP TT VYDR+R+
Sbjct: 107  TGYTPSTIGVGLKKWFVNVKTAISSGWKDYST--SVALGDEHTEREVHPGTTQVYDRHRF 164

Query: 181  PGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFVL 240
            P NE+SNAKYNA TF+PTLLYEQFKFF+NLYFL+VALSQAIPALRIGYLSSYVVPLAFVL
Sbjct: 165  PSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVVPLAFVL 224

Query: 241  TVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVL 300
            TVTM+KEA DDIQRRRRD ESN ELY VL + + V SKDLKVGDLIKISKG R+PADL+L
Sbjct: 225  TVTMAKEASDDIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGARVPADLIL 284

Query: 301  LQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLG 360
            LQSSEPSGE FIKTDQLDGETDWKLRIA  LTQNL E DL+ K++ITASAPEK+IH+FLG
Sbjct: 285  LQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASAPEKSIHSFLG 344

Query: 361  KVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELE 420
            +VTYKDT+++ L+IDNTLWANTVLAS+GFCIGCV+YTGRDTRQAMNTT+A VKTGLLELE
Sbjct: 345  RVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTTSAKVKTGLLELE 404

Query: 421  INSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVY 480
            IN ISKILCA VF LSI+LVVFAG HN DWY+D+MRYLILFSTIIPVSLRVNLDLAKSVY
Sbjct: 405  INDISKILCACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIPVSLRVNLDLAKSVY 464

Query: 481  AHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL 540
            AHQIEHD TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK+HLG VSYT+ET 
Sbjct: 465  AHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKVHLGNVSYTTETA 524

Query: 541  DIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTY 600
            DIVSDY+  ++ S N +  +     ST+RKD +  V D++ TLAICHNVTPTFEDDELTY
Sbjct: 525  DIVSDYIQGMIESKNDS-VTNLGPRSTTRKDAATHVIDLITTLAICHNVTPTFEDDELTY 583

Query: 601  QAASPDEIAIVKFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGII 660
            QAASPDEIAIVKFTESVGLSLFKRDR               Y++L +FPFNSD+KRMGII
Sbjct: 584  QAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILNYDVLTMFPFNSDTKRMGII 643

Query: 661  VHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQF 720
            V+D+QKD+YWF+QKGADTVM RIV NNDWLEEETGNMAREGLRTLV+GRKKL++ IY+QF
Sbjct: 644  VYDKQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAREGLRTLVIGRKKLTKKIYEQF 703

Query: 721  KKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKI 780
            KK+Y++ S SM NR+Q+M   I+KYLE+DLELLGLTGVEDKLQ DVKSSIELLRNAGIKI
Sbjct: 704  KKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKI 763

Query: 781  WMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGES 840
            WMLTGDKVETARCVSISAKLISRGQYVH++TKL+KPEGA NQLEYLKVNK ACLLIDGES
Sbjct: 764  WMLTGDKVETARCVSISAKLISRGQYVHVVTKLSKPEGAFNQLEYLKVNKNACLLIDGES 823

Query: 841  LGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMI 900
            LGMFL+YY++EFFDVV+ LPTV+ACRCTPQQKADVAL+IRE TGKRVCCIGDGGNDVSMI
Sbjct: 824  LGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKADVALIIRELTGKRVCCIGDGGNDVSMI 883

Query: 901  QCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVI 960
            QCADVGVGIVGKEGKQASLAADFSIT+FCHLTELLLWHGRNSYKRSAKLAQF+MHRGL+I
Sbjct: 884  QCADVGVGIVGKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLII 943

Query: 961  AICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYPELYKDL 1020
            AICQAV+S+CS+FEPI LYQG+LMVGYATCYTMAPVFS+TLDHDI+ESLTK+YPELYKDL
Sbjct: 944  AICQAVFSVCSQFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKMYPELYKDL 1003

Query: 1021 TEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALILNELIMVA 1080
            TEGKSLSYKTFFVW ALS +QG VIQG SQ F+SL E+DFTKMVAIGFTALI NELIMVA
Sbjct: 1004 TEGKSLSYKTFFVWVALSFYQGLVIQGFSQTFTSLAEIDFTKMVAIGFTALIFNELIMVA 1063

Query: 1081 LEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVSVFPVWAA 1140
            LEIYTWNK M+ TEI+T   YV SVPFLGEYFDLKY+ TL+F  EL+ IL+VS+FPVW  
Sbjct: 1064 LEIYTWNKTMIITEIVTLAIYVFSVPFLGEYFDLKYISTLKFITELILILVVSIFPVWLT 1123

Query: 1141 KAIHRRLHPPSYAKVQEFSTV 1161
            KAI+RRL+ PSYAKVQEFSTV
Sbjct: 1124 KAIYRRLNLPSYAKVQEFSTV 1144

>Kwal_23.5789
          Length = 1133

 Score = 1630 bits (4220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 806/1164 (69%), Positives = 951/1164 (81%), Gaps = 41/1164 (3%)

Query: 1    MPFSPSLNPDRQKSNSIGPRNSADSFDL---QFEDSFDAVLDNIELNTDTRXXXXXXXXX 57
            M FSP   P      SI   N  +SFDL   Q EDS DA L++++++T            
Sbjct: 1    MSFSP---PPGSNKESIPHNNRHNSFDLLDPQLEDSLDAALESLQIHT------------ 45

Query: 58   XXXXKASSENKDKLQESFEMKSLNARNGGLGHSRNSSNGDRQPLMHDSASNPDGSPYKYT 117
                          +E FEM SL +        +N+   D +PL+++ A+ P+   + + 
Sbjct: 46   ---------GGSPAREDFEMTSLRSNES----QKNARQSDTEPLINNGATAPNS--WSHD 90

Query: 118  NVSESALNLHSNNRFSNWITK-LKMVGAQKWKKFH-TMGSVEL-DDRHMEREIHPSTTPV 174
               +S  +  S + F + ITK ++   + K   +  T  S++L DD+ ++REIHPSTTPV
Sbjct: 91   PRHDSDRSTASGSPFWSRITKFMRSSHSPKVSTYKATSNSIQLKDDQQLDREIHPSTTPV 150

Query: 175  YDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVV 234
            YDR +Y  N ISNAKYN  TFIP +LYEQFKFF+NLYFL+VALSQAIPALRIGYLSSY+V
Sbjct: 151  YDRYKYAPNAISNAKYNPVTFIPKILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIV 210

Query: 235  PLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRL 294
            PLAFVLTVTMSKEA+DDIQRRRRD ESN+ELY VL++S+LVPSKDLKVGDLIKI KG R 
Sbjct: 211  PLAFVLTVTMSKEALDDIQRRRRDRESNNELYEVLSKSQLVPSKDLKVGDLIKIGKGARA 270

Query: 295  PADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKA 354
            PADLVLLQSSEPSGE FIKTDQLDGETDWKLRIA  LTQ+L++ DL+ ++SITAS PEK+
Sbjct: 271  PADLVLLQSSEPSGEIFIKTDQLDGETDWKLRIACPLTQHLSQDDLLYRISITASVPEKS 330

Query: 355  IHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKT 414
            I+NFLGK+T+ +  S PLS+DNT+WANTV AS G  I CVVYTG DTRQAMNT+ ++VKT
Sbjct: 331  INNFLGKLTFGEIQSQPLSVDNTMWANTVFASAGTAIACVVYTGADTRQAMNTSMSSVKT 390

Query: 415  GLLELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLD 474
            GLLELEINS+SKILCA VF LS+ LV FAGF+N+DWY+D+MRYLILFSTIIPVSLRVNLD
Sbjct: 391  GLLELEINSLSKILCACVFILSVALVAFAGFNNNDWYVDIMRYLILFSTIIPVSLRVNLD 450

Query: 475  LAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVS 534
            L KSVYAHQIEHD TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM+LKK+HLGTVS
Sbjct: 451  LGKSVYAHQIEHDSTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMELKKLHLGTVS 510

Query: 535  YTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFE 594
            YT +T+DIV+DYV A+ ++ NS+     +VPS S+KDL  RVRD+V+TLA+CH VTPTFE
Sbjct: 511  YTMDTMDIVTDYVRAMSDNLNSS-----AVPSASKKDLPGRVRDLVLTLALCHQVTPTFE 565

Query: 595  DDELTYQAASPDEIAIVKFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDS 654
            D ELTYQAASPDEIAIVKFTESVGL+LF+RDR               Y+IL VFPFNSD+
Sbjct: 566  DGELTYQAASPDEIAIVKFTESVGLTLFRRDRHSITLLHDQSGTNFEYDILHVFPFNSDN 625

Query: 655  KRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSR 714
            KRMGI++ D+QKDEYWF+QKGAD VM++IV+ NDWLEEETGN+AREGLRTLV+GRK+LS+
Sbjct: 626  KRMGIVIFDKQKDEYWFLQKGADVVMSKIVQKNDWLEEETGNLAREGLRTLVIGRKRLSK 685

Query: 715  NIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLR 774
             +   F KDY+DASL M+NR+  M+ VI+K+LE+DLE+LGLTGVEDKLQ DVKSSIELLR
Sbjct: 686  KLLQTFTKDYEDASLMMLNREVTMSNVISKHLEHDLEILGLTGVEDKLQEDVKSSIELLR 745

Query: 775  NAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACL 834
            NAGIKIWMLTGDKVETARCVSISAKL+SRGQYVH +TK+ KPEGAL  LE LK+N  +CL
Sbjct: 746  NAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKVNKPEGALTHLELLKINTNSCL 805

Query: 835  LIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGG 894
            LIDGESLG++L YY+++FF++V+ LP V+ACRCTPQQKADVA  IRE TGKRVCCIGDGG
Sbjct: 806  LIDGESLGLYLEYYRQQFFEIVVNLPAVIACRCTPQQKADVATFIREVTGKRVCCIGDGG 865

Query: 895  NDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIM 954
            NDVSMIQ ADVGVGIVGKEGKQASLAADFSIT+FCHL++LLLWHGRNSYKRSAKLAQF++
Sbjct: 866  NDVSMIQSADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRSAKLAQFVI 925

Query: 955  HRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYP 1014
            HRGL+I++CQAVYSI SKFEPI LYQG+LMVGYATCYTMAPVFS+TLDHDI+ESLTK YP
Sbjct: 926  HRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYP 985

Query: 1015 ELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALILN 1074
            ELYK+LT GKSLSYKTFFVW  LSLFQGCVIQG SQ F+SL E+DF ++VA+ FT LILN
Sbjct: 986  ELYKELTAGKSLSYKTFFVWVVLSLFQGCVIQGLSQGFTSLDELDFKRLVALSFTVLILN 1045

Query: 1075 ELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVSV 1134
            ELIMVA+EIYTWNK MV +E++TFL +V SVP L EYFDL YM    +YG+L  IL +S+
Sbjct: 1046 ELIMVAIEIYTWNKTMVVSEVVTFLIFVGSVPLLEEYFDLTYMSRPEYYGKLAIILSLSI 1105

Query: 1135 FPVWAAKAIHRRLHPPSYAKVQEF 1158
             PVWAAKA+HRRL+PPSYAKVQ+F
Sbjct: 1106 IPVWAAKALHRRLNPPSYAKVQQF 1129

>KLLA0C08393g 734655..738101 highly similar to sp|P40527 Saccharomyces
            cerevisiae YIL048w NEO1 ATPase whose overproduction
            confers neomycin resistance, start by similarity
          Length = 1148

 Score = 1615 bits (4183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 797/1184 (67%), Positives = 950/1184 (80%), Gaps = 59/1184 (4%)

Query: 1    MPFSPSLNPDRQKSNSIGPRNSA-------DSFDLQFEDSFDAVLDNIELNTDTRXXXXX 53
            M FSP   P  Q  N     N         DSFDLQFEDS DA L++++L          
Sbjct: 1    MSFSPP--PGSQIPNKYSKSNQHQAQSTDRDSFDLQFEDSLDAALESLQL---------- 48

Query: 54   XXXXXXXXKASSENKDKLQESFEMKSLNA-RNGGLGHSRNSSNGDRQPLMHDSASNPDGS 112
                     +       + E FEMKS++     G+ HS    + D  PL+ + ++N    
Sbjct: 49   ------PEHSHRRENSTVFEDFEMKSMHGDHQTGMLHS----DADTAPLITNHSNNG--- 95

Query: 113  PYKYTNVSESALNLHSNNRFSNWITKLKMVGAQKWKKFHTMGS---------------VE 157
                  +S S  N  + N  + W +K K      + K  +  S               +E
Sbjct: 96   ----RMLSNSDRNAQNTNNITVW-SKAKSWFEHSFTKAKSKPSSLSVYSSTNSVDGNKIE 150

Query: 158  LDDRHMEREIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVAL 217
            L+D ++EREIHP+TTP+YDR +YP N ISNAKYN FTFIP +LYEQFKFF+NLYFL+VAL
Sbjct: 151  LNDHNVEREIHPATTPIYDRKKYPSNVISNAKYNPFTFIPLILYEQFKFFFNLYFLIVAL 210

Query: 218  SQAIPALRIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPS 277
            SQAIP LRIGYLSSY+VPLAFVLTVTMSKEAMDDI RR+RD E+N+ELY V+N+   +PS
Sbjct: 211  SQAIPQLRIGYLSSYIVPLAFVLTVTMSKEAMDDINRRKRDREANNELYEVVNKPCPIPS 270

Query: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTE 337
            KDLKVGD+IK+ KG R+PAD+V+LQ++EP+GE+FIKTDQLDGETDWKLR+A +LTQ+LTE
Sbjct: 271  KDLKVGDIIKLKKGARVPADVVVLQTNEPNGESFIKTDQLDGETDWKLRLACSLTQSLTE 330

Query: 338  PDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYT 397
             DL+N ++ITASAPE +IHNFLGK+TYKD++S+PLS+DNT+W NTVLAS+  CI C+VYT
Sbjct: 331  NDLLNNITITASAPEHSIHNFLGKITYKDSTSSPLSVDNTMWENTVLASSAACICCIVYT 390

Query: 398  GRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRY 457
            GR+TRQA+NTT +  KTGLLELEIN +SKILCA VF LSI+LV FAGF+N+DWY+D+MRY
Sbjct: 391  GRETRQALNTTKSKAKTGLLELEINGLSKILCACVFLLSIMLVAFAGFNNNDWYVDIMRY 450

Query: 458  LILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGT 517
            LILFSTIIPVSLRVNLDL KSVYA++IEHD  I +TIVRTSTIPEDLGRIEYLLSDKTGT
Sbjct: 451  LILFSTIIPVSLRVNLDLGKSVYAYKIEHDKQIEDTIVRTSTIPEDLGRIEYLLSDKTGT 510

Query: 518  LTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVR 577
            LTQNDMQLKKIHLGTVSYT+ET+DIV+D++ ++ NS  S      S P+T+RK++S RV 
Sbjct: 511  LTQNDMQLKKIHLGTVSYTNETMDIVTDFIQSM-NSRTS-----NSTPTTTRKNISDRVI 564

Query: 578  DMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRXXXXXXXXXXX 637
            D+V TLAICHNVTPTFED ELTYQAASPDEIAIVKFTESVGLSLF+RDR           
Sbjct: 565  DLVTTLAICHNVTPTFEDGELTYQAASPDEIAIVKFTESVGLSLFRRDRHSISLFHDHSG 624

Query: 638  XXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNM 697
                Y+I  +FPFNSDSKRMG+I+ D+ K EYWF+QKGADTVM+ IV  NDWLEEET NM
Sbjct: 625  MKLEYDIKILFPFNSDSKRMGVIIFDKLKQEYWFLQKGADTVMSSIVVRNDWLEEETSNM 684

Query: 698  AREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTG 757
            A EGLRTLV+GRKKLS N+++QF+K+Y +ASL+M++R+  M  V+ K+LE DLELLGLTG
Sbjct: 685  ATEGLRTLVIGRKKLSTNLFEQFEKEYSEASLTMMDREVHMQNVVRKFLENDLELLGLTG 744

Query: 758  VEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPE 817
            VEDKLQ DVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH +TK+ KPE
Sbjct: 745  VEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKVNKPE 804

Query: 818  GALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVAL 877
            GAL+ LEYL+VN+ +CLLIDGESLG++L+Y+  EFFD+V+ LPTVVACRCTPQQKADVA+
Sbjct: 805  GALHHLEYLQVNQNSCLLIDGESLGLYLQYFPDEFFDIVVNLPTVVACRCTPQQKADVAV 864

Query: 878  VIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLW 937
             IR+ TGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSIT+FCHLT+LLLW
Sbjct: 865  FIRQATGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHLTKLLLW 924

Query: 938  HGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVF 997
            HGRNSYK SAKL+QF++HRGL+I++CQAVYSICS FEP+ LYQG+LMVGYATCYTMAPVF
Sbjct: 925  HGRNSYKSSAKLSQFVIHRGLIISVCQAVYSICSMFEPLALYQGWLMVGYATCYTMAPVF 984

Query: 998  SMTLDHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLE 1057
            S+TLDHDI+ESLT +YPELYK+LT GKSLS+KTFFVW ALS+FQGCVIQ  SQ F+SL +
Sbjct: 985  SLTLDHDIDESLTTLYPELYKELTLGKSLSFKTFFVWVALSVFQGCVIQMASQFFTSLND 1044

Query: 1058 VDFTKMVAIGFTALILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYM 1117
             DFTKMVAI FTAL+LNELIMV LEI TWNKIM  TE++T L Y+ S+PFLGEYFDL Y+
Sbjct: 1045 SDFTKMVAISFTALVLNELIMVGLEINTWNKIMAITEVVTLLIYLGSIPFLGEYFDLSYV 1104

Query: 1118 MTLRFYGELLFILLVSVFPVWAAKAIHRRLHPPSYAKVQEFSTV 1161
             T +F   +L IL++SV PVWAAK+I+RRL+PP+YAKVQ+FS V
Sbjct: 1105 STTKFPLRVLVILVISVVPVWAAKSIYRRLNPPNYAKVQQFSMV 1148

>ADL079C [1662] [Homologous to ScYIL048W (NEO1) - SH] (544854..548354)
            [3501 bp, 1166 aa]
          Length = 1166

 Score = 1592 bits (4123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/1151 (67%), Positives = 935/1151 (81%), Gaps = 34/1151 (2%)

Query: 20   RNSADSFDLQFEDSFDAVLDNIELNTDTRXXXXXXXXXXXXXKASSENKDKLQ--ESFEM 77
            R S DSF+L+F+DS DA L+++++                   AS E    ++  E FE+
Sbjct: 41   RGSLDSFELEFDDSLDAALESLQIK----------------RSASHERHSGIRGAEDFEL 84

Query: 78   KSLNARNGGLGHSRNS--SNGDRQPLMHDSASNPDGSPY-KYTNVSESALNLHSN-NRFS 133
            KS+   + G GHS +   +N D QPL+     + D   Y +   +    L   S+  R  
Sbjct: 85   KSMGRVDDG-GHSPSGVLTNQDTQPLI-----SQDSWDYGQVKRLRSGWLGPQSSWQRLK 138

Query: 134  NWITKLKMVGAQKW---KKFHTMGSVELDDRHMEREIHPSTTPVYDRNRYPGNEISNAKY 190
            +W+      GA        + +  S+EL D+H++REIH  TTP+YD+ +YP N ISNAKY
Sbjct: 139  SWVLPGAKAGAPLLGVTATYSSTHSIELTDQHVDREIHLDTTPIYDKRKYPTNAISNAKY 198

Query: 191  NAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFVLTVTMSKEAMD 250
            NA TF+P +LYEQFKFF+NLYFL+V+LSQ+IPALRIGYLSSY+VPLAFVL VTMSKEAMD
Sbjct: 199  NAITFLPIVLYEQFKFFFNLYFLLVSLSQSIPALRIGYLSSYIVPLAFVLVVTMSKEAMD 258

Query: 251  DIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGET 310
            DIQRRRRD E+N+ELY VLN S+LVPSK+L+VGDL+K+ K  R+PAD++LLQSSEPSGET
Sbjct: 259  DIQRRRRDRETNNELYEVLNNSQLVPSKNLRVGDLVKLHKDSRIPADMILLQSSEPSGET 318

Query: 311  FIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSN 370
            F+KTDQLDGETDWKLR+AP+LTQNLT+ +++ KV ITASAPEK+IH F GK+TYK  SS 
Sbjct: 319  FVKTDQLDGETDWKLRVAPSLTQNLTQDEMLTKVHITASAPEKSIHMFTGKLTYKG-SSA 377

Query: 371  PLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCA 430
            PLS+DNTLWANTVLAS+G C+ CV+YTG DTRQAMNT+ ++VKTGLLELEINS+SKILC 
Sbjct: 378  PLSVDNTLWANTVLASSGTCVACVIYTGTDTRQAMNTSKSSVKTGLLELEINSLSKILCI 437

Query: 431  SVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTI 490
             VF LSI+LVV  G  +  WY+D+MRYLILFSTIIPVSLRVNLDL KSVYA QIE D +I
Sbjct: 438  CVFTLSILLVVIGGLDDDKWYVDIMRYLILFSTIIPVSLRVNLDLGKSVYARQIESDKSI 497

Query: 491  PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDAL 550
            P+TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQL+KIHLGTVSYT ET+D+V+DY+  L
Sbjct: 498  PDTIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLRKIHLGTVSYTMETMDMVTDYIQTL 557

Query: 551  VNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAI 610
             + +N    +G +V + SRK++S RVRD+VVTLA CHNVTP FED+EL YQAASPDEIAI
Sbjct: 558  TSPAN-MGAAGVAV-TGSRKEVSQRVRDLVVTLATCHNVTPNFEDNELAYQAASPDEIAI 615

Query: 611  VKFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYW 670
            VKFTE VGLSLFKRDR               Y+IL VFPF SD+KRMGIIV D  K+E W
Sbjct: 616  VKFTERVGLSLFKRDRHSLTLFHEYSGVNLQYDILHVFPFTSDTKRMGIIVRDRTKNEIW 675

Query: 671  FMQKGADTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLS 730
            F+QKGADTVM++IV++NDWLEEE  NMAREGLRTLV+ RKKLS  +Y+QF K+Y DASLS
Sbjct: 676  FLQKGADTVMSKIVQSNDWLEEEVSNMAREGLRTLVIARKKLSTRLYEQFSKEYKDASLS 735

Query: 731  MVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVET 790
            M+NRD+ MN V+ ++LE++LELLGLTGVEDKLQ DVK+SIELLRNAG+KIWMLTGDKVET
Sbjct: 736  MLNRDEAMNEVVKRHLEHNLELLGLTGVEDKLQKDVKTSIELLRNAGVKIWMLTGDKVET 795

Query: 791  ARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKR 850
            ARCV +SAKLISRGQYVH ITKLT+ +GAL++LEYLK N+ +CLLIDG+SL +++ +Y+ 
Sbjct: 796  ARCVCVSAKLISRGQYVHTITKLTRRDGALSRLEYLKANRNSCLLIDGDSLAIYMSHYRA 855

Query: 851  EFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIV 910
            EFF++VICLP V+ACRCTPQQKADVAL+IRE TGKRVCCIGDGGNDVSMIQCADVGVGIV
Sbjct: 856  EFFEIVICLPVVIACRCTPQQKADVALLIREMTGKRVCCIGDGGNDVSMIQCADVGVGIV 915

Query: 911  GKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSIC 970
            GKEGKQASLAAD+SIT+FCHLT+LLLWHGRNSYKRSAKL+QF++HRGL+I++CQAVYSI 
Sbjct: 916  GKEGKQASLAADYSITQFCHLTKLLLWHGRNSYKRSAKLSQFVIHRGLLISVCQAVYSIS 975

Query: 971  SKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYPELYKDLTEGKSLSYKT 1030
            S  +PI LYQG+LMVGYATCYTMAPVFS+TLDHDI+ESLTK YPELYK+LTEG+SLSYKT
Sbjct: 976  SNLKPIALYQGWLMVGYATCYTMAPVFSLTLDHDIDESLTKTYPELYKELTEGRSLSYKT 1035

Query: 1031 FFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIGFTALILNELIMVALEIYTWNKIM 1090
            FFVW  LSLFQG VIQG SQ+F  +    F KMVA+ FTAL++NELIMVALEIYTWNK M
Sbjct: 1036 FFVWVILSLFQGAVIQGFSQLFIGVGSEVFKKMVALSFTALVINELIMVALEIYTWNKTM 1095

Query: 1091 VFTEILTFLCYVISVPFLGEYFDLKYMMTLRFYGELLFILLVSVFPVWAAKAIHRRLHPP 1150
              +EI+TF  YV+S+P LGEYFDL  M+ L F+ +L  IL VS+FPVWAAK IHRRL PP
Sbjct: 1096 AISEIVTFAIYVLSIPLLGEYFDLTSMLALPFFIQLTIILTVSIFPVWAAKTIHRRLKPP 1155

Query: 1151 SYAKVQEFSTV 1161
            S+AKVQ+FS V
Sbjct: 1156 SHAKVQQFSAV 1166

>Scas_89.1
          Length = 271

 Score =  473 bits (1218), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 215/257 (83%), Positives = 245/257 (95%)

Query: 717 YDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNA 776
           YD+F+K+Y DASLSM+N D+ M++VI K+LE++LELLGLTGVEDKLQNDVKSSIELLRNA
Sbjct: 2   YDKFEKEYHDASLSMLNXDETMSSVIKKHLEHNLELLGLTGVEDKLQNDVKSSIELLRNA 61

Query: 777 GIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLI 836
           G+KIWMLTGDKVETARCVSISAKLISRGQYVH +TKL++PEGALN LEYLK+NK +CLLI
Sbjct: 62  GVKIWMLTGDKVETARCVSISAKLISRGQYVHTVTKLSRPEGALNALEYLKINKSSCLLI 121

Query: 837 DGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGND 896
           DGESLGMFL YYK+EFFD+V+ LP V+ACRCTPQQKADVAL+IRE TGKRVCCIGDGGND
Sbjct: 122 DGESLGMFLTYYKQEFFDIVVDLPAVIACRCTPQQKADVALLIREITGKRVCCIGDGGND 181

Query: 897 VSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHR 956
           VSMIQCADVGVGIVGKEGKQASLAADFS+T+FCHLT+LLLWHGRNSYKRSAKLAQF++HR
Sbjct: 182 VSMIQCADVGVGIVGKEGKQASLAADFSVTQFCHLTKLLLWHGRNSYKRSAKLAQFVIHR 241

Query: 957 GLVIAICQAVYSICSKF 973
           GL+I++CQAVYS+CSK 
Sbjct: 242 GLIISVCQAVYSVCSKL 258

>KLLA0A04015g complement(355624..359655) similar to sp|P39524
            Saccharomyces cerevisiae YAL026c DRS2 P-type
            amino-phospholipids-ATPase, start by similarity
          Length = 1343

 Score =  439 bits (1130), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 321/1058 (30%), Positives = 521/1058 (49%), Gaps = 90/1058 (8%)

Query: 177  RNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPL 236
            R  Y  N IS  KYNA TF+P  L+++F  + NL+FL  ++ Q +P +      + +  L
Sbjct: 199  RFGYRDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTL 258

Query: 237  AFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQ--SKLVPSK--DLKVGDLIKISKGD 292
              VL V+  KE+++D++R   D E N  L  VL++   + V  K  D+ VGD+I++   +
Sbjct: 259  LVVLIVSAVKESVEDLKRSNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEE 318

Query: 293  RLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVS--ITASA 350
             +PADL++L SSEP G  +I+T  LDGET+ K++ A   T N  +   + K+   + +  
Sbjct: 319  AIPADLIILSSSEPEGLCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEH 378

Query: 351  PEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTA 410
            P  +++ + G +T  + S+ PLS D  L     L +T +  G +V+TG +T+   N T  
Sbjct: 379  PNSSLYTYEGTMTL-NGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATAT 437

Query: 411  TVKTGLLELEINSISKILCASVFALSIILVVFAGFHN----------------------S 448
             +K   +E  IN   +IL  ++F + I+L + +   N                       
Sbjct: 438  PIKRTAVERVINM--QIL--ALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAG 493

Query: 449  DWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDDTIPETIVRTSTIPE 502
             ++ D++ + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E
Sbjct: 494  LFFKDILTFWILFSNLVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVE 553

Query: 503  DLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGK 562
            +LG+IEY+ SDKTGTLT+N M+ K + +    Y     +     V+  +     +  S K
Sbjct: 554  ELGQIEYIFSDKTGTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLK 613

Query: 563  SVPSTSRKDLSARVRDMVVTLAICHNVTP-TFEDDELTYQAASPDEIAIVKFTESVGLSL 621
               +    D +  V + +  LA CH V P T  D  + YQAASPDE A+V+    +G   
Sbjct: 614  DKMTDPEDDEAGIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFR- 672

Query: 622  FKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMA 681
            F   R               Y++L +  FNS  KRM  I          F  KGADTV+ 
Sbjct: 673  FDIRRPNSVSISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFC-KGADTVIL 731

Query: 682  RIV--ENNDWLEEETGNM---AREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQ 736
              +  E N +++    ++   A EGLRTL +  + +    Y+++ K Y+ AS +M +R +
Sbjct: 732  ERLDSEFNPYVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTE 791

Query: 737  QMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 796
            +++    + +E+DL  LG T +EDKLQ  V  +I  L+ AG+K+W+LTGD+ ETA  + +
Sbjct: 792  ELDRA-AELIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGM 850

Query: 797  SAKLISRGQYVHIITKLTKP------EGALNQLEYLKVNK----GACLLIDGESLGMFLR 846
            S +L+S    + I+ + TK       +  LN +E  ++++       L+IDG+SLG  L 
Sbjct: 851  SCRLLSEDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALE 910

Query: 847  Y-YKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADV 905
               + +F  +      V+ CR +P QKA V  +++  T   +  IGDG NDVSMIQ A V
Sbjct: 911  EDLEDQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHV 970

Query: 906  GVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQA 965
            GVGI G EG QA+ +ADF+I +F  L +LL+ HG  SY+R +    +  ++ + + + Q 
Sbjct: 971  GVGISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQF 1030

Query: 966  VYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTL-DHDIEESLTKIYPELYKDLTEGK 1024
             Y   + F    + + + +  Y   +T+ P F + + D  +   L   YP+LYK   +G+
Sbjct: 1031 WYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQKGQ 1090

Query: 1025 SLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKMVAIG-------------FTAL 1071
              S   F+ W     +   V+        S+L   +   + +G             +T  
Sbjct: 1091 FFSVTIFWGWVLNGFYHSAVV-----FIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTS 1145

Query: 1072 ILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDL------KYMMTLRFYGE 1125
            I+  L   AL    W K  +     + + +++  PF    F         Y +    YG 
Sbjct: 1146 IIIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYGS 1205

Query: 1126 LLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157
              F L+  V PV+A       K   R   P SY  VQE
Sbjct: 1206 ATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQE 1243

>CAGL0G06270g 598357..602343 highly similar to sp|P39524 Saccharomyces
            cerevisiae YAL026c DRS2, start by similarity
          Length = 1328

 Score =  436 bits (1122), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 328/1065 (30%), Positives = 521/1065 (48%), Gaps = 81/1065 (7%)

Query: 165  REIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPAL 224
            REIH S     +R  Y  N IS  KYNA TF+P  L+++F  + NL+FL  +  Q +P +
Sbjct: 166  REIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 225

Query: 225  RIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNE---SNSELYHVLNQSKLVPSK--D 279
                  + +  L  VL V+  KE+++D++R   DNE   S +E+Y    +   +  +  D
Sbjct: 226  SPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEA-EGDFIQKRWID 284

Query: 280  LKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEP- 338
            +KVGD+I+++  + +PAD+++L SSEP G  +I+T  LDGET+ K++ A   T  + +  
Sbjct: 285  IKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQARTETAKIMDSR 344

Query: 339  DLMN-KVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYT 397
            +L N K  I++  P  +++ + G +    T   PLS +  +     L +TG+  G V++T
Sbjct: 345  ELRNIKGVISSEQPNSSLYTYEGTLEMNGTKI-PLSPEQMILRGATLRNTGWIFGIVIFT 403

Query: 398  GRDTRQAMNTTTATVKTGLLELEIN-----------------SISKILCASVFALSIILV 440
            G +T+   N T   +K   +E  IN                 SI  ++ ++  A  +  +
Sbjct: 404  GHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNVIMSTADAKHLSYL 463

Query: 441  VFAGFHNSDWYL-DVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD------DTIPET 493
               G + +  +  D + + ILFS ++P+SL V ++L K   A  I  D      +T   T
Sbjct: 464  YLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEETDTPT 523

Query: 494  IVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSET-LDIVSDYVDALVN 552
            +V+TS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y      D  + + D +  
Sbjct: 524  VVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYAEHIPEDKAATFEDGIEV 583

Query: 553  SSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFE-DDELTYQAASPDEIAIV 611
               S +   K +  T+  D    + + +  LA CH V P F+ D  + YQAASPDE A+V
Sbjct: 584  GYRSFDDLKKQL--TTNSDDCKIIDEFLTLLATCHTVIPEFQADGSIKYQAASPDEGALV 641

Query: 612  KFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWF 671
            +    +G     R +               Y++L +  FNS  KRM  I      D    
Sbjct: 642  EGGALLGYKFLIR-KPNSVTILINEEEEREYQLLNICEFNSTRKRMSAIFRFPD-DSIKL 699

Query: 672  MQKGADTV-MARIVENNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYDD 726
            + KGAD+V + R+ E  ++  + T     + A EGLRTL +  K +  + Y+ + K Y D
Sbjct: 700  LCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCLATKDIPEDEYNAWNKKYMD 759

Query: 727  ASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGD 786
            A+ ++ +R ++++AV  + +E  L L+G T +EDKLQ  V  +I  L+ AGIKIW+LTGD
Sbjct: 760  AATTLDHRAEKLDAVAEE-IESGLTLIGATAIEDKLQEGVPDTIRTLQEAGIKIWVLTGD 818

Query: 787  KVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKV----------NKGACLLI 836
            K ETA  + +S +L+S    + II++ TK     N  E L                 L+I
Sbjct: 819  KQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEEKLAALHEHSLSEHDMNTLALVI 878

Query: 837  DGESLGMFLRYYKREFFDVV--ICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGG 894
            DG SL   L     ++F  +  +C   V+ CR +P QKA V  +++  T   +  IGDG 
Sbjct: 879  DGHSLSFALEADLEDYFLAIGKMC-KAVICCRVSPLQKALVVKMVKRKTNSLLLAIGDGA 937

Query: 895  NDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIM 954
            NDVSMIQ A VGVGI G EG QA+ +AD S+ +F  L +LLL HG  SY+R +    +  
Sbjct: 938  NDVSMIQAAHVGVGISGMEGMQAARSADISVGQFRFLKKLLLVHGAWSYQRISVAILYSF 997

Query: 955  HRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSM-TLDHDIEESLTKIY 1013
            ++   + + Q  Y   + F    + + + M  Y   +T+ P F +   D  +   L + Y
Sbjct: 998  YKNTALYMTQFWYVFANAFSGQSIMESWTMSLYNVFFTVLPPFVIGVFDQFVNSRLLERY 1057

Query: 1014 PELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVF---------SSLLEVDFTKMV 1064
            P+LYK   +G+  S   F+ W     +   V+   + +F                ++  +
Sbjct: 1058 PQLYKLGQKGQFFSVSIFWGWIVNGFYHSAVVFVGTILFYRYGFALRKHGETADHWSWGI 1117

Query: 1065 AIGFTALILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLRF-- 1122
            AI +T+ ++  L   AL    W K  +F    +   ++I  P  G  F    +    F  
Sbjct: 1118 AI-YTSSVIIVLGKAALVTNQWTKFTLFAIPGSLFFWLIFFPIYGSIFPYAKISREYFGV 1176

Query: 1123 ----YGELLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157
                YG   F L + V P +A       K   R   P SY  +QE
Sbjct: 1177 VEHTYGSATFWLTLIVLPTFALTRDFIWKYYKRMYAPESYHLIQE 1221

>Kwal_26.7070
          Length = 1315

 Score =  431 bits (1107), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 326/1078 (30%), Positives = 522/1078 (48%), Gaps = 93/1078 (8%)

Query: 159  DDRHMEREIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALS 218
            DD+   R+I+ +         +  N IS  KYN  TFIP  L+++F  + NL+FL  +  
Sbjct: 176  DDKSSPRQIYINDKEANRARGFGSNHISTTKYNLATFIPKFLFQEFSKYANLFFLFTSAI 235

Query: 219  QAIPALRIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQS----KL 274
            Q +P +      + +  L  VL V+  KE ++D++R + D+E N     V ++      L
Sbjct: 236  QQVPNVTPTNRYTTIGTLLIVLIVSAIKEIVEDLKRAQSDSELNDSRAQVFSEQLQDFTL 295

Query: 275  VPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQN 334
                ++ VGD+IK++  + +PAD++++ SSEP G  +I+T  LDGET+ K++ A   T  
Sbjct: 296  SKWVNISVGDIIKVNSEEAIPADVIVIASSEPEGLCYIETANLDGETNLKIKQARIETSK 355

Query: 335  LTEPDLMN--KVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIG 392
              + D +   +  + +  P  +++ + G +     + + LS +  +     L +T +  G
Sbjct: 356  FIDKDDLAGMRGKVLSEHPNSSLYTYEGTMNLNGKNIS-LSPEQMVLRGATLRNTAWIYG 414

Query: 393  CVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHN----- 447
             VV+TG +T+   N T   +K   +E  IN    +   ++F + I+L + +   N     
Sbjct: 415  LVVFTGHETKLMRNATATPIKRTAVERVIN----MQIVALFGVLIVLALISSIGNVIKVT 470

Query: 448  SD-----------------WYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD-DT 489
            SD                 ++ D++ Y ILFS ++P+SL V +++ K   A+ I  D D 
Sbjct: 471  SDAEHLTYLYLQGTNKVGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQAYMIASDLDL 530

Query: 490  IPE-----TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL--DI 542
              E     T+VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y  ET+  D 
Sbjct: 531  YDEASDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGKCYI-ETIPEDK 589

Query: 543  VSDYVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTF-EDDELTYQ 601
             +   D +       +   +++  T   D S  + D +  LA CH V P F ED  + YQ
Sbjct: 590  AATTEDGIEIGFRKFDSMKETLNDTQDPD-SHIINDFLTLLATCHTVIPEFQEDGSIKYQ 648

Query: 602  AASPDEIAIVKFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIV 661
            AASPDE A+V+   S+G     R                 Y++L +  FNS  KRM  I 
Sbjct: 649  AASPDEGALVEGAASLGYKFIIRKPNSVSVLIEDLGQEQEYQLLNICEFNSTRKRMSAIF 708

Query: 662  HDEQKDEYWFMQKGADTVMARIVE--NNDWLEEETGNM---AREGLRTLVVGRKKLSRNI 716
                 +   F  KGADTV+   ++   N ++E    ++   A EGLRTL +  + ++ + 
Sbjct: 709  RLPNGEIKLFC-KGADTVILERLKAGENPYIEATLRHLEDYAAEGLRTLCLASRTVTESE 767

Query: 717  YDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNA 776
            Y ++K  YD AS ++ +R Q+++    + +E DL LLG T +EDKLQ+ V  +I  L++A
Sbjct: 768  YAEWKDIYDAASTTLDDRAQKLDDA-AELIEKDLFLLGATAIEDKLQDGVPETIHTLQDA 826

Query: 777  GIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKV-------- 828
            GIK+W+LTGD+ ETA  + +S +L+S    + II +  K     N  E LK         
Sbjct: 827  GIKVWVLTGDRQETAVNIGMSCRLLSEDMNLLIINEEDKEATRKNLTEKLKAISDHQISQ 886

Query: 829  --NKGACLLIDGESLGMFLRYYKREFFDVV--ICLPTVVACRCTPQQKADVALVIREFTG 884
                   L+IDG+SLG  L     ++   +  +C   V+ CR +P QKA V  +++  T 
Sbjct: 887  QDMNSLALVIDGKSLGFALEADLEDYLLAIGKLC-KAVICCRVSPLQKALVVKMVKRKTD 945

Query: 885  KRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYK 944
              +  IGDG NDVSMIQ A VGVGI G EG QA+ +ADF+I +F +L +LLL HG  SY+
Sbjct: 946  SLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYLKKLLLVHGSWSYQ 1005

Query: 945  RSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSM-TLDH 1003
            R ++   +  ++ + + + Q  Y   + +    + + + M  Y   +T+ P F M   D 
Sbjct: 1006 RISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVFFTVLPPFVMGVFDQ 1065

Query: 1004 DIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSLLEV----- 1058
             +   L   YP+LYK    G+  S + F+ W     +   V    S +F     V     
Sbjct: 1066 FVSSRLLDRYPQLYKLGQRGQFFSVRIFWGWVINGFYHSAVTFIGSTLFYRNGNVLNSHG 1125

Query: 1059 DFTKMVAIGFTALILNELIMV---ALEIYTWNKIMVFTEILTFLCYVISVPFLG------ 1109
            +     A G +    + +I++   AL    W K   F    + + +++  P         
Sbjct: 1126 ETADHWAWGVSIYTCSVIIVIGKAALVTNQWTKFTAFAIPGSLVFWLVFFPIYASILPHA 1185

Query: 1110 ----EYFDLKYMMTLRFYGELLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157
                EY    Y +    YG   F L+  V P +A       K   R   P SY  VQE
Sbjct: 1186 NVSKEY----YGVVSHVYGSATFWLMCIVLPTFALMRDLVWKYYKRTYTPESYHVVQE 1239

>YAL026C (DRS2) [42] chr1 complement(95633..99700) Membrane-spanning
            Ca-ATPase (P-type) required for ribosome assembly and
            involved in late Golgi function, member of the cation
            transporting (E1-E2) P-type ATPase superfamily [4068 bp,
            1355 aa]
          Length = 1355

 Score =  421 bits (1083), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 315/1065 (29%), Positives = 510/1065 (47%), Gaps = 79/1065 (7%)

Query: 165  REIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPAL 224
            R IH + +       Y  N IS  KYN  TF+P  L+++F  + NL+FL  +  Q +P +
Sbjct: 183  RVIHINDSLANSSFGYSDNHISTTKYNFATFLPKFLFQEFSKYANLFFLCTSAIQQVPHV 242

Query: 225  RIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSK--LVPSK--DL 280
                  + +  L  VL V+  KE ++DI+R   D E N+    + +++    V  +  D+
Sbjct: 243  SPTNRYTTIGTLLVVLIVSAMKECIEDIKRANSDKELNNSTAEIFSEAHDDFVEKRWIDI 302

Query: 281  KVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDL 340
            +VGD+I++   + +PAD ++L SSEP G  +I+T  LDGET+ K++ +   T    +   
Sbjct: 303  RVGDIIRVKSEEPIPADTIILSSSEPEGLCYIETANLDGETNLKIKQSRVETAKFIDVKT 362

Query: 341  MNKVS--ITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTG 398
            +  ++  + +  P  +++ + G +T  D    PLS D  +     L +T +  G V++TG
Sbjct: 363  LKNMNGKVVSEQPNSSLYTYEGTMTLNDRQI-PLSPDQMILRGATLRNTAWIFGLVIFTG 421

Query: 399  RDTRQAMNTTTATVKTGLLELEIN-----------------SISKILCASVFALSIILVV 441
             +T+   N T   +K   +E  IN                 SI  ++ ++  A  +  + 
Sbjct: 422  HETKLLRNATATPIKRTAVEKIINRQIIRLFTVLIVLILISSIGNVIMSTADAKHLSYLY 481

Query: 442  FAGFHNSDWYL-DVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD------DTIPETI 494
              G + +  +  D + + ILFS ++P+SL V ++L K   A  I  D       T   T+
Sbjct: 482  LEGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMIGSDLDLYYEKTDTPTV 541

Query: 495  VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL-DIVSDYVDALVNS 553
            VRTS++ E+LG+IEY+ SDKTGTLT+N M+ K   +    Y  +   D  +   D +   
Sbjct: 542  VRTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGHCYIDKIPEDKTATVEDGIEVG 601

Query: 554  SNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDD-ELTYQAASPDEIAIVK 612
                +   K +   S +D S  + D +  LA CH V P F+ D  + YQAASPDE A+V+
Sbjct: 602  YRKFDDLKKKLNDPSDED-SPIINDFLTLLATCHTVIPEFQSDGSIKYQAASPDEGALVQ 660

Query: 613  FTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFM 672
                +G     R                 Y++L +  FNS  KRM  I          F 
Sbjct: 661  GGADLGYKFIIRKGNSVTVLLEETGEEKEYQLLNICEFNSTRKRMSAIFRFPDGSIKLFC 720

Query: 673  QKGADTVMARIV--ENNDWLEEETGNM---AREGLRTLVVGRKKLSRNIYDQFKKDYDDA 727
             KGADTV+   +  E N ++E    ++   A EGLRTL +  + +S   Y+++   Y++A
Sbjct: 721  -KGADTVILERLDDEANQYVEATMRHLEDYASEGLRTLCLAMRDISEGEYEEWNSIYNEA 779

Query: 728  SLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDK 787
            + ++ NR ++++      +E +L L+G T +EDKLQ+ V  +I  L+ AGIKIW+LTGD+
Sbjct: 780  ATTLDNRAEKLDEA-ANLIEKNLILIGATAIEDKLQDGVPETIHTLQEAGIKIWVLTGDR 838

Query: 788  VETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVN------------KGACLL 835
             ETA  + +S +L+S    + II + T+ +   N LE  K+N            K   L+
Sbjct: 839  QETAINIGMSCRLLSEDMNLLIINEETRDDTERNLLE--KINALNEHQLSTHDMKSLALV 896

Query: 836  IDGESLGMFLRYYKREFFDVVICL-PTVVACRCTPQQKADVALVIREFTGKRVCCIGDGG 894
            IDG+SLG  L     ++   V  L   V+ CR +P QKA V  +++  +   +  I  G 
Sbjct: 897  IDGKSLGFALEPELEDYLLTVAKLCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIASGA 956

Query: 895  NDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIM 954
            NDVSMIQ A VGVGI G EG QA+ +AD ++ +F  L +LLL HG  SY+R +    +  
Sbjct: 957  NDVSMIQAAHVGVGISGMEGMQAARSADIALGQFKFLKKLLLVHGSWSYQRISVAILYSF 1016

Query: 955  HRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSM-TLDHDIEESLTKIY 1013
            ++   + + Q  Y   + F    + + + M  Y   +T+ P F +   D  +   L + Y
Sbjct: 1017 YKNTALYMTQFWYVFANAFSGQSIMESWTMSFYNLFFTVWPPFVIGVFDQFVSSRLLERY 1076

Query: 1014 PELYKDLTEGKSLSYKTFFVWCALSLFQGCVI---------QGCSQVFSSLLEVDFTKMV 1064
            P+LYK   +G+  S   F+ W     F   ++          G +      L   ++  V
Sbjct: 1077 PQLYKLGQKGQFFSVYIFWGWIINGFFHSAIVFIGTILIYRYGFALNMHGELADHWSWGV 1136

Query: 1065 AIGFTALILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLK------YMM 1118
             +  T++I+  L   AL    W K  +     + L ++I  P     F         Y +
Sbjct: 1137 TVYTTSVII-VLGKAALVTNQWTKFTLIAIPGSLLFWLIFFPIYASIFPHANISREYYGV 1195

Query: 1119 TLRFYGELLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157
                YG  +F L + V P++A       K   R   P +Y  +QE
Sbjct: 1196 VKHTYGSGVFWLTLIVLPIFALVRDFLWKYYKRMYEPETYHVIQE 1240

>ADR350W [2091] [Homologous to ScYAL026C (DRS2) - SH]
            complement(1320732..1324667) [3936 bp, 1311 aa]
          Length = 1311

 Score =  405 bits (1040), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 321/1067 (30%), Positives = 507/1067 (47%), Gaps = 113/1067 (10%)

Query: 180  YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
            Y  N IS  KYNA TF+P  L+++F  + NL+FL  ++ Q +P +      + +  L  V
Sbjct: 194  YGDNHISTTKYNAATFLPKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRFTTIGTLIVV 253

Query: 240  LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQ--SKLVPSK--DLKVGDLIKISKGDRLP 295
            L V+  KE+++D++R   D E N     V +    + +  K  D+ VGD+I++   + +P
Sbjct: 254  LVVSAIKESVEDLKRSNSDKELNHSRADVYSDEMGQFISKKWIDIAVGDIIRVRSEEAIP 313

Query: 296  ADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKV--SITASAPEK 353
            ADL++L SSEP G  +I+T  LDGET+ K++ A   T  + +   ++ +   I +  P  
Sbjct: 314  ADLIVLSSSEPEGLCYIETANLDGETNLKIKQARPETSKILDVRELSAMRGKILSEQPNT 373

Query: 354  AIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVK 413
            +++ + G +   +    PLS D  L     L +T +  G V++TG +T+   N T   +K
Sbjct: 374  SLYTYEGTMILHNNRI-PLSPDQILLRGATLRNTVWIFGIVIFTGHETKLTRNATATPIK 432

Query: 414  TGLLELEINSISKILCASVFALSIILVVFAGFHN----------------------SDWY 451
               +E  IN    +   ++F + I L + + F N                      + ++
Sbjct: 433  RTAVERVIN----LQIVALFGVLICLSLISSFGNLIVMYNQKENLSYLYLQGTNMVALFF 488

Query: 452  LDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDDTIPETIVRTSTIPEDLG 505
             +++ + ILFS ++P+SL V +++ K   A+ I       H+++   T+VRTS++ E+LG
Sbjct: 489  KNILTFWILFSNLVPISLFVTVEMIKYYQAYMIASDLDLFHEESNMPTVVRTSSLVEELG 548

Query: 506  RIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVP 565
            +IEY+ SDKTGTLTQN M+ K   +    Y     +      D  +            + 
Sbjct: 549  QIEYIFSDKTGTLTQNVMEFKSCSIAGRCYIQSIPEDKDAAFDEGIEVGYRTYDDMHELL 608

Query: 566  STSRKDLSARVRDMVVTLAICHNVTPTF-EDDELTYQAASPDEIAIVKFTESVGLSLFKR 624
             T      A + + +  L+ICH V P F E+  + YQAASPDE A+V+    +G     R
Sbjct: 609  HTPGSGDGAIIDEFLTLLSICHTVIPEFQENGSIKYQAASPDEGALVQGAADLGYKFIIR 668

Query: 625  DRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTV-MARI 683
                             YE+L +  FNS  KRM  I      +    + KGADTV + R+
Sbjct: 669  KPNSVTILREDITEEVVYELLNICEFNSTRKRMSAIFRFPD-NSIRLLCKGADTVILERL 727

Query: 684  VENNDWLEEET----GNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMN 739
               ++     T     + A EGLRTL +  + +  + Y+++ K YD A+ +M NR ++++
Sbjct: 728  AATSNPYVAATLRHLEDYAAEGLRTLCIASRTIPESEYEEWSKLYDAAATTMHNRSEELD 787

Query: 740  AVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 799
             V  + +E  L LLG T +EDKLQ+ V  +I  L+ AGIK+W+LTGD+ ETA  + +S K
Sbjct: 788  KV-AEMIEKGLVLLGATAIEDKLQDGVPETIHTLQQAGIKVWVLTGDRQETAINIGMSCK 846

Query: 800  LISRGQYVHIITKLTKPEGALNQLEYLK-VNKGA---------CLLIDGESLGMFLRYYK 849
            L+S    + I+ + TK     N ++ L+ +N             L+IDG+SLG  L    
Sbjct: 847  LLSEDMNLLIVNEDTKESTRNNLIDKLRAINDHQISQQDMNTLALVIDGKSLGFALEPDL 906

Query: 850  REFFDVV--ICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGV 907
             EF   +  +C   V+ CR +P QKA V  +++  T   +  IGDG NDVSMIQ A VGV
Sbjct: 907  EEFLLAIGKMCR-AVICCRVSPLQKALVVKMVKRRTKSLLLAIGDGANDVSMIQAAHVGV 965

Query: 908  GIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVY 967
            GI G EG QA+ +ADF++ +F +L +LLL HG  SY+R ++   +  ++ + + + Q  Y
Sbjct: 966  GISGMEGMQAARSADFALGQFKYLKKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWY 1025

Query: 968  SICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTLDHDIEESLTKIYPELYKDLTEGKSLS 1027
             + + F    + + + +  Y    T AP          E S       L     +  ++ 
Sbjct: 1026 VLYNAFSGQSIMESWTLTFYNWGGTAAPPGPPKRRDQFERS------GLLNRDAQSCTVG 1079

Query: 1028 YKTFFVWCALSLFQGCVIQGCSQVFSSLLEVDFTKM---------------------VAI 1066
             K  F W A ++F+G  I G    + + + +D   M                     VAI
Sbjct: 1080 QKGQF-WPA-TIFRGSAINGN---YHNWITIDGWIMDYRYGAAGAMHGETADHWVWGVAI 1134

Query: 1067 GFTALILNELIMVALEIYTWNKIMVFT-------EILTFLCYVISVPFLG---EYFDLKY 1116
              T++I   L   AL    W K  V          +L F  Y   +P L    EY    Y
Sbjct: 1135 QPTSIIF-VLGKAALITNQWTKFTVLAIPGSLVFWLLFFPIYAYLLPGLNVSKEY----Y 1189

Query: 1117 MMTLRFYGELLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157
             +    YG   F  +  V PV A       K   R   P SY  VQE
Sbjct: 1190 GIVSHVYGSFTFWAMCYVLPVLALLRDLLWKYYKRTYTPESYHVVQE 1236

>CAGL0L11814g 1262124..1266854 highly similar to sp|P32660
            Saccharomyces cerevisiae YER166w or sp|Q12675
            Saccharomyces cerevisiae YDR093w, start by similarity
          Length = 1576

 Score =  343 bits (879), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 255/865 (29%), Positives = 430/865 (49%), Gaps = 130/865 (15%)

Query: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-T 336
            K +KVGD+++I   D +PAD++LL +S+  G  +++T  LDGET+ K+R A   +  + T
Sbjct: 395  KSVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYVETKNLDGETNLKVRQALKCSYKIKT 454

Query: 337  EPDLM-NKVSITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLASTGFC 390
              D+   +  I +  P   ++++ G + +KD+++N     P++I+N L     L +T + 
Sbjct: 455  SRDIARTRFWIESEGPHANLYSYQGNLKWKDSTNNELRNEPVTINNMLLRGCTLRNTKWA 514

Query: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSII------------ 438
            +G VV+TG DT+  +N      K   +  E+N    I    +F L  I            
Sbjct: 515  MGIVVFTGDDTKIMLNAGVTPTKKSRISRELNFSVLINFLVLFILCFISGLANGIDYDKH 574

Query: 439  --------LVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTI 490
                        AG   ++ ++     +IL+ +++P+SL +++++ K+  A  I  D  +
Sbjct: 575  PRSRDFFEFGTVAGNPATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYGDVLL 634

Query: 491  PETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--------- 535
                +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 635  YNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 694

Query: 536  --------------TSETLDIVSD---YVDALVNSSNSANPSGKSVPSTSR---KDLSAR 575
                            E  +I  D    ++ L N SN+       +   S+   +D   R
Sbjct: 695  GLRKRQGIDVEAEGRREKEEIAKDRDVMINDLRNLSNNTQFFPDEITFISKEIVQDFKGR 754

Query: 576  VRDM--------VVTLAICHNV----TPTFEDDELTYQAASPDEIAIVKFTESVGLSLFK 623
              D+        ++ LA+CH+V    +PT   ++L  +A SPDE A+V     +G     
Sbjct: 755  NGDIQKKCCEHFMLALALCHSVLTEPSPT-NPNKLEMKAQSPDEAALVTTARDLGFCFMG 813

Query: 624  RDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIV-------HDEQKDEYWFMQKGA 676
            + +               +EIL +  FNS  KRM  I+       +DE +     + KGA
Sbjct: 814  KTKTGMVVEIQGIQKE--FEILNILEFNSARKRMSCIIKIPGATPNDEPR--ALLICKGA 869

Query: 677  DTVM-----ARIVENNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYDDA 727
            D+V+      +  EN++ L E+T       A EGLRTL + +++L+ + Y ++   YD A
Sbjct: 870  DSVIYSRLSTKAGENDETLLEKTALHLEQYATEGLRTLCLAQRELTWSEYTEWNARYDIA 929

Query: 728  SLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDK 787
            + S+ NR++Q+  +++  +E DL LLG T +ED+LQ+ V  SI LL  AGIK+W+LTGDK
Sbjct: 930  AASLTNREEQLE-IVSDSIERDLILLGGTAIEDRLQDGVPESIALLAEAGIKLWVLTGDK 988

Query: 788  VETARCVSISAKLISRGQYVHIITKLTK--------PEGALNQL--EYLKVNKGA----- 832
            VETA  +  S  L++    + ++    +        P   +N L  +YL+   G      
Sbjct: 989  VETAINIGFSCNLLNNDMELLVVKTAGEDVLEYGEDPHEVVNSLISKYLREKFGLSGSEM 1048

Query: 833  ----------------CLLIDGESLGMFLRY--YKREFFDVVICLPTVVACRCTPQQKAD 874
                             ++IDG++L + L     KR+F  +      V+ CR +P QKA 
Sbjct: 1049 ELDNAKGDHSFPKGDFAVVIDGDALKIALTGDDMKRKFLLLCKNCKAVLCCRVSPAQKAA 1108

Query: 875  VALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTEL 934
            V  +++         IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I +F +LT L
Sbjct: 1109 VVKLVKNTLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYLTRL 1168

Query: 935  LLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMA 994
            LL HGR SYKR +++     ++ ++  +    Y I + F+   L++   ++ Y   +T  
Sbjct: 1169 LLVHGRWSYKRLSEMIPEFFYKNVIFTLALFWYGIYNNFDGSYLFEYTYLMFYNLAFTSI 1228

Query: 995  PVFSM-TLDHDIEESLTKIYPELYK 1018
            PV  +  LD D+ ++++ + P+LY+
Sbjct: 1229 PVILLGILDQDVNDTISLVVPQLYR 1253

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 85/205 (41%), Gaps = 23/205 (11%)

Query: 66  ENKDKLQESFEMKSLNARNGGL-GHSRNSSNGDRQPLMHDSASNPDGSPYKYTNVSESAL 124
           +N D    S EMK L      + GH     N  R   +  +  N   +P+   +  E   
Sbjct: 91  DNDDHNDSSREMKRLRMGTRRVKGHKSQFGNMSRNKTLKWAKKNIK-NPFDDFSRDEEEE 149

Query: 125 NLHSNNRFSNWITKLKMVGAQKWKKFHTMGSVELDDRHMEREIHPSTTPVYDRNRYPGNE 184
           N  S NR      +L+ V       +H +    L +  ++ E +P          YP N+
Sbjct: 150 NDRSTNR----ADQLRTV-------YHNL---PLPEEMLDEEGNPIM-------EYPRNK 188

Query: 185 ISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFVLTVTM 244
           I   KY   +F P  L  QF+ F N+YFLV+ +  A     +       VPL  ++ +T 
Sbjct: 189 IRTTKYTPLSFFPKNLLFQFQNFANVYFLVLIILGAFQIFGVTNPGLSAVPLIVIVIITA 248

Query: 245 SKEAMDDIQRRRRDNESNSELYHVL 269
            K+ ++D +R   D E N+   H+L
Sbjct: 249 IKDGIEDSRRTILDLEVNNTRTHIL 273

>Scas_576.8
          Length = 1591

 Score =  338 bits (868), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 266/945 (28%), Positives = 462/945 (48%), Gaps = 143/945 (15%)

Query: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-- 335
            K++KVGD+++I   D +PAD++LL +S+  G  +++T  LDGET+ K+R +   + ++  
Sbjct: 415  KNVKVGDIVRIHNNDEIPADIILLSTSDSDGGCYLETKNLDGETNLKVRESLKCSHSIRN 474

Query: 336  TEPDLMNKVSITASAPEKAIHNFLGKVTYKDTS-----SNPLSIDNTLWANTVLASTGFC 390
            +      K  + +  P   ++++ G V + D+      + P++I+N L     L +T + 
Sbjct: 475  SRDIARTKFWVESEGPHANLYSYQGNVKWVDSKDGDLKNEPVTINNLLLRGCTLRNTKWA 534

Query: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVF-------- 442
            +G VV+TG DT+  +N+     K   +  E+N     L  S+  L + ++ F        
Sbjct: 535  MGMVVFTGDDTKIMLNSGATPTKKSRISRELN-----LSVSLNFLFLFIICFISAIINGV 589

Query: 443  -----------------AGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE 485
                             AG  +++ ++     +IL+ +++P+SL +++++ K+  A  I 
Sbjct: 590  DYDKHPRSRDFFEFGTVAGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIY 649

Query: 486  HDDTIPETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY---- 535
             D  +    +      ++  I +D+G+IEY+ SDKTGTLTQN M+ KK  +  +SY    
Sbjct: 650  GDVLLYNAKLDYPCTPKSWNISDDMGQIEYIFSDKTGTLTQNVMEFKKCTINGISYGRAY 709

Query: 536  --------TSETLDI----------VSDYVDALVNSSNSANPSGKSVPS----TSRK--- 570
                      + +D+          ++   D ++N+  + + + +  P      S++   
Sbjct: 710  TEALAGLRKRQGIDVEEEGRREKEEIAKDRDTMINTLRNLSHNSQFYPDDITFISKEFVN 769

Query: 571  DLSARVRDM--------VVTLAICHNV--TPTFEDDE-LTYQAASPDEIAIVKFTESVGL 619
            DL     DM        ++ LA+CH+V   P   D + L  +A SPDE A+V     VG 
Sbjct: 770  DLKGASGDMQQKCCEHFMLALALCHSVLVEPNKHDSKKLDVKAQSPDEAALVCTARDVGF 829

Query: 620  SLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIV-----HDEQKDEYWFMQK 674
            S   + +               ++IL    FNS  KRM  IV     + + +     + K
Sbjct: 830  SFIGKTKTGLIIEVQGVQKE--FQILNTLEFNSTRKRMSCIVKIPGANPDDEPRALLICK 887

Query: 675  GADTVM-----ARIVENNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYD 725
            GAD+++      +   N++ L E+T       A EGLRTL + +++LS   Y ++ K YD
Sbjct: 888  GADSIIYSRLGTKNGANSENLLEKTALHLEQYATEGLRTLCIAQRELSWPEYLEWNKRYD 947

Query: 726  DASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTG 785
             A+ S+ NR++Q+ AV +  +E +L LLG T +ED+LQ+ V  SI +L  AGIK+W+LTG
Sbjct: 948  IAAASVTNREEQLEAV-SDEIERELTLLGGTAIEDRLQDGVPESISILAQAGIKLWVLTG 1006

Query: 786  DKVETARCVSISAKLI----------SRGQYVH------------IITKLTKPEGAL--N 821
            DKVETA  +  S  L+          + G  V             +ITK  + +  L  +
Sbjct: 1007 DKVETAINIGFSCNLLNNDMELLVVKTNGDDVQEFGNDPAEIAESLITKYLREKFGLTGS 1066

Query: 822  QLEYLKVNKGA-------CLLIDGESLGMFL--RYYKREFFDVVICLPTVVACRCTPQQK 872
            ++E     K          ++IDGE+L + L     +R+F  +      V+ CR +P QK
Sbjct: 1067 EMELADAKKNHDFPRGDFAVVIDGEALKLALNGESIRRKFLLLCKNCKAVLCCRVSPAQK 1126

Query: 873  ADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLT 932
            A V  ++          IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I +F +LT
Sbjct: 1127 AAVVKLVMTSLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYLT 1186

Query: 933  ELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYT 992
             L+L HGR SY+R A++     ++ ++  +    Y I + F+   L++   ++ Y   +T
Sbjct: 1187 RLVLVHGRWSYRRLAEMIPAFFYKNVIFTLALFWYGIYNNFDGSYLFEYTFLMFYNLAFT 1246

Query: 993  MAPVFSM-TLDHDIEESLTKIYPELYK------DLTEGKSLSY--KTFFVWCALSLFQGC 1043
              PV  M  +D D+ ++++ + P+LY+      D  + K L Y     +  C    F  C
Sbjct: 1247 SLPVIFMGIMDQDVSDTVSLVMPQLYRSGILRLDWNQTKFLWYMLDGLYQSCICFFFPYC 1306

Query: 1044 VIQGCSQVFSSLLEVDFTKMVAIGFTAL-ILNELIMVALEIYTWN 1087
            +      V ++ L +D    V +  T+L +++  I + L  Y W+
Sbjct: 1307 LYHKNQIVSNNGLGLDHRFYVGVMVTSLAVVSCNIYMLLHQYRWD 1351

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 3/97 (3%)

Query: 173 PVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSY 232
           P+ D   YP N+I   KY+   F P  +  QF+ F N+YFLV+ +  A     +      
Sbjct: 197 PITD---YPRNKIRTTKYSPLNFFPKNIMFQFQNFANVYFLVLIILGAFQIFGVTNPGLA 253

Query: 233 VVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVL 269
            VPL  ++ +T  K+A++D +R   D E N+   H+L
Sbjct: 254 AVPLIVIVIITAIKDAIEDSRRTLLDMEVNNTRTHIL 290

>YER166W (DNF1) [1594] chr5 (512739..517454) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to S. cerevisiae Drs2p, which is a
            membrane-spanning Ca-ATPase (P-type) required for
            ribosome assembly and involved in late Golgi function
            [4716 bp, 1571 aa]
          Length = 1571

 Score =  338 bits (867), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 262/894 (29%), Positives = 439/894 (49%), Gaps = 136/894 (15%)

Query: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-T 336
            K +KVGD+++I   D +PAD++LL +S+  G  +++T  LDGET+ K+R +   T  + T
Sbjct: 399  KGVKVGDIVRIHNNDEIPADIILLSTSDTDGACYVETKNLDGETNLKVRQSLKCTNTIRT 458

Query: 337  EPDLM-NKVSITASAPEKAIHNFLGKVTYKDTS-----SNPLSIDNTLWANTVLASTGFC 390
              D+   K  I +  P   ++ + G + +++ +     + P++I+N L     L +T + 
Sbjct: 459  SKDIARTKFWIESEGPHSNLYTYQGNMKWRNLADGEIRNEPITINNVLLRGCTLRNTKWA 518

Query: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDW 450
            +G V++TG DT+  +N+     K   +  E+N  S ++    F L  IL   +G  N  +
Sbjct: 519  MGVVMFTGGDTKIMLNSGITPTKKSRISRELN-FSVVIN---FVLLFILCFVSGIANGVY 574

Query: 451  YLDVMR------------------------YLILFSTIIPVSLRVNLDLAKSVYAHQIEH 486
            Y    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 575  YDKKGRSRFSYEFGTIAGSAATNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAAFIYG 634

Query: 487  DDTIPETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY----- 535
            D  +    +      ++  I +DLG++EY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 635  DVLLYNAKLDYPCTPKSWNISDDLGQVEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 694

Query: 536  ------------------TSETLDIVSD---YVDALVNSSNSANPSGKSVPSTSR----- 569
                                E  +I  D    +D L   S ++    + V   S+     
Sbjct: 695  EALAGLRKRQGIDVETEGRREKAEIAKDRDTMIDELRALSGNSQFYPEEVTFVSKEFVRD 754

Query: 570  -KDLSARVRD-----MVVTLAICHNVTPTFEDD---ELTYQAASPDEIAIVKFTESVGLS 620
             K  S  V+       ++ LA+CH+V      D   +L  +A SPDE A+V     VG S
Sbjct: 755  LKGASGEVQQRCCEHFMLALALCHSVLVEANPDNPKKLDLKAQSPDEAALVATARDVGFS 814

Query: 621  LFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVH-------DEQKDEYWFMQ 673
               + +               +EIL +  FNS  KRM  IV        DE +     + 
Sbjct: 815  FVGKTKKGLIIEMQGIQKE--FEILNILEFNSSRKRMSCIVKIPGLNPGDEPR--ALLIC 870

Query: 674  KGADTVM-ARIVE----NNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDY 724
            KGAD+++ +R+      N++ + E+T       A EGLRTL + +++LS + Y+++ + Y
Sbjct: 871  KGADSIIYSRLSRQSGSNSEAILEKTALHLEQYATEGLRTLCIAQRELSWSEYEKWNEKY 930

Query: 725  DDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLT 784
            D A+ S+ NR+ ++  V+   +E +L LLG T +ED+LQ+ V   IELL  AGIK+W+LT
Sbjct: 931  DIAAASLANREDELE-VVADSIERELILLGGTAIEDRLQDGVPDCIELLAEAGIKLWVLT 989

Query: 785  GDKVETARCVSISAKLISRGQYVHIITKL--------TKPEGALNQL--EYLK------- 827
            GDKVETA  +  S  L++    + +I           ++P   ++ L  +YLK       
Sbjct: 990  GDKVETAINIGFSCNLLNNEMELLVIKTTGDDVKEFGSEPSEIVDALLSKYLKEYFNLTG 1049

Query: 828  -------------VNKGA-CLLIDGESLGMFL--RYYKREFFDVVICLPTVVACRCTPQQ 871
                           KG   ++IDG++L + L     +R+F  +      V+ CR +P Q
Sbjct: 1050 SEEEIFEAKKDHEFPKGNYAIVIDGDALKLALYGEDIRRKFLLLCKNCRAVLCCRVSPSQ 1109

Query: 872  KADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHL 931
            KA V  ++++        IGDG NDV+MIQ ADVG+GI G+EG+QA + +D++I +F +L
Sbjct: 1110 KAAVVKLVKDSLDVMTLAIGDGSNDVAMIQSADVGIGIAGEEGRQAVMCSDYAIGQFRYL 1169

Query: 932  TELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCY 991
              L+L HGR SYKR A++     ++ ++ A+    Y I + F+   LY+   M+ Y   +
Sbjct: 1170 ARLVLVHGRWSYKRLAEMIPEFFYKNMIFALALFWYGIYNDFDGSYLYEYTYMMFYNLAF 1229

Query: 992  TMAPV-FSMTLDHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCV 1044
            T  PV F   LD D+ ++++ + P+LY+     K  + + F  +    L+Q  +
Sbjct: 1230 TSLPVIFLGILDQDVNDTISLVVPQLYRVGILRKEWNQRKFLWYMLDGLYQSII 1283

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (52%)

Query: 179 RYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAF 238
           +YP N+I   KY   TF+P  +  QF  F N+YFLV+ +  A     +       VPL  
Sbjct: 190 QYPRNKIRTTKYTPLTFLPKNILFQFHNFANVYFLVLIILGAFQIFGVTNPGLSAVPLVV 249

Query: 239 VLTVTMSKEAMDDIQRRRRDNESNSELYHVL 269
           ++ +T  K+A++D +R   D E N+   H+L
Sbjct: 250 IVIITAIKDAIEDSRRTVLDLEVNNTKTHIL 280

>AGR120C [4431] [Homologous to ScYER166W (DNF1) - SH; ScYDR093W (DNF2)
            - SH] (972456..977099) [4644 bp, 1547 aa]
          Length = 1547

 Score =  334 bits (856), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 286/1028 (27%), Positives = 475/1028 (46%), Gaps = 163/1028 (15%)

Query: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTE 337
            KD++VGD+++I   D +PAD++LL +S+  G  +++T  LDGET+ K+R +   +  +  
Sbjct: 406  KDIRVGDIVRIHNNDEIPADIILLSTSDADGACYVETKNLDGETNLKVRQSLKCSHRIRN 465

Query: 338  PDLMNKVS--ITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLASTGFC 390
               +++    + +  P   ++++ G   + D+ +      P++I+N L     L +T + 
Sbjct: 466  SKDISRCKFWVESEGPHANLYSYQGNFKWVDSETGVMHNEPVNINNMLLRGCSLRNTKWA 525

Query: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDW 450
            +G V++TG DT+  +N      K   +  E+N  S IL    F    +L + AG  N  +
Sbjct: 526  MGIVMFTGTDTKIMLNAGVTPTKRSRISRELN-YSVILN---FVFLFVLCLAAGLVNGIY 581

Query: 451  Y------------------------LDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 486
            Y                        L     LIL+ +++P+SL +++++ K+  A  I  
Sbjct: 582  YRRDATSRTFFEFGTVAGTPFANGILAFFVALILYQSLVPISLYISIEIIKTAQAAFIYG 641

Query: 487  DDTI--PE----TIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY----- 535
            D  +  P+       RT  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 642  DVLLYNPKLDYPCTPRTWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 701

Query: 536  -------TSETLDIV--------------SDYVDALVNSSNSANPSGKSVPSTSR---KD 571
                     + +DI                  V+ L+    ++     +V   S+   +D
Sbjct: 702  EALAGLRKRQGVDIEEEGARERAEIEEDKKQMVELLLKLGKNSQLDPHTVTFVSKELVQD 761

Query: 572  LSAR--------VRDMVVTLAICHNVT---PTFEDDELTYQAASPDEIAIVKFTESVGLS 620
            L           V   +++LA+CH+V         ++L  +A SPDE A+V+    +G S
Sbjct: 762  LGGANSQEQKEAVEHFMLSLALCHSVVVEENKNNPEKLDIKAQSPDEAALVETARDMGFS 821

Query: 621  LFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDE-----YWFMQKG 675
               R +               + IL V  FNS  KRM  IV     DE        + KG
Sbjct: 822  FVGRTKNGVIIEIQGVQKE--FRILNVLEFNSTRKRMSCIVKIPAADENSKPKALLLCKG 879

Query: 676  ADTVMARIVE---NNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYDDAS 728
            AD+V+   ++   N+  L E T       A EGLRTL V ++++  + Y  + +  + A+
Sbjct: 880  ADSVIYSRLDRSRNDPKLLERTALHLEQFATEGLRTLCVAQREIDWDEYLNWNERRELAA 939

Query: 729  LSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKV 788
             S+ NR++ +  V    +E  L LLG T +ED+LQ+ V  SI +L +AGIK+W+LTGDKV
Sbjct: 940  ASLDNREEALERV-ADAIERQLVLLGGTAIEDRLQDGVPDSISILADAGIKLWVLTGDKV 998

Query: 789  ETARCVSISAKLI----------SRGQYV---------------------HIITKLTKPE 817
            ETA  +  S  L+          S G+ V                     H   K +  E
Sbjct: 999  ETAINIGFSCNLLGSDMELLVIKSSGEDVEHLGEKDSDVVLALIDKYLETHFNMKGSPEE 1058

Query: 818  GALNQLEYLKVNKGACLLIDGESLGMFLRY--YKREFFDVVICLPTVVACRCTPQQKADV 875
             A  + ++        ++IDG++L + L     +R+F  +      V+ CR +P QKA V
Sbjct: 1059 LAAARKDHTPPQSAFGVVIDGDALKLALHGEDIRRKFLLLCKNCKAVLCCRVSPSQKAAV 1118

Query: 876  ALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELL 935
              +++E        IGDG NDV+MIQ ADVG+GI G+EG+QA ++AD++I +F +LT L+
Sbjct: 1119 VKLVKESLDVVTLAIGDGSNDVAMIQAADVGIGIAGEEGRQAVMSADYAIGQFRYLTRLV 1178

Query: 936  LWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAP 995
            L HGR SYKR A++     ++ +   +    + ICS ++   L++   ++ Y   +T  P
Sbjct: 1179 LVHGRWSYKRLAEMIPQFFYKNITFTLALFWFGICSNYDGSYLFEYTYLMFYNLAFTSLP 1238

Query: 996  V-FSMTLDHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVI--------- 1045
            V F   +D D  + L+ + P+LYK        +   F+ +C   ++Q  +          
Sbjct: 1239 VIFLGIMDQDASDVLSVVVPQLYKVGILRTEWTQNKFWWYCFDGVYQSIICFFFPYLCYY 1298

Query: 1046 -QGCSQVFSSLLEVDFTKMVAIGFTALILNELIMVALEIYTWNKIMVFTEILTFL-CYVI 1103
              G     +  L+  +T  V +   A++   L  V +  Y W+    FT +  FL C ++
Sbjct: 1299 RTGLITKNAYGLDHRYTFGVFVTSIAVVSCNL-YVLIHQYRWD---WFTTLFIFLSCGIL 1354

Query: 1104 --------SVPFLGEYFDLKYMMTLRFYGELLF--ILLVSV----FPVWAAKAIHRRLHP 1149
                    S  + GE+    Y   +R Y + +F  +L V V     P +   A+ +   P
Sbjct: 1355 FFWTGVWSSATYSGEF----YKTAVRLYAQPVFWAVLFVGVIFCLLPRFTWDAVQKLFFP 1410

Query: 1150 PSYAKVQE 1157
                 V+E
Sbjct: 1411 RDIDIVRE 1418

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 47/91 (51%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           YP N+I   KY   +F+P  L  QFK   N+YFL++     +    +   +   +PL  +
Sbjct: 203 YPRNKIRTTKYTPLSFLPKNLAYQFKNAANIYFLLLVCLSFVSIFGVTNPALAAIPLIAI 262

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVLN 270
           + +T  K+A +D +R   D E N+   H+L+
Sbjct: 263 VVITGLKDAFEDSRRTILDLEVNNMRSHILH 293

>Scas_636.16
          Length = 1554

 Score =  333 bits (855), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 287/1027 (27%), Positives = 480/1027 (46%), Gaps = 159/1027 (15%)

Query: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-- 335
            K+++VGD+++I   D +PAD++LL +S+  G  +++T  LDGE++ K+R +   T  +  
Sbjct: 378  KNVRVGDIVRIHNNDEIPADVILLSTSDIDGGCYVETKNLDGESNLKVRQSLRCTNAIRN 437

Query: 336  TEPDLMNKVSITASAPEKAIHNFLGKVTYKD-----TSSNPLSIDNTLWANTVLASTGFC 390
            +      K  + +  P   ++ + G + + D     T + P++I+N L     L +T + 
Sbjct: 438  SRDICRTKFWVESEGPHANLYVYQGNLKWIDSLDGQTHNEPITINNMLLRGCTLRNTKWA 497

Query: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDW 450
            +G VV+TG DT+  +N      K   +  E+N    +L   VF    IL + AG  N  +
Sbjct: 498  MGIVVFTGDDTKTMINAGVTPTKKSRISRELN--FSVLINFVFLF--ILCLIAGVANGAY 553

Query: 451  YLDVMR------------------------YLILFSTIIPVSLRVNLDLAKSVYAHQIEH 486
            Y    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 554  YRKKPRSRDFFEFGTIAGNPTTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYL 613

Query: 487  DDTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTS-- 537
            D  +       P T  ++ +I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY    
Sbjct: 614  DVLLYNERLDYPCT-PKSWSISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAY 672

Query: 538  ---------------------ETLDIVSD---YVDALVNSSNSANPSGKSVPSTSR---K 570
                                 E   I  D    +D L   SN++    + +   S+   +
Sbjct: 673  TEALAGLRKRQGIDTEKEGRIEREGIAQDREIMIDDLRKISNNSQFYPEELTFVSKEFSQ 732

Query: 571  DL--------SARVRDMVVTLAICHN--VTPTFED-DELTYQAASPDEIAIVKFTESVGL 619
            DL          R +  ++ LA+CH+  V P   D ++L   A SPDE A+V     +G 
Sbjct: 733  DLLGNNGEVQQKRCQHFMLALALCHSVLVEPDKNDPNKLELTAQSPDETALVTTARDMGF 792

Query: 620  SLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVH---DEQKDE--YWFMQK 674
            S   + +               ++IL +  FNS  KRM  IV      +KDE     + K
Sbjct: 793  SFIGKTKQGLLVEVQGIQKE--FQILNILEFNSSRKRMSCIVKLPPATEKDEPRALLICK 850

Query: 675  GADTVM-ARIVE----NNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYD 725
            GAD+V+ +R+      N++ L E+T       A EGLRTL VG++++S + Y ++ + Y+
Sbjct: 851  GADSVIYSRLSRKPGYNDETLLEKTALHLEQYATEGLRTLCVGQREISWSEYQEWNEKYN 910

Query: 726  DASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTG 785
             A+ S+  R+++++ V    +E DL LLG T +ED+LQ+ V  SI LL  AGIK+W+LTG
Sbjct: 911  IAAASLAGREEELDHV-ADLIERDLVLLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTG 969

Query: 786  DKVETARCVSISAKLISRGQYVHIITKLTK--------PEGALNQL--EYL--KVNKGA- 832
            DKVETA  +  S  L++    + +I    +        P   +N L  +YL  K N    
Sbjct: 970  DKVETAINIGFSCNLLNTDMELLVIKTTGEDVKEFGDDPTEIVNALVSKYLMEKFNMTGS 1029

Query: 833  ------------------CLLIDGESLGMFLR--YYKREFFDVVICLPTVVACRCTPQQK 872
                               ++IDGE+L + L     KR+F  +      V+ CR +P QK
Sbjct: 1030 EEELAAAKKDHSPPQGEFAIIIDGEALKIALTGDTMKRKFLLLCKNCKAVLCCRVSPAQK 1089

Query: 873  ADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLT 932
            A V  ++++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I +F ++T
Sbjct: 1090 AAVVKLVKDTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVT 1149

Query: 933  ELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYT 992
             L+L HG+  YKR A++     ++ ++  +    Y + + F+   L++   +  Y   +T
Sbjct: 1150 RLVLVHGKWCYKRLAEMIPQFFYKNVIFTLALFWYGVHNDFDGSYLFEYTYLTFYNLAFT 1209

Query: 993  MAPV-FSMTLDHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALS---------LFQG 1042
              PV F   LD D+  +++ I P+LY+     +  + +T F+W              F  
Sbjct: 1210 SLPVIFLGILDQDVSATVSMIVPQLYRSGILRQEWN-QTKFLWYMFDGIYQSVICYFFPY 1268

Query: 1043 CVIQGCSQVFSSLLEVDFTKMVAIGFTALILNEL-IMVALEIYTWNKIMVFTEILTFLCY 1101
             + +  + +  + L +D    V I  T + +      V +E Y W+    FT    FL  
Sbjct: 1269 LIYRKTNIITQNGLGLDHRYYVGIPVTGIAVTSCNFYVLMEQYRWD---WFTTFFAFLST 1325

Query: 1102 VISVPFLG---------EYFDLKYMM--TLRFYGELLFILLVSVFPVWAAKAIHRRLHPP 1150
            ++   + G         E++     M  T  F+       L  + P +      + L+P 
Sbjct: 1326 IVYFGWTGIWSSSIASYEFWKGASRMYGTPSFWAVYFVGFLFCILPRFTYDVFMKYLYPS 1385

Query: 1151 SYAKVQE 1157
                ++E
Sbjct: 1386 DVEIIRE 1392

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           YP N+I   KY   TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 168 YPRNKIRTTKYTPLTFFPKNVMLQFNNFANIYFLIMIILGAFQIFGVTNPGLAAVPLIVI 227

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVL 269
           + +T  K+A++D +R   D E N+   H+L
Sbjct: 228 IILTAIKDAIEDSRRTLLDMEVNNTRTHIL 257

>CAGL0G08085g 763185..767921 highly similar to sp|Q12675 Saccharomyces
            cerevisiae YDR093w, hypothetical start
          Length = 1578

 Score =  332 bits (850), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 254/889 (28%), Positives = 440/889 (49%), Gaps = 127/889 (14%)

Query: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-T 336
            K++KVGD+++I   + +PAD++LL +S+  G  +++T  LDGET+ K+R +   T ++ +
Sbjct: 406  KNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETNLKVRQSMKCTSDIRS 465

Query: 337  EPDLMN-KVSITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLASTGFC 390
              D+   +  I +  P   ++++ G   +     N     P++I+N L     L +T + 
Sbjct: 466  SIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVNINNLLLRGCTLRNTKWA 525

Query: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAG-FHN-- 447
            +G V +TG DT+  +N      K   +  E+N       A +F L  I  ++ G +HN  
Sbjct: 526  MGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFALLFVLCFIAGLYNGIYHNKH 585

Query: 448  -----------------SDWYLDVMRYLILFSTIIPVSLRVNLDLAKS-----VYAHQIE 485
                             +  ++     +IL+ +++P+SL +++++ K+     +Y   + 
Sbjct: 586  PRSRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYLDVMM 645

Query: 486  HDDTIPETIVRTS-TIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY--------- 535
            +++ +       S  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY         
Sbjct: 646  YNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEALA 705

Query: 536  ---TSETLDIV--------------SDYVDALVNSSNSANPSGKSVPSTSRK---DLSA- 574
                 + +D+                + ++ L N + ++      V   S++   DL+  
Sbjct: 706  GLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNLAKNSQFYEDEVTFVSKEFVDDLTGG 765

Query: 575  -------RVRDMVVTLAICHNV--TPTFEDD-ELTYQAASPDEIAIVKFTESVGLSLFKR 624
                     +  ++ LA+CH+V   P+ ED  +L  +A SPDE A+V     +G S  K+
Sbjct: 766  SGSVQQKSCQHFMLALALCHSVLTEPSKEDPAKLEIKAQSPDEAALVTTARDMGFSFLKK 825

Query: 625  DRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVH-----DEQKDEYWFMQKGADTV 679
             +               ++IL +  FNS  KRM  IV         K +   + KGAD+V
Sbjct: 826  TKEGMVLEVQGIEKE--FQILNILEFNSSRKRMSCIVKIPGDDANGKPKALLICKGADSV 883

Query: 680  MARIVE----NNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSM 731
            +   ++    N + L E+T       A EGLRTL + +++LS   Y+++ K YD A+ ++
Sbjct: 884  IYSRLDKTGLNEESLLEKTALHLEQYATEGLRTLCLAQRELSWEEYERWNKKYDIAAAAV 943

Query: 732  VNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETA 791
            V+R++++  V +  +E  L LLG T +ED+LQ+ V  SI LL  AGIK+W+LTGDKVETA
Sbjct: 944  VDREEELEKV-SDEIERHLILLGGTAIEDRLQDGVPDSIALLGEAGIKLWVLTGDKVETA 1002

Query: 792  RCVSISAKLISRGQYVHIITKLTKPE------------------------GALNQLEYLK 827
              +  S  L++    + +I K T P+                        G     E LK
Sbjct: 1003 INIGFSCNLLNNDMELLVI-KTTGPDVEDLGATPKDIVDTLISQYLHDKFGMAGSEEELK 1061

Query: 828  VNKGA--------CLLIDGESLGMFLRY--YKREFFDVVICLPTVVACRCTPQQKADVAL 877
              K           ++IDGE+L   L     KR+F  +     +V+ CR +P QKA V  
Sbjct: 1062 KAKAEHDIPRGEFAVIIDGEALKYALSTEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVK 1121

Query: 878  VIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLW 937
            +++         IGDG NDV+MIQ A++GVGI G+EG+QA +++D++I +F +LT LLL 
Sbjct: 1122 LVKNTLDVMTLAIGDGSNDVAMIQSANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLV 1181

Query: 938  HGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVF 997
            HG+  YKR A++     ++ ++  +    + I + ++   L++   +  Y   +T  PV 
Sbjct: 1182 HGKWCYKRLAEMIPQFFYKNMIFTLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVI 1241

Query: 998  SMTL-DHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCAL-SLFQGCV 1044
             + + D D+ ++++ ++P+LY+     K  S +T F+W  L  L+Q  +
Sbjct: 1242 LLGIFDQDVSDTISLVFPQLYRVGILRKEWS-QTKFLWYMLDGLYQSVI 1289

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           YP N+I   KY   TF+P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 196 YPRNKIRTTKYTPLTFLPKNILLQFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLIVI 255

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVL 269
           + +T  K+ ++D +R   D E N+   HVL
Sbjct: 256 IIITAIKDGIEDSRRTVLDLEVNNTKTHVL 285

>YDR093W (DNF2) [945] chr4 (631276..636114) Member of the haloacid
            dehalogenase or epoxide hydrolase family, has low
            similarity to familial intrahepatic cholestasis 1 (human
            ATP8B1), which is an aminophospholipid ATPase transporter
            associated with familial intrahepatic cholestasis [4839
            bp, 1612 aa]
          Length = 1612

 Score =  330 bits (847), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 259/883 (29%), Positives = 445/883 (50%), Gaps = 131/883 (14%)

Query: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNL-T 336
            K++KVGD++++   D +PAD++LL +S+  G  +++T  LDGET+ K+R +   ++ + +
Sbjct: 444  KNVKVGDIVRVHNNDEIPADMILLSTSDVDGACYVETKNLDGETNLKVRQSLKCSKIIKS 503

Query: 337  EPDLMN-KVSITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLASTGFC 390
              D+   K  + +  P   ++++ G   ++DT +      P++I+N L     L +T + 
Sbjct: 504  SRDITRTKFWVESEGPHANLYSYQGNFKWQDTQNGNIRNEPVNINNLLLRGCTLRNTKWA 563

Query: 391  IGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDW 450
            +G V++TG DT+  +N      K   +  E+N  S IL    F L  IL   AG  N  +
Sbjct: 564  MGMVIFTGDDTKIMINAGVTPTKKSRISRELN-FSVILN---FVLLFILCFTAGIVNGVY 619

Query: 451  YLDVMR------------------------YLILFSTIIPVSLRVNLDLAKSVYAHQIEH 486
            Y    R                         +IL+ +++P+SL +++++ K+  A  I  
Sbjct: 620  YKQKPRSRDYFEFGTIGGSASTNGFVSFWVAVILYQSLVPISLYISVEIIKTAQAIFIYT 679

Query: 487  DDTIPETIV------RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY----- 535
            D  +    +      ++  I +DLG+IEY+ SDKTGTLTQN M+ KK  +  VSY     
Sbjct: 680  DVLLYNAKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYT 739

Query: 536  -------TSETLDIVSD--------------YVDALVNSSNSANPSGKSVPSTSRK---D 571
                     + +D+ S+               +D L + S++     + +   S++   D
Sbjct: 740  EALAGLRKRQGVDVESEGRREKEEIAKDRETMIDELRSMSDNTQFCPEDLTFVSKEIVED 799

Query: 572  LSARVRD--------MVVTLAICHNV--TPTFED-DELTYQAASPDEIAIVKFTESVGLS 620
            L     D         ++ LA+CH+V   P  +D  +L  +A SPDE A+V     +G S
Sbjct: 800  LKGSSGDHQQKCCEHFLLALALCHSVLVEPNKDDPKKLDIKAQSPDESALVSTARQLGYS 859

Query: 621  LFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVH---DEQKDE--YWFMQKG 675
                 +               +++L V  FNS  KRM  I+       KDE     + KG
Sbjct: 860  FVGSSKSGLIVEIQGVQKE--FQVLNVLEFNSSRKRMSCIIKIPGSTPKDEPKALLICKG 917

Query: 676  ADTVM-ARI--VENNDWLEEETG----NMAREGLRTLVVGRKKLSRNIYDQFKKDYDDAS 728
            AD+V+ +R+   +N+  L E+T       A EGLRTL + +++L+ + Y+++ K YD A+
Sbjct: 918  ADSVIYSRLDRTQNDATLLEKTALHLEEYATEGLRTLCLAQRELTWSEYERWVKTYDVAA 977

Query: 729  LSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKV 788
             S+ NR+++++ V T  +E +L LLG T +ED+LQ+ V  SI LL  AGIK+W+LTGDKV
Sbjct: 978  ASVTNREEELDKV-TDVIERELILLGGTAIEDRLQDGVPDSIALLAEAGIKLWVLTGDKV 1036

Query: 789  ETARCVSISAKLI----------SRGQYV------------HIITKLTKPE----GALNQ 822
            ETA  +  S  ++          + G+ V            +++TK  + +    G+  +
Sbjct: 1037 ETAINIGFSCNVLNNDMELLVVKASGEDVEEFGSDPIQVVNNLVTKYLREKFGMSGSEEE 1096

Query: 823  LEYLKVNKGA-----CLLIDGESLGMFL--RYYKREFFDVVICLPTVVACRCTPQQKADV 875
            L+  K   G       ++IDG++L + L     +R+F  +      V+ CR +P QKA V
Sbjct: 1097 LKEAKREHGLPQGNFAVIIDGDALKVALNGEEMRRKFLLLCKNCKAVLCCRVSPAQKAAV 1156

Query: 876  ALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELL 935
              ++++        IGDG NDV+MIQ ADVGVGI G+EG+QA + +D++I +F ++T L+
Sbjct: 1157 VKLVKKTLDVMTLAIGDGSNDVAMIQSADVGVGIAGEEGRQAVMCSDYAIGQFRYVTRLV 1216

Query: 936  LWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAP 995
            L HG+  YKR A++     ++ ++  +    Y I + F+   L++   +  Y   +T  P
Sbjct: 1217 LVHGKWCYKRLAEMIPQFFYKNVIFTLSLFWYGIYNNFDGSYLFEYTYLTFYNLAFTSVP 1276

Query: 996  VFSMT-LDHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCAL 1037
            V  +  LD D+ ++++ + P+LY+     K  + +T F+W  L
Sbjct: 1277 VILLAVLDQDVSDTVSMLVPQLYRVGILRKEWN-QTKFLWYML 1318

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 47/94 (50%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           YP N+I   KY   TF P  +  QF  F N+YFL++ +  A     +       VPL  +
Sbjct: 229 YPRNKIRTTKYTPLTFFPKNILFQFHNFANIYFLILLILGAFQIFGVTNPGFASVPLIVI 288

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSK 273
           + +T  K+ ++D +R   D E N+   H+L+  K
Sbjct: 289 VIITAIKDGIEDSRRTVLDLEVNNTRTHILSGVK 322

>KLLA0C17644g 1557138..1561868 similar to sp|P32660 Saccharomyces
            cerevisiae YER166w, start by similarity
          Length = 1576

 Score =  330 bits (846), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 255/871 (29%), Positives = 423/871 (48%), Gaps = 145/871 (16%)

Query: 278  KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALT----- 332
            K + VGD++++   D +PAD++LL SS+  G  +++T  LDGET+ K+R +   +     
Sbjct: 444  KSVSVGDIVRVHNNDEIPADIILLSSSDSDGACYVETKNLDGETNLKVRQSLKCSHMIRN 503

Query: 333  -QNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLAS 386
             +N+T      K  + +  P   ++++ G + + D  +      P++I+N L     L +
Sbjct: 504  SRNITR----TKFKVESEGPHSNLYSYQGNLKWVDRETGLEKNEPVNINNLLLRGCTLRN 559

Query: 387  TGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVF---ALSIILVVFA 443
            T + +G VV+TG DT+  +N        G+   +++ IS+ L  SVF   AL  +L   A
Sbjct: 560  TKWAMGIVVFTGPDTKIMLNA-------GVTPTKVSRISRELNLSVFMNFALLFVLCFAA 612

Query: 444  GFHNSDWY------------------------LDVMRYLILFSTIIPVSLRVNLDLAKSV 479
            G  N  +Y                        +     LIL+ +++P+SL +++++ K+ 
Sbjct: 613  GIVNGVYYRTDNTSRNYFEFGSIAGSAAANGVVSFWVALILYQSVVPISLYISIEIIKTA 672

Query: 480  YAHQIEHDDTI-------PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGT 532
             A  I  D  +       P T  ++ TI +DLG+IEY+ SDKTGTLTQN M+ KK  +  
Sbjct: 673  QALFIYGDVALYNERLDYPCT-PKSWTISDDLGQIEYIFSDKTGTLTQNVMEFKKCTING 731

Query: 533  VSYTS-----------------------ETLDIVSDYVDALVN-----------SSNSAN 558
            VSY                         E   I  D    L N             N   
Sbjct: 732  VSYGRAYTEALAGLRKRQGIDVEEEGALEKEGIAQDKEIMLANLKILGENSQLRPENVTF 791

Query: 559  PSGKSVPSTSRKDLSARVR---DMVVTLAICHNVTPTFEDDE---LTYQAASPDEIAIVK 612
             S + V  T+  +   + +   + ++ LA+CH V      D+   + ++A SPDE A+V 
Sbjct: 792  VSKEFVQDTAGANGETQKKCNENFMLALALCHTVLVEENKDDPEIMDFKAQSPDEAALVG 851

Query: 613  FTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIV-----HDEQKD 667
                +G S   R +               Y +L V  FNS  KRM  I+     +  ++ 
Sbjct: 852  TARDMGFSFVGRTKNGVIVDIQGVQKE--YRLLNVLEFNSTRKRMSCILKIPSENPNEEP 909

Query: 668  EYWFMQKGADTVM-ARIVENNDW-LEEETG----NMAREGLRTLVVGRKKLSRNIYDQFK 721
                + KGAD+++ +R+ +NND  L E+T       A EGLRTL + +++LS   Y ++ 
Sbjct: 910  RALLICKGADSIIYSRLSKNNDEKLLEKTALHLEQYATEGLRTLCIAQRELSWKEYQEWN 969

Query: 722  KDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIW 781
            + ++ A+ ++V+R+ +M  V    +E +L LLG T +ED+LQ+ V  SI  L  AGIK+W
Sbjct: 970  EKHEIAAAALVDREDEMEKV-ADVIERELTLLGGTAIEDRLQDGVPDSIATLGEAGIKLW 1028

Query: 782  MLTGDKVETARCVSISAKLISRGQYVHIITKL--------TKP----------------- 816
            +LTGDKVETA  +  S  L++    + +I           +KP                 
Sbjct: 1029 VLTGDKVETAINIGFSCNLLNNEMELLVIKASGDDVDIYGSKPAEIVKNLILKYLQEKFQ 1088

Query: 817  -EGALNQLEYLK-----VNKGACLLIDGESLGMFLRY--YKREFFDVVICLPTVVACRCT 868
              G+  +LE  K           ++IDG++L + LR    KREF  +      V+ CR +
Sbjct: 1089 MSGSYEELEEAKKVHEPPTGNFGVIIDGDALKLALRNDDVKREFLLLCKRCKAVLCCRVS 1148

Query: 869  PQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEF 928
            P QKA V  +++         IGDG NDV+MIQ AD+GVGI G+EG+QA +++D++I +F
Sbjct: 1149 PAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQSADIGVGIAGEEGRQAVMSSDYAIGQF 1208

Query: 929  CHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYA 988
             +LT L+L HGR SYKR A++     ++ ++  +    Y + + ++   L++   +  + 
Sbjct: 1209 RYLTRLVLVHGRWSYKRMAEMIPLFFYKNVIFTLSLFWYGVYNNYDGSYLFEYTYLTLFN 1268

Query: 989  TCYTMAPV-FSMTLDHDIEESLTKIYPELYK 1018
              +T  PV F   LD D+ + ++ + P+LY+
Sbjct: 1269 LAFTSLPVIFLGILDQDVNDIVSMVVPQLYR 1299

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 53/113 (46%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           YP N+I   KY   TF P  +  QFK   N+YFLV+ +        +       VPL  +
Sbjct: 240 YPRNKIRTTKYTPLTFFPKNIAFQFKNVANVYFLVLIIMGFFQIFGVANPGLATVPLIVI 299

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGD 292
           + +T  K+A++D +R   D E N+   H+L   + V   + KV    K  K +
Sbjct: 300 VVLTSFKDAIEDSRRTILDMEVNNAPTHILKGVENVNVSNDKVSLWRKFKKAN 352

>CAGL0H04477g 421857..426737 similar to sp|Q12674 Saccharomyces
            cerevisiae YMR162c, start by similarity
          Length = 1626

 Score =  211 bits (537), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 153/473 (32%), Positives = 241/473 (50%), Gaps = 34/473 (7%)

Query: 692  EETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLE 751
            E+  + + EGLRTL+   K +S   ++Q++  Y +A  S+  R Q+++ V  + +E +L 
Sbjct: 963  EDIESFSTEGLRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQ-IEDELY 1021

Query: 752  LLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIIT 811
            LLG T +EDKLQ  V  +IE +R AGIK+WMLTGDK ETA  +  S KLI     V I+T
Sbjct: 1022 LLGATAIEDKLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTVVILT 1081

Query: 812  KLTKPEGALNQLEYL--KVNKG----ACLLIDGESLGMFLRYYKREFFDVVICLPT--VV 863
              T  E  ++++  +  +V+ G      ++IDG +L MF            +C  T  VV
Sbjct: 1082 --TSDENIISKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTDSVV 1139

Query: 864  ACRCTPQQKADVALVIREFTGKRVC--CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 921
             CR +P QKA +   IR  T K +    IGDG ND++MIQ AD+GVGI GKEG QAS +A
Sbjct: 1140 CCRASPAQKALMVSNIRN-TDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSA 1198

Query: 922  DFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQG 981
            D+SI +F  + +LLL HGR +Y R+AK      ++ L   + Q +Y   + F    LY+ 
Sbjct: 1199 DYSIGQFRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSLYEP 1258

Query: 982  FLMVGYATCYTMAPVFSMTL-DHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLF 1040
            + +  Y T +T  PV  + + + D++       PELY      K+ ++  F  W  L   
Sbjct: 1259 WSLSMYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTA 1318

Query: 1041 QGCVIQGCSQVFSSLLEVDFTKMVAIGF------TALILNELIMVALEIYTWNKIMVFTE 1094
               +I   + V      +    +  +GF       ALI  +   + +    W   + FT 
Sbjct: 1319 NALIITFLNIVAWGETSLSDNTLYPLGFVNFSATVALINVKAQFIEMRNRNW---LAFTS 1375

Query: 1095 IL----TFLCYVISVPFLGE---YFDLKYMMTLRFYGELLFI---LLVSVFPV 1137
            ++     +L +  ++P L      +D+ Y +   F  ++ F    L+++V P+
Sbjct: 1376 VILSCGGWLVWCCALPILNRSDGIYDVTYGLYHHFGRDITFWCTSLILAVLPI 1428

 Score =  181 bits (459), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 129/449 (28%), Positives = 215/449 (47%), Gaps = 73/449 (16%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           Y  N I++++Y   +F P  LY QF    N+YF +VA+ Q IP        + +VPL   
Sbjct: 123 YCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAILQMIPGWSTTGTYTTIVPLCVF 182

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVL------------------------------ 269
           + ++M++EA DD +R + D E N++L  VL                              
Sbjct: 183 MAISMAREAYDDYRRHKLDKEENNKLTKVLQILHEREDNDLDLENNAQHSANNPESISNL 242

Query: 270 --NQSKLVPSK-----------DLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQ 316
             N   L+  K           D++VGD + + + D +PAD+++L S   + E FI+T  
Sbjct: 243 YFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQDDWVPADILILTSDGDNSEVFIETMA 302

Query: 317 LDGETDWKLRIAPALTQNLTEP--DLMN-KVSITASAPEKAIHNFLGKVTYKDTSSN--- 370
           LDGET+ K ++       LT+    L N    +T   P   ++NF G +     SS+   
Sbjct: 303 LDGETNLKGKVPHPEINKLTKSASGLANINAQVTVEDPNNDLYNFEGNLELNSGSSSKKK 362

Query: 371 -PLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNT-TTATVKTGLLELEINSISKIL 428
            PL  DN ++  +++ +T  C+G V++TG +++  MN       K   L+ +IN I   +
Sbjct: 363 YPLGPDNVIYRGSIIRNTRNCVGMVIFTGEESKIRMNALRNPRTKAPKLQRKINMIVVFM 422

Query: 429 -----CASVFAL--SIILVVFAGFHNSDWYL---------DVMRYLILFSTIIPVSLRVN 472
                C S+F+     I +     +N  WYL          +M ++I+++TIIP+SL V 
Sbjct: 423 VFVVACMSLFSYLGHTIQIKRYVNNNKAWYLLQEDAGTAPTIMSFIIMYNTIIPLSLYVT 482

Query: 473 LDLAKSVYAHQIE------HDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLK 526
           ++L K   +  +E      H ++     VRT+TI E+LG++ Y+ SDKTGTLT N M  +
Sbjct: 483 MELIKVAQSRMMEWDIDMYHAESDTPCAVRTATILEELGQVSYIFSDKTGTLTDNKMLFR 542

Query: 527 KIHLGTVSYTSETLDIVSDYVDALVNSSN 555
           K+     S+       +S++  A +++ N
Sbjct: 543 KLSFCGTSWVHNATQDISEFKPAQLSNKN 571

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 77/178 (43%), Gaps = 19/178 (10%)

Query: 564 VPSTSRKDLSARVRDMVVTLAICHNVTPTF------EDDELTYQAASPDEIAIVKFTESV 617
           + S  +   + + +  +++LAICH   P        EDD + YQ++SPDE+A+V     +
Sbjct: 663 IQSNPKSLFAKKAKMFILSLAICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDM 722

Query: 618 GLSLFKRDRXXXXXXX-----XXXXXXXTYEILQVFPFNSDSKRMGIIVH-DEQKDEYWF 671
           G  ++ R+                     +EIL++  FNS  KRM +IV   E+KD    
Sbjct: 723 GYIVYNRNANILTLKTFPDGFDELPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVLL 782

Query: 672 MQKGADTVMARIVENN-------DWLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKK 722
             KGAD V+   + N        D +E  T          ++  RK L R + D   +
Sbjct: 783 FCKGADNVILERLHNKEMALDMLDQVENNTKYRKDAEAELVIQHRKSLERAVNDDLPR 840

>KLLA0E01650g complement(155975..160627) similar to sp|Q12674
            Saccharomyces cerevisiae YMR162c, start by similarity
          Length = 1550

 Score =  206 bits (523), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 130/366 (35%), Positives = 202/366 (55%), Gaps = 15/366 (4%)

Query: 682  RIVENNDWLEEETGN----MAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQ 737
            ++++N +++ E+T N     + EGLRTL+   K +    Y  ++  Y +A  S+ NR  Q
Sbjct: 928  KLIKNEEFILEKTLNAIDEFSTEGLRTLLYSYKWIPAEEYKAWEAKYHEAKTSLTNRSTQ 987

Query: 738  MNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSIS 797
            + A +  ++E DLELLG T +EDKLQ  V  +I+ +R AGIK+WMLTGDK ETA  +  +
Sbjct: 988  I-AEVGGHIETDLELLGATAIEDKLQEGVPEAIQKIRRAGIKMWMLTGDKRETAINIGYA 1046

Query: 798  AKLISRGQYVHIITK-----LTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREF 852
             KLI     V I+ K     ++K      +L+  K+     L+IDG SL +F        
Sbjct: 1047 CKLIYDYSTVVILKKNDDNLISKMTALGEELDTGKI-AHCVLVIDGASLAVFENNPTMMS 1105

Query: 853  FDVVICLPT--VVACRCTPQQKADVALVIREFTGKRVC-CIGDGGNDVSMIQCADVGVGI 909
              + +C  T  V+ CR +P QKA +   IR      V   IGDG ND++MIQ AD+GVGI
Sbjct: 1106 VFIELCTKTDSVICCRASPSQKALIVTNIRLKNKDLVTLAIGDGANDIAMIQSADIGVGI 1165

Query: 910  VGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSI 969
             GKEG QAS ++D+SI +F +L +LL  HGR +Y R++K      ++ ++  + Q +Y  
Sbjct: 1166 TGKEGLQASRSSDYSIAQFRYLLKLLFVHGRYNYVRTSKFVLCTFYKEVLFYLTQMIYQR 1225

Query: 970  CSKFEPIGLYQGFLMVGYATCYTMAPVFSMTL-DHDIEESLTKIYPELYKDLTEGKSLSY 1028
             + F    LY+ + +  + T +T  PV  + + + D++       PELY    + ++ + 
Sbjct: 1226 QTMFSGTSLYEPWSLSMFNTLFTSLPVICIGMFEKDLKPMTLLAVPELYTMGQKCQAFNL 1285

Query: 1029 KTFFVW 1034
            K F VW
Sbjct: 1286 KIFLVW 1291

 Score =  129 bits (324), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 152/291 (52%), Gaps = 35/291 (12%)

Query: 278 KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIA-PALTQNLT 336
           KDLKVG+ + ++  D +PAD++LL +   + E F++T  LDGET+ K +   P L + +T
Sbjct: 275 KDLKVGEFVLLNSDDWVPADILLLSTDGENNEAFVETMALDGETNLKSKNPLPELAKRMT 334

Query: 337 EPD--LMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCV 394
                 M+  + T   P   ++NF G V   D    PL  DN ++  ++L +T   +G V
Sbjct: 335 SATGLSMHSATTTLEDPNNDLYNFEGTVEI-DGELYPLGSDNVVYRGSILRNTQSIVGIV 393

Query: 395 VYTGRDTRQAMNT-TTATVKTGLLELEINSISKILCASVFALSIILVVFAGFH------- 446
           ++TG +T+  MN       K   L+ +IN I   +   V A++  +  + G H       
Sbjct: 394 IFTGEETKIRMNAIKNPRTKAPKLQGKINLIVLFMVFVVAAMA--MFSYLGQHILKKNYV 451

Query: 447 --NSDWYL---------DVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHD-------- 487
             N  WYL          +M ++I+++T+IP+SL V  ++ K++ +  +E D        
Sbjct: 452 DNNRAWYLFQEDAGTAPTIMSFIIMYNTLIPLSLYVTTEIIKAMQSKLMEWDIDMYHIES 511

Query: 488 DTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSE 538
           DT  E+  RT+TI E+LG++ Y+ SDKTGTLT N M  +K  +   S+  E
Sbjct: 512 DTPCES--RTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSICGSSWLHE 560

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 57/94 (60%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           Y  N I++++Y  ++F+P  LY QF    N YFL+VA+ Q IP+       + +VPL+  
Sbjct: 116 YRDNVITSSRYTVYSFLPRQLYAQFSKLANAYFLLVAILQMIPSWSTTGTYTTIVPLSIF 175

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSK 273
           L+++M++EA DD +R R D E N++   VL   K
Sbjct: 176 LSISMAREAWDDFKRHRLDKEENNKSTKVLTMGK 209

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 57/127 (44%), Gaps = 9/127 (7%)

Query: 571 DLSARVRDMVVTLAICHNVTPTFEDD---ELTYQAASPDEIAIVKFTESVGLSLFKRDRX 627
           + S R +  +++LA+CH   P    D    + YQ++SPDE+A+V     +G  +  R+  
Sbjct: 664 EFSIRAKFFILSLALCHTCLPKKTHDGTDSILYQSSSPDELALVTAARDMGFVVTNRNSS 723

Query: 628 XXXXXXX-----XXXXXXTYEILQVFPFNSDSKRMGIIVH-DEQKDEYWFMQKGADTVMA 681
                              YE+L+   F+S  KRM + V      D    + KGAD V+ 
Sbjct: 724 TLSIATYPNGFDDQPIVEDYEVLEYINFDSQRKRMSVAVKMPNDDDRVLLICKGADNVIL 783

Query: 682 RIVENND 688
             + N++
Sbjct: 784 ERLRNSE 790

>AFL191W [3004] [Homologous to ScYMR162C (DNF3) - SH]
            complement(79156..83883) [4728 bp, 1575 aa]
          Length = 1575

 Score =  201 bits (511), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 142/426 (33%), Positives = 223/426 (52%), Gaps = 24/426 (5%)

Query: 700  EGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVE 759
            EGLRTL+   K +    Y+ +   Y  A  ++VNR +QM+ V  + +E DL LLG  G+E
Sbjct: 951  EGLRTLLYSFKWIGNQEYETWNSRYSAAKAALVNRREQMDTV-GEIIERDLTLLGTIGIE 1009

Query: 760  DKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGA 819
            DKLQ  V  +I+ LR AGIK+WMLTGDK ETA  +  S +LI    Y  +I      E  
Sbjct: 1010 DKLQEGVPDAIDKLRRAGIKMWMLTGDKRETAINIGYSCRLIH--DYSTVIILAPNDENM 1067

Query: 820  LNQL-----EYLKVNKGACLL-IDGESLGMFLRYYKREFFDVVICLPT--VVACRCTPQQ 871
             +++     E    N   C++ IDG +L +F          + +C  T  V+ CR +P Q
Sbjct: 1068 ASKITTITQEIEAGNVAHCVVVIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQ 1127

Query: 872  KADVALVIREFTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCH 930
            KA +   IR+   K V   IGDG ND++MIQ AD+GV I GKEG QAS ++D+SI +F +
Sbjct: 1128 KALMVTKIRKTDKKLVTLAIGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRY 1187

Query: 931  LTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATC 990
            L +LLL HGR +Y R++K      ++  V  + Q ++ I + F     Y+ + +  + T 
Sbjct: 1188 LLKLLLVHGRYNYIRTSKFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTL 1247

Query: 991  YTMAPVFSMTL-DHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCS 1049
            +T  PV  + + + D++       PELY    + ++ +   F  W A++     +I   +
Sbjct: 1248 FTSLPVLCIGMFEKDLKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVIICFTN 1307

Query: 1050 -QVFSSLLEVDFT--KMVAIGFTALILNELIMVA---LEIYTWNKIM---VFTEILTFLC 1100
             Q +S   + D T   +  I +TA+++  L+ V    LE+   N +     F  +  +LC
Sbjct: 1308 WQCWSLTAQSDNTLYPIGLINYTAVVV--LVNVKCQLLEMANRNWLAFASFFISVCGWLC 1365

Query: 1101 YVISVP 1106
            + + +P
Sbjct: 1366 WCLLLP 1371

 Score =  189 bits (481), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 174/673 (25%), Positives = 300/673 (44%), Gaps = 161/673 (23%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           Y GN I++++Y+ ++F+P  L  QF    N YF  +A+ Q +P        + +VPL+  
Sbjct: 110 YIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQYTTIVPLSIF 169

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQS--------KLVPS-------------- 277
           + +++++E  +D +R + D E N++L  VL Q+        K + +              
Sbjct: 170 MGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEARAASFTDFETLQ 229

Query: 278 ------------KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKL 325
                       KD++VG+ + +++ D +PADL LL +   + E +++T  LDGET+ K 
Sbjct: 230 ANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYVETMALDGETNLKC 289

Query: 326 R-IAPAL-TQNLTEPDLMN-KVSITASAPEKAIHNFLGKVTYKDTSSN----PLSIDNTL 378
           + + P + +Q  T   L   +   T   P   ++NF GK+  +  S       + +DN L
Sbjct: 290 KHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETDSGEQQAYSIGLDNVL 349

Query: 379 WANTVLASTGFCIGCVVYTGRDTRQAMNT-TTATVKTGLLELEINSIS--KILCASVFA- 434
           +  +++ +T   +G VV+TG +T+  MN      +K+  L+ +IN I    IL  ++F+ 
Sbjct: 350 FRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQINLIVLFMILVVAIFSF 409

Query: 435 LSIILVVFAGFHNSD------WYL---------DVMRYLILFSTIIPVSLRVNLDLAKSV 479
           LS  L  F  F N +      WYL          +M ++I+++T+IP+SL V +++ K +
Sbjct: 410 LSFGLQRF--FKNREVDSDRAWYLMKVDAGLAPTIMSFIIMYNTLIPLSLYVTMEIIKDM 467

Query: 480 YAHQIE------HDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHL-GT 532
            +  +E      H +T      RT+TI E+LG++ Y+ SDKTGTLT N M  +K    GT
Sbjct: 468 QSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDKTGTLTDNRMIFRKFSFCGT 527

Query: 533 V--------------SYTSETLDIVSDYVDALV-----NSS------------------- 554
                          S T + ++++S   ++ +     NS+                   
Sbjct: 528 AWEHDVARKDQETGCSQTKKDVEVISVESNSFIKNFELNSTDTRTSVEYKGLASATYTGR 587

Query: 555 --------------NSANPSGKSVPSTSR---------------KDL------------S 573
                         NSAN +  S P  SR                DL            S
Sbjct: 588 PSIASQIELMKLQQNSANTNKSSSPKISRLPTLDSSPEPKLKTSLDLIMHIQLNPNTVFS 647

Query: 574 ARVRDMVVTLAICHNVTP-------TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDR 626
            R +  ++ LA+CH   P       + + D + YQ++SPDE+A+V     +G  +  R+ 
Sbjct: 648 QRAKFFILALALCHTCLPKKRQGADSGDFDSVEYQSSSPDELALVTAARDMGYVVLNRNG 707

Query: 627 XXXXXXX-----XXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDE-YWFMQKGADTVM 680
                               YE+L    F+SD KRM ++V   Q  E    + KGAD V+
Sbjct: 708 DELTIKTYPDGFEADCVLEKYEVLNTIDFSSDRKRMSVLVRMHQHPEKVLLICKGADNVI 767

Query: 681 ARIVENNDWLEEE 693
              + N+D  +++
Sbjct: 768 LERLHNSDLAQQK 780

>Kwal_23.3556
          Length = 1597

 Score =  201 bits (511), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 143/433 (33%), Positives = 222/433 (51%), Gaps = 28/433 (6%)

Query: 657  MGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEET----GNMAREGLRTLVVGRKKL 712
            +G ++ D   +EY + +         +++N +++ E T     + +  GLRTL+   K +
Sbjct: 931  LGPLLDDNSIEEYIWSED--------LIQNEEFVLERTLQAIEDFSTSGLRTLLYSYKWI 982

Query: 713  SRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIEL 772
                Y+++ K Y  A  S+ NR ++M++V  + +E  L LLG T +EDKLQ  V  +I+ 
Sbjct: 983  PSEDYEKWSKKYHAAKTSLENRKEKMHSV-GELVETSLHLLGATAIEDKLQEGVADAIDK 1041

Query: 773  LRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQL-----EYLK 827
            +R AGIK+WMLTGDK ETA  +  S  LI    Y  ++    K E   ++L     E  +
Sbjct: 1042 IRRAGIKMWMLTGDKRETAINIGYSCNLIH--DYSTVVILSAKDENISSKLTAVSQEIER 1099

Query: 828  VNKGACLL-IDGESLGMFLRYYKREFFDVVICLPT--VVACRCTPQQKADVALVIREFTG 884
             N   C++ IDG +L  F          V +C  T  V+ CR +P QKA +   IR    
Sbjct: 1100 GNIAHCVVVIDGSTLTTFESNPTLMSVFVELCTKTDSVICCRASPSQKALMVTHIRNTDK 1159

Query: 885  KRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSY 943
            K V   IGDG ND++MIQ AD+GVGI GKEG QAS ++D+SI +F  L +LLL HGR +Y
Sbjct: 1160 KLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSSDYSIAQFRFLLKLLLVHGRYNY 1219

Query: 944  KRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSMTL-D 1002
             R+ K      ++ L+  + Q +Y   + F    LY+ + +  + T +T  PV  + + +
Sbjct: 1220 VRTTKFVLCTFYKELLFYLTQMIYQRHTMFSGTSLYEPWSLSMFNTLFTSLPVLCIGMFE 1279

Query: 1003 HDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCS---QVFSSLLEVD 1059
             D++       PELY      +S + + F  W  L+     +I   +      SSL +  
Sbjct: 1280 KDLKPMTLLAIPELYSIGRLSQSFNLRVFLYWMFLAALNSLIITFLNWKIWAVSSLSDNT 1339

Query: 1060 FTKMVAIGFTALI 1072
               +  I FTA+I
Sbjct: 1340 VYPIGVINFTAII 1352

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 109/445 (24%), Positives = 188/445 (42%), Gaps = 89/445 (20%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           Y  N I++++Y  +TF+P  LY QF    N YF +VA+ Q IP        + +VPL   
Sbjct: 108 YISNLITSSRYTIYTFLPRQLYAQFSRLANAYFFLVAVLQMIPGWSTTGTYTTIVPLLIF 167

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLV 299
           + ++MS+EA DD +R + D E N +   VL +S    ++  +   L  + +  +      
Sbjct: 168 MGISMSREAWDDFRRHKLDREENDKTARVLVKSSSPHTEFSRPNSLYSLPQWQQSATSTS 227

Query: 300 LLQSSEPSGETFIKTDQLDGETDWKL----------------------------RIAPAL 331
           +L +          T Q D  T+W L                               PA 
Sbjct: 228 MLTNPTLESTAEAATSQNDDHTNWDLLKSKYGVEAVEKKWKDIKVGDYVVLEQDEWVPAD 287

Query: 332 TQNLT-----------------EPDLMNKVSITASAP----EKAIHNFLGKVTYKDTSSN 370
              LT                 E +L NK  +T  +        +  F  KVT +D + +
Sbjct: 288 MLVLTCSDEKNECFVETMALDGETNLKNKQPLTEVSEVMKTAAGLTEFKAKVTVEDPNID 347

Query: 371 PLSIDNTL-----------------WANTVLASTGFCIGCVVYTGRDTRQAMNT-TTATV 412
             + +  L                 +  +++ +T   +G VV+TG +T+  MN      +
Sbjct: 348 LHNFEGNLELLGENRKLTIGPDHIIYRGSIIRNTSNAVGMVVFTGEETKIRMNAIKNPRI 407

Query: 413 KTGLLELEINSISKILCASVFALSIILVVFAGF-------HNSDWYL---------DVMR 456
           K   L+  IN I   +   V ++++  ++           +N  WYL          VM 
Sbjct: 408 KAPKLQRAINLIVLFMVFVVASMALFSLLGQRIIKKKYVDNNRAWYLFNSDAGLAPTVMS 467

Query: 457 YLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDDTIPETIVRTSTIPEDLGRIEYL 510
           ++I+++T+IP+SL V +++ K++ +  +E      H +T      RT+TI E+LG++ Y+
Sbjct: 468 FIIMYNTLIPLSLYVTMEIIKAMQSKLMEWDIDMYHAETNTPCESRTATILEELGQVSYI 527

Query: 511 LSDKTGTLTQNDMQLKKIHLGTVSY 535
            SDKTGTLT N M  + + +   S+
Sbjct: 528 FSDKTGTLTDNKMVFRALSVCGSSW 552

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 15/130 (11%)

Query: 572 LSARVRDMVVTLAICHNVTPTFE-----DDELTYQAASPDEIAIVKFTESVGLSLFKRDR 626
            + +V   +++LA+CH   P        +D + YQA+SPDE+A+V     +G ++  R+ 
Sbjct: 661 FAKKVSFFILSLALCHACLPKSSSGVEGEDCVEYQASSPDELALVTAARDMGYAVMNRNS 720

Query: 627 XXXXXXX-----XXXXXXXTYEILQVFPFNSDSKRMGIIV---HDEQKDEYWFMQKGADT 678
                               YEIL    F+S  KRM ++V   H+E +     + KGAD 
Sbjct: 721 DVLTIKTYPNGFDAEPHLDKYEILNNIEFSSHRKRMSVLVRLPHEENR--ILLICKGADN 778

Query: 679 VMARIVENND 688
           V+   + N+D
Sbjct: 779 VILERLHNSD 788

>YMR162C (DNF3) [4117] chr13 complement(578950..583920) Member of the
            Drs2p-like family of the P-type ATPase superfamily of
            membrane transporters [4971 bp, 1656 aa]
          Length = 1656

 Score =  197 bits (500), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 146/463 (31%), Positives = 237/463 (51%), Gaps = 30/463 (6%)

Query: 700  EGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVE 759
            EGLRTLV   K +    Y+ + K Y  A  S+ +R  +++    + +E  L LLG+T +E
Sbjct: 1031 EGLRTLVYAYKWIDIGQYENWNKRYHQAKTSLTDRKIKVDEAGAE-IEDGLNLLGVTAIE 1089

Query: 760  DKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGA 819
            DKLQ+ V  +IE +R AGIK+WMLTGDK ETA  +  S  LI     V I+T  T  E  
Sbjct: 1090 DKLQDGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCMLIKDYSTVVILT--TTDENI 1147

Query: 820  LNQLEYL--KVNKG----ACLLIDGESLGMFLR--YYKREFFDVVICLPTVVACRCTPQQ 871
            ++++  +  +V+ G      ++IDG ++ MF     Y   F ++     +V+ CR +P Q
Sbjct: 1148 ISKMNAVSQEVDSGNIAHCVVVIDGATMAMFEGNPTYMSVFVELCTKTDSVICCRASPSQ 1207

Query: 872  KADVALVIREFTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCH 930
            KA +   IR      V   IGDG ND++MIQ AD+GVGI GKEG QAS  +D+SI +F  
Sbjct: 1208 KALMVSNIRNTDPNLVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRVSDYSIGQFRF 1267

Query: 931  LTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATC 990
            L +LL  HGR +Y R++K      ++ +     Q +Y   + F    LY+ + +  + T 
Sbjct: 1268 LLKLLFVHGRYNYIRTSKFMLCTFYKEITFYFTQLIYQRYTMFSGSSLYEPWSLSMFNTL 1327

Query: 991  YTMAPVFSMTL-DHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCS 1049
            +T  PV  + + + D++       PELY      +  ++  F  W  L+     +I   +
Sbjct: 1328 FTSLPVLCIGMFEKDLKPMTLLTVPELYSYGRLSQGFNWLIFMEWVILATTNSLIITFLN 1387

Query: 1050 QV---FSSLLEVDFTKMVAIGFTALILNELIMVA---LEIYTWNKIMVFTEILT---FLC 1100
             V    SSL +     +  I FTA++   LI V    +E++  N +   + +L+   +L 
Sbjct: 1388 VVMWGMSSLSDNTMYPLGLINFTAIV--ALINVKSQFVEMHNRNWLAFTSVVLSCGGWLV 1445

Query: 1101 YVISVPFLG---EYFDLKYMMTLRFYGELLFI---LLVSVFPV 1137
            +  ++P L    + +D+ Y     F  ++ F    L++++ P+
Sbjct: 1446 WCCALPILNNTDQIYDVAYGFYNHFGKDITFWCTSLVLALLPI 1488

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 88/287 (30%), Positives = 146/287 (50%), Gaps = 31/287 (10%)

Query: 280 LKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEP- 338
           L+VGD + +++ D +PADL+LL     + E F++T  LDGET+ K +        LT+  
Sbjct: 302 LRVGDFVLLTQDDWVPADLLLLTCDGENSECFVETMALDGETNLKSKQPHPELNKLTKAA 361

Query: 339 -DLMN-KVSITASAPEKAIHNFLGKVTYKDTSSN-----PLSIDNTLWANTVLASTGFCI 391
             L N    +T   P   ++NF G +  K+  ++     PL  DN ++  ++L +T   +
Sbjct: 362 SGLANINAQVTVEDPNIDLYNFEGNLELKNHRNDTIMKYPLGPDNVIYRGSILRNTQNVV 421

Query: 392 GCVVYTGRDTRQAMNT-TTATVKTGLLELEINSISKILCASVFALSIILVVFAGFH---- 446
           G V+++G +T+  MN       K   L+ +IN I   +   V  +S+   +    H    
Sbjct: 422 GMVIFSGEETKIRMNALKNPRTKAPKLQRKINMIIVFMVFVVATISLFSYLGHVLHKKKY 481

Query: 447 ---NSDWYL---------DVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIE------HDD 488
              N  WYL          +M ++I+++T+IP+SL V +++ K V +  +E      H +
Sbjct: 482 IDQNKAWYLFQADAGVAPTIMSFIIMYNTVIPLSLYVTMEIIKVVQSKMMEWDIDMYHAE 541

Query: 489 TIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSY 535
           T      RT+TI E+LG++ Y+ SDKTGTLT N M  +K  L   S+
Sbjct: 542 TNTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIFRKFSLCGSSW 588

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 52/90 (57%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           Y  N I++++Y  ++F+P  LY QF    N YF +VA+ Q IP        + ++PL   
Sbjct: 138 YCDNRITSSRYTFYSFLPRQLYAQFSKLANTYFFIVAVLQMIPGWSTTGTYTTIIPLCVF 197

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVL 269
           + ++M++EA DD +R R D E N++   VL
Sbjct: 198 MGISMTREAWDDFRRHRLDKEENNKPVGVL 227

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 12/121 (9%)

Query: 572 LSARVRDMVVTLAICHNVTP------TFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD 625
            S + +   ++LA+CH+  P      +  +D + YQ++SPDE+A+V     +G  +  R+
Sbjct: 724 FSQKAKFFFLSLALCHSCLPKKTHNESIGEDSIEYQSSSPDELALVTAARDLGYIVLNRN 783

Query: 626 RXXXXXXX-----XXXXXXXTYEILQVFPFNSDSKRMGIIVH-DEQKDEYWFMQKGADTV 679
                                YEIL    FNS  KRM ++V    Q ++   + KGAD V
Sbjct: 784 AQILTIKTFPDGFDGEAKLENYEILNYIDFNSQRKRMSVLVRMPNQPNQVLLICKGADNV 843

Query: 680 M 680
           +
Sbjct: 844 I 844

>Scas_669.3
          Length = 1638

 Score =  186 bits (472), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 148/462 (32%), Positives = 232/462 (50%), Gaps = 28/462 (6%)

Query: 700  EGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVE 759
            EGLRTLV   K +    Y Q++  Y DA +S+ NR  ++ A + + +E DL+LLG T +E
Sbjct: 1005 EGLRTLVYSYKWVDLQEYQQWEDRYHDAKISLTNRKSKI-AEVGEEIEQDLQLLGATAIE 1063

Query: 760  DKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITK----LTK 815
            DKLQ  V  +IE +R AGIKIWMLTGDK ETA  +  S KLI     V I+ K    +  
Sbjct: 1064 DKLQEGVSEAIEKIRRAGIKIWMLTGDKRETAINIGYSCKLIYDYSTVVILAKGDENIIS 1123

Query: 816  PEGALNQLEYLKVNKGAC-LLIDGESLGMFLRYYKREFFDVVICLPT--VVACRCTPQQK 872
               A++Q E    N   C ++IDG +L MF          + +C  T  V+ CR +P QK
Sbjct: 1124 KMNAISQ-EVDSGNVAHCVIIIDGSTLAMFEGNPTLMSVFIELCTKTDSVICCRASPSQK 1182

Query: 873  ADVALVIREFTGKRVC-CIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHL 931
            + +   IR      V   IGDG ND++MIQ AD+G+GI GKEG QAS  AD+SI +F  +
Sbjct: 1183 SLMVTNIRNSNKNLVTLAIGDGANDIAMIQSADIGIGIGGKEGLQASRTADYSIAQFRFI 1242

Query: 932  TELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCY 991
             +LLL HGR +Y R+AK       + +   + Q ++   + F    LY+ + +  + T +
Sbjct: 1243 LKLLLVHGRYNYIRTAKFILCTFFKEITFYLTQLIFQRYTMFSGSSLYEPWSLSMFNTLF 1302

Query: 992  TMAPVFSMTL-DHDIEESLTKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQ 1050
            T  PV  + + + D++       PELY      +  +   F  W   +     +I   + 
Sbjct: 1303 TSLPVLCIGMFEKDLKPMTLLTIPELYSMGRLSQGFNLIIFGEWVIQAAAYALLITFLNI 1362

Query: 1051 VF---SSLLEVDFTKMVAIGFTALILNELIMVALEIYTWN--KIMVFTEIL----TFLCY 1101
            +    ++L +     +  I FTA++   L+ V  +    N    +VFT ++     +L +
Sbjct: 1363 IIWGETALSDHTMYPLGVINFTAIV--ALVNVKCQFIEMNNRNWVVFTSVILSCGGWLVW 1420

Query: 1102 VISVPFLGE---YFDLKYMMTLRFYGELLF---ILLVSVFPV 1137
              ++P L      +D+ Y     F  ++ +     +++V P+
Sbjct: 1421 CCALPILNRSDVIYDVPYGFFYHFGKDITWWCSCFVLAVLPI 1462

 Score =  174 bits (440), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 134/474 (28%), Positives = 227/474 (47%), Gaps = 87/474 (18%)

Query: 180 YPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIGYLSSYVVPLAFV 239
           Y  N I++++Y  ++F P  LY QF    N+YF VVA+ Q IP        + +VPL   
Sbjct: 140 YCNNNITSSRYTIYSFFPKQLYAQFSKVANVYFFVVAILQMIPGWSTTGTYTTIVPLCIF 199

Query: 240 LTVTMSKEAMDDIQRRRRDNESNSELYHVLNQS---------KLVPSK------------ 278
           + ++M++EA DD +R R D E N++   +L +            +PS+            
Sbjct: 200 MGISMAREAWDDFRRHRLDKEENNKTCSILTKEFSNKPMPDDAQLPSRQNIDNLSNDSNT 259

Query: 279 ---------------------------DLKVGDLIKISKGDRLPADLVLLQSSEPSGETF 311
                                      +L VGD + + + + +PAD+++L S   + E F
Sbjct: 260 DYLNTKFNNFPFLEERHGVRIQETTWSNLHVGDFVLLKQDNWVPADILVLTSDGDNNECF 319

Query: 312 IKTDQLDGETDWKLRIA-PALTQNLTEPDLMNKVS--ITASAPEKAIHNFLGKVTYKDTS 368
           ++T  LDGET+ K++   P L +       +  ++  IT   P   ++NF G +   D +
Sbjct: 320 VETMALDGETNLKVKQPHPELNKLACSASGLANINALITVEDPNSDLYNFEGNLELTDNN 379

Query: 369 SN-----PLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINS 423
           +N     P+  DN  +  +++ +T   IG V+YTG++T+  MN      +T   +L+ N 
Sbjct: 380 NNSLKKYPVGPDNVAYRGSIIRNTDNVIGMVIYTGKETKIRMNALN-NPRTKAPKLQKN- 437

Query: 424 ISKILCASVFALSII-LVVFAGF---------HNSDWYL---------DVMRYLILFSTI 464
           I+ I+   VF +++I L  + G           N  WYL          +M ++I+++TI
Sbjct: 438 INIIITFMVFVVAVISLFSYLGHVLQNKKAIDENQAWYLLTKDAGAAPTIMSFIIMYNTI 497

Query: 465 IPVSLRVNLDLAKSVYAHQIE------HDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTL 518
           IP+SL V +++ K++ +  +E      H +T      RT+TI E+LG++ Y+ SDKTGTL
Sbjct: 498 IPLSLYVTMEIIKAMQSKMMEWDIDMYHSETNTPCESRTATILEELGQVSYMFSDKTGTL 557

Query: 519 TQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDL 572
           T N M  +K  +   S+   T D+ S   +AL   S ++N S   V S   + L
Sbjct: 558 TDNKMIFRKFSICGSSWLHST-DLGS---NALYKGSPNSNNSDIDVVSLENQSL 607

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 80/180 (44%), Gaps = 23/180 (12%)

Query: 572 LSARVRDMVVTLAICHNVTPTFE------DDELTYQAASPDEIAIVKFTESVGLSLFKRD 625
            + + +  +++LA+CH   P         +D + YQ++SPDE+A+V     +G  +  ++
Sbjct: 695 FAKKAKFFILSLALCHTCLPKKSNFPEGGEDVIEYQSSSPDELALVTAARDLGYVVLNKN 754

Query: 626 RXXXXXXX-----XXXXXXXTYEILQVFPFNSDSKRMGIIVH-DEQKDEYWFMQKGADTV 679
                                Y+IL    FNS  KRM ++V   ++ ++   + KGAD +
Sbjct: 755 ADVLTIKTYPDGFENEPIFEDYQILNYIDFNSQRKRMSVLVKTPDEPNKVLLICKGADNM 814

Query: 680 MARIVENNDWLEEETGNMARE---------GLRTLVVGRKKLSRNIYDQFKKDYDDASLS 730
           +   +++ D   ++  ++ R          GL  ++  RK L R  YD   ++    SLS
Sbjct: 815 ILERLQDRDLAYQKMEDINRNTRERKELEAGL--VIEQRKSLERMAYDDVPRNSFKTSLS 872

>Scas_505.4
          Length = 1025

 Score =  140 bits (353), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 160/348 (45%), Gaps = 24/348 (6%)

Query: 833  CLLIDGESLGMFLRYYKREFFDVV--ICLPTVVACRCTPQQKADVALVIREFTGKRVCCI 890
             L+IDG+SL   L     ++   +  IC   VV CR +P QKA V  +++  T   +  I
Sbjct: 559  ALVIDGKSLSYALESDLEDYLLALGKIC-KAVVCCRVSPLQKALVVKMVKRKTSSLLLAI 617

Query: 891  GDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLA 950
            GDG NDVSMIQ A VGVGI G EG QA+ +AD ++ +F  L +LLL HG  SY+R +   
Sbjct: 618  GDGANDVSMIQAAHVGVGISGMEGMQAARSADIAVGQFRFLKKLLLVHGSWSYQRISVAI 677

Query: 951  QFIMHRGLVIAICQAVYSICSKFEPIGLYQGFLMVGYATCYTMAPVFSM-TLDHDIEESL 1009
             +  ++   + + Q  +   + F    + + + M  Y   +T+ P F +   D  +   L
Sbjct: 678  LYSFYKNTALYMTQFWFVFANAFSGQSIMESWTMSYYNVFFTVFPPFVIGVFDQFVSSRL 737

Query: 1010 TKIYPELYKDLTEGKSLSYKTFFVWCALSLFQGCVIQGCSQVFSSL-LEVDFTKMVA--- 1065
             + YP+LYK   +GK  S + F+ W     +   V+   + +F    + ++    VA   
Sbjct: 738  LERYPQLYKLGQQGKFFSVRIFWGWIVNGFYHSAVVYIGTMLFYRYGMALNMHGEVADHW 797

Query: 1066 ----IGFTALILNELIMVALEIYTWNKIMVFTEILTFLCYVISVPFLGEYFDLKYMMTLR 1121
                  +T+ IL  L   AL    W K  +F    +F+ ++I  P     F    +    
Sbjct: 798  SWGIAVYTSSILIVLGKAALVTNQWTKFTLFAIPGSFIFWMIFFPIYASVFPYANISREY 857

Query: 1122 F------YGELLFILLVSVFPVWAA------KAIHRRLHPPSYAKVQE 1157
            F      YG   F L + V PV+A       K   R   P SY  VQE
Sbjct: 858  FGVVKHTYGSGTFWLTLIVLPVFALMRDFVWKYYRRMYEPESYHLVQE 905

 Score =  135 bits (340), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 88/301 (29%), Positives = 154/301 (51%), Gaps = 13/301 (4%)

Query: 155 SVELDDRHMEREIHPSTTPVYDRNRYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLV 214
           +V   D    REI+ +         Y  N IS  KYN  TF+P  L+++F  + NL+FL 
Sbjct: 212 NVGASDDGTPREIYLNDRTANHAFNYGDNHISTTKYNIATFLPKFLFQEFSKYANLFFLC 271

Query: 215 VALSQAIPALRIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRD---NESNSELYHVLNQ 271
            A  Q +P +      + V  L  VL V+  KE+++DI+R   D   N S +E+Y   N 
Sbjct: 272 TAAIQQVPHVSPTNRYTTVGTLMVVLIVSAFKESIEDIKRANSDKELNNSKTEIYSEEN- 330

Query: 272 SKLVPSK--DLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAP 329
              +  +  D++ GD+I++   + +PADL+++ SSEP G  +I+T  LDGET+ K++ A 
Sbjct: 331 GDFIERRWIDIRAGDVIRVKSEEAIPADLIVISSSEPEGLCYIETANLDGETNLKIKQAR 390

Query: 330 ALTQNLTEPDLMN--KVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLAST 387
             T  + +   +N  K  + +  P  +++ + G + + +    PLS +  +     L +T
Sbjct: 391 PETAEMMDSRKLNNFKGKVISEQPNSSLYTYEGTLEFNNRKI-PLSPEQMILRGATLRNT 449

Query: 388 GFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHN 447
            +  G V++TG +T+   N T   +K   +E  IN    +   ++F + I+LV+ +   N
Sbjct: 450 SWMFGLVIFTGHETKLMRNATATPIKRTAVERVIN----LQIVALFGVLIVLVLISSLGN 505

Query: 448 S 448
           +
Sbjct: 506 A 506

>KLLA0A08910g complement(779526..783368) similar to sp|P38929
           Saccharomyces cerevisiae YGL006w PMC1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 1280

 Score = 97.1 bits (240), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 183/769 (23%), Positives = 301/769 (39%), Gaps = 139/769 (18%)

Query: 274 LVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQ 333
           L+   DL VGD+I +  GD +PAD VL+     SG        L GE+D   ++A     
Sbjct: 251 LISIHDLLVGDVISLQTGDVVPADAVLI-----SGSCECDESALTGESDTIKKVA----- 300

Query: 334 NLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLW----ANTVLASTGF 389
              +P L     I    P   I    G     +   +PL I  +       N V+ S G 
Sbjct: 301 --LKPALEKYKQIFEKDPTIDI----GSHGVGEKVPDPLLISGSKLLSGIGNAVITSVG- 353

Query: 390 CIGCVVYTGRDTRQAMNTTTATVKTGLLELEIN---SISKILCASVFALSIILVV--FAG 444
                     + R  M   T +  T L E   N   +IS   C +   L IIL +     
Sbjct: 354 ------ENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMAALVLFIILFIRFLTY 407

Query: 445 FHNSDWYLDV------MRYLILFSTII-------PVSLRVNLDLAKSVYAHQIEHDDTIP 491
             N   Y D+       +++ +F T +       P  L + + LA +    ++  D  + 
Sbjct: 408 LPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVTLALAFATTRMTKDGNL- 466

Query: 492 ETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALV 551
              VR     E +G    + SDKTGTLT+N M + K   G + +   T     +   A+V
Sbjct: 467 ---VRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFDDTTHAENKEIKSAVV 523

Query: 552 NSSNSANP------SGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTF------------ 593
             SN          S  S+ ST+ ++  ++ +D  V     H    +             
Sbjct: 524 LRSNCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHKSRKSLFPWSRNNRTSQL 583

Query: 594 ------EDDELTYQAASPDEIAIVKFTE-SVGLSLFKRDRXXXXXXXXXXXXXXTYEILQ 646
                 E+DE      S  E A++ F + S+G+    + R                +++Q
Sbjct: 584 IADAMKENDEQFL--GSKTETALLAFAQKSLGMKDVHKLRTKPSDLGID-------KVVQ 634

Query: 647 VFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVEN-----------NDWLEEET- 694
           V PF S  K   I V       Y F  KGA  ++ ++  N           N  L +E+ 
Sbjct: 635 VIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSIVPMNQDLYDESF 694

Query: 695 ---GNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDAS-LSMVNRDQQMNAVIT-KYLEYD 749
               +MA   LRT+ +    + R+  +   K++ D++  S+ + D  M   +  K L  +
Sbjct: 695 KKIQDMASHALRTISL----VHRDFKEWPPKEFADSTDPSIASPDLVMGHELDHKNLSSE 750

Query: 750 -LELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVH 808
            + L  + G++D L+  VK S+E  + AG+ + M+TGD + TAR +S +  ++S   Y  
Sbjct: 751 GMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISRNCNILSEEGY-- 808

Query: 809 IITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTV-VACRC 867
                  PE A+    + K+                   YK+    ++  +P + V  R 
Sbjct: 809 -----NDPECAMEGPTFRKLP------------------YKK----MLRVIPKLRVLARS 841

Query: 868 TPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLAADFSI 925
           +P+ K  +   +++  G+ V   GDG ND   ++ ADVG  +GI G E  + +       
Sbjct: 842 SPEDKRILVETLKKM-GEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMT 900

Query: 926 TEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFE 974
            +F  +   + W GR       K  QF +   +   I   V ++ S  E
Sbjct: 901 DDFTAIVNAIKW-GRCVSVSIKKFIQFQLTVNITAVILTFVSAVASAEE 948

>YDR039C (ENA2) [892] chr4 complement(531302..534577) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 96.7 bits (239), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 191/795 (24%), Positives = 312/795 (39%), Gaps = 165/795 (20%)

Query: 209 NLYFLVVALSQAIP-ALR---IGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSE 264
           N   +V+ +S AI  A+R    G + S+V+ +  ++ +    +A   +   +  +  N+ 
Sbjct: 72  NAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNA- 130

Query: 265 LYHVL--NQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSE-PSGETFIKTDQLDGET 321
             HV+   +S+ + SKD+  GD+  +  GD +PADL L+++    + E+ +  + L    
Sbjct: 131 --HVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSK 188

Query: 322 DWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWAN 381
           D  L           E  + +++++  S+         G V     +S    I  +L  +
Sbjct: 189 DANLVFGKE-----EETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGD 243

Query: 382 TVLASTGFCIGCVVYTGRDTRQA--MNTTTATVKTGLLELEIN---SISKILCASVFALS 436
           + L S            RD  ++   NT  +T K     L  N    + + L      L 
Sbjct: 244 SGLIS------------RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLF 291

Query: 437 IILVVFAGFHNSDWYLDVMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDDTIP 491
            I V+FA    +    DV + + +++     ++IP SL V L +  SV A  +   + I 
Sbjct: 292 WIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVI- 350

Query: 492 ETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSETLDIVSDYVD 548
              VR     E LG +  + SDKTGTLTQ  M  ++I     GT++ +            
Sbjct: 351 ---VRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITIS------------ 395

Query: 549 ALVNSSNSANPSGKSVPSTSR--------------------------KDLSARVRDM--- 579
              NS +  NP+  +V    R                          KDL   + DM   
Sbjct: 396 ---NSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDI-DMDLF 451

Query: 580 --VVTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGL-----------SLFKR 624
              +  A   N+   F+DD      A   P EIAI  F   + L           +    
Sbjct: 452 QKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNE 511

Query: 625 DRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA-------- 676
           +                +E +  FPF+S  KRM  + ++   + Y    KGA        
Sbjct: 512 NDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCC 571

Query: 677 ------DTVMARIVENND--WLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDAS 728
                 D V    + + D   + +   +++ EGLR L    K         F KD     
Sbjct: 572 SSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASK--------SFTKD----- 618

Query: 729 LSMVNRDQQMNAVITKY-LEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDK 787
              VN DQ  N    +   E DL  LGL G+ D  +N+   +++    AGI + MLTGD 
Sbjct: 619 --QVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDF 676

Query: 788 VETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRY 847
           V TA+ ++         Q V I+          N   Y +    + ++   +  G+    
Sbjct: 677 VGTAKAIA---------QEVGILPT--------NLYHYSQEIVDSMVMTGSQFDGL---- 715

Query: 848 YKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCI-GDGGNDVSMIQCADVG 906
              E  D +  LP V+A RC+PQ K  V ++      K+ C + GDG ND   ++ A+VG
Sbjct: 716 -SEEEVDDLPVLPLVIA-RCSPQTK--VRMIEALHRRKKFCAMTGDGVNDSPSLKMANVG 771

Query: 907 V--GIVGKE-GKQAS 918
           +  GI G +  K+AS
Sbjct: 772 IAMGINGSDVSKEAS 786

>YDR038C (ENA5) [891] chr4 complement(527417..530692) Member of the
           Na[+]-transporting ATPases family in the superfamily of
           P-type ATPases [3276 bp, 1091 aa]
          Length = 1091

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 191/795 (24%), Positives = 312/795 (39%), Gaps = 165/795 (20%)

Query: 209 NLYFLVVALSQAIP-ALR---IGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSE 264
           N   +V+ +S AI  A+R    G + S+V+ +  ++ +    +A   +   +  +  N+ 
Sbjct: 72  NAMIMVLVISMAISFAVRDWITGGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNA- 130

Query: 265 LYHVL--NQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSE-PSGETFIKTDQLDGET 321
             HV+   +S+ + SKD+  GD+  +  GD +PADL L+++    + E+ +  + L    
Sbjct: 131 --HVIRNGKSETINSKDVVPGDICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSK 188

Query: 322 DWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWAN 381
           D  L           E  + +++++  S+         G V     +S    I  +L  +
Sbjct: 189 DANLVFGKE-----EETSVGDRLNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGD 243

Query: 382 TVLASTGFCIGCVVYTGRDTRQA--MNTTTATVKTGLLELEIN---SISKILCASVFALS 436
           + L S            RD  ++   NT  +T K     L  N    + + L      L 
Sbjct: 244 SGLIS------------RDPSKSWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLF 291

Query: 437 IILVVFAGFHNSDWYLDVMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDDTIP 491
            I V+FA    +    DV + + +++     ++IP SL V L +  SV A  +   + I 
Sbjct: 292 WIAVLFAIIVMASQKFDVDKRVAIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVI- 350

Query: 492 ETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSETLDIVSDYVD 548
              VR     E LG +  + SDKTGTLTQ  M  ++I     GT++ +            
Sbjct: 351 ---VRKLDSLEALGAVNDICSDKTGTLTQGKMLARQIWIPRFGTITIS------------ 395

Query: 549 ALVNSSNSANPSGKSVPSTSR--------------------------KDLSARVRDM--- 579
              NS +  NP+  +V    R                          KDL   + DM   
Sbjct: 396 ---NSDDPFNPNEGNVSLIPRFSPYEYSHNEDGDVGILQNFKDRLYEKDLPEDI-DMDLF 451

Query: 580 --VVTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGL-----------SLFKR 624
              +  A   N+   F+DD      A   P EIAI  F   + L           +    
Sbjct: 452 QKWLETATLANIATVFKDDATDCWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNE 511

Query: 625 DRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA-------- 676
           +                +E +  FPF+S  KRM  + ++   + Y    KGA        
Sbjct: 512 NDQSSLSQHNEKPGSAQFEHIAEFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCC 571

Query: 677 ------DTVMARIVENND--WLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDAS 728
                 D V    + + D   + +   +++ EGLR L    K         F KD     
Sbjct: 572 SSWYGKDGVKITPLTDCDVETIRKNVYSLSNEGLRVLGFASK--------SFTKD----- 618

Query: 729 LSMVNRDQQMNAVITKY-LEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDK 787
              VN DQ  N    +   E DL  LGL G+ D  +N+   +++    AGI + MLTGD 
Sbjct: 619 --QVNDDQLKNITSNRATAESDLVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDF 676

Query: 788 VETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRY 847
           V TA+ ++         Q V I+          N   Y +    + ++   +  G+    
Sbjct: 677 VGTAKAIA---------QEVGILPT--------NLYHYSQEIVDSMVMTGSQFDGL---- 715

Query: 848 YKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCI-GDGGNDVSMIQCADVG 906
              E  D +  LP V+A RC+PQ K  V ++      K+ C + GDG ND   ++ A+VG
Sbjct: 716 -SEEEVDDLPVLPLVIA-RCSPQTK--VRMIEALHRRKKFCAMTGDGVNDSPSLKMANVG 771

Query: 907 V--GIVGKE-GKQAS 918
           +  GI G +  K+AS
Sbjct: 772 IAMGINGSDVSKEAS 786

>CAGL0K12034g complement(1161299..1164562) highly similar to
           sp|P13587 Saccharomyces cerevisiae YDR040c ENA1 or
           sp|Q01896 Saccharomyces cerevisiae YDR039c ENA2 or
           sp|Q12691 Saccharomyces cerevisiae YDR038c ENA5,
           hypothetical start
          Length = 1087

 Score = 94.7 bits (234), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 189/790 (23%), Positives = 301/790 (38%), Gaps = 156/790 (19%)

Query: 209 NLYFLVVALSQAIP-ALR---IGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSE 264
           N   LV+ +S  I  A+R    G +  +V+ +  ++ +    +A   +   R  +  N+ 
Sbjct: 68  NAMILVLIISMIISFAIRDWITGGVICFVIGINVIIGLIQEYKASKTMNALRALSSPNAH 127

Query: 265 LYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLL-QSSEPSGETFIKTDQL------ 317
           +    N S++V S D+  GDL+ +  GD +PADL L+ Q +  + E  +  + L      
Sbjct: 128 VIRNGN-SEVVDSTDVVPGDLVVVKVGDTIPADLRLVSQQNFETDEALLTGESLPVSKDA 186

Query: 318 ----DGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPL- 372
               D ET    RI  A + +         ++I     +  ++  +GK+       N L 
Sbjct: 187 NEIFDDETPVGDRINLAFSSSTVVKGRAQGIAI-----KTGLNTEIGKIAKSLRGGNELI 241

Query: 373 SIDNT-LWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINSISKILCAS 431
           S D    W      ST   +G  + T + T                      + + L   
Sbjct: 242 SRDPAKTWYQNAWISTKRTVGAFLGTTQGT---------------------PLHRKLSKL 280

Query: 432 VFALSIILVVFAGFHNSDWYLDVMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEH 486
              L  I VVFA    +    DV R + +++     ++IP SL V L +  SV A  +  
Sbjct: 281 AVLLFWIAVVFAIVVMASQKFDVDRGVAIYAVCVALSMIPSSLVVVLTITMSVGAAVMAS 340

Query: 487 DDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGT--VSYTSETLD 541
            + I    +R     E LG +  + SDKTGTLTQ  M  K+I     GT  V  ++E L+
Sbjct: 341 RNVI----IRKLDSLEALGAVNDICSDKTGTLTQGKMIAKQIWVPKFGTLQVVGSNEPLN 396

Query: 542 IVSDYVDALVNSSN---SANPS--------------GKSVPSTSRKDLSARVRDMVVTLA 584
                ++ + N S    S N +              GKS+P   +  L     D  +  A
Sbjct: 397 PEKGDINFIPNLSPYEYSHNETEDVGIMQNFKDKYEGKSIPGNCQYQLF----DKWLETA 452

Query: 585 ICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLSLF----KRD--------RXXXX 630
              N+   F D E     A   P EIAI  F   + L       +RD             
Sbjct: 453 SLANIASVFTDPETKEWKAHGDPTEIAIQVFATRMDLPRHVLTGERDDMDEDEIMSSVSL 512

Query: 631 XXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA-------------- 676
                      +     FPF+S  KRM  +        Y    KGA              
Sbjct: 513 SEKDATAANAKFRHAAEFPFDSTIKRMSSVYESRDYKTYEIYTKGAFESVLNCCTHWYGR 572

Query: 677 --DTVMARIVENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNR 734
             +T       + D ++E   +M+ EGLR L    K          K D ++  L  + +
Sbjct: 573 DPNTATVMTDADVDTIKENIDSMSSEGLRVLAFANKSYP-------KSDVNEEKLQKILK 625

Query: 735 DQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCV 794
           ++        Y E  L  LGL G+ D  + +   +++    AGI + MLTGD   TA+ +
Sbjct: 626 ERD-------YAETGLTFLGLIGIYDPPREETAGAVKKFHQAGINVRMLTGDFPGTAKAI 678

Query: 795 SISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFD 854
           +    ++    Y H   ++                    +++ G+           +  D
Sbjct: 679 AQEVGILPTNLY-HYSKEVVD-----------------IMVMTGKQFDNL----SEDEID 716

Query: 855 VVICLPTVVACRCTPQQKADV--ALVIREFTGKRVCCI-GDGGNDVSMIQCADVGV--GI 909
            +  LP V+A RC+PQ K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI
Sbjct: 717 NLPVLPLVIA-RCSPQTKVRMIEALHRRE----KFCAMTGDGVNDSPSLKMANVGIAMGI 771

Query: 910 VGKE-GKQAS 918
            G +  K AS
Sbjct: 772 NGSDVAKDAS 781

>YDR040C (ENA1) [893] chr4 complement(535187..538462) P-type ATPase
           involved in Na+ and Li+ efflux, required for Na+
           tolerance [3276 bp, 1091 aa]
          Length = 1091

 Score = 93.6 bits (231), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 184/773 (23%), Positives = 301/773 (38%), Gaps = 161/773 (20%)

Query: 227 GYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVL--NQSKLVPSKDLKVGD 284
           G + S+V+ +  ++ +    +A   +   +  +  N+   HV+   +S+ + SKD+  GD
Sbjct: 94  GGVISFVIAVNVLIGLVQEYKATKTMNSLKNLSSPNA---HVIRNGKSETINSKDVVPGD 150

Query: 285 LIKISKGDRLPADLVLLQSSE-PSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNK 343
           +  +  GD +PADL L+++    + E+ +  + L    D  L           E  + ++
Sbjct: 151 ICLVKVGDTIPADLRLIETKNFDTDESLLTGESLPVSKDANLVFGKE-----EETSVGDR 205

Query: 344 VSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQ 403
           +++  S+         G V     +S    I  +L  ++ L S            RD  +
Sbjct: 206 LNLAFSSSAVVKGRAKGIVIKTALNSEIGKIAKSLQGDSGLIS------------RDPSK 253

Query: 404 A--MNTTTATVKTGLLELEIN---SISKILCASVFALSIILVVFAGFHNSDWYLDVMRYL 458
           +   NT  +T K     L  N    + + L      L  I V+FA    +    DV + +
Sbjct: 254 SWLQNTWISTKKVTGAFLGTNVGTPLHRKLSKLAVLLFWIAVLFAIIVMASQKFDVDKRV 313

Query: 459 ILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSD 513
            +++     ++IP SL V L +  SV A  +   + I    VR     E LG +  + SD
Sbjct: 314 AIYAICVALSMIPSSLVVVLTITMSVGAAVMVSRNVI----VRKLDSLEALGAVNDICSD 369

Query: 514 KTGTLTQNDMQLKKI---HLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSR- 569
           KTGTLTQ  M  ++I     GT++ +               NS +  NP+  +V    R 
Sbjct: 370 KTGTLTQGKMLARQIWIPRFGTITIS---------------NSDDPFNPNEGNVSLIPRF 414

Query: 570 -------------------------KDLSARVRDM-----VVTLAICHNVTPTFEDDELT 599
                                    KDL   + DM      +  A   N+   F+DD   
Sbjct: 415 SPYEYSHNEDGDVGILQNFKDRLYEKDLPEDI-DMDLFQKWLETATLANIATVFKDDATD 473

Query: 600 YQAA--SPDEIAIVKFTESVGL-----------SLFKRDRXXXXXXXXXXXXXXTYEILQ 646
              A   P EIAI  F   + L           +    +                +E + 
Sbjct: 474 CWKAHGDPTEIAIQVFATKMDLPHNALTGEKSTNQSNENDQSSLSQHNEKPGSAQFEHIA 533

Query: 647 VFPFNSDSKRMGIIVHDEQKDEYWFMQKGA--------------DTVMARIVENND--WL 690
            FPF+S  KRM  + ++   + Y    KGA              D V    + + D   +
Sbjct: 534 EFPFDSTVKRMSSVYYNNHNETYNIYGKGAFESIISCCSSWYGKDGVKITPLTDCDVETI 593

Query: 691 EEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKY-LEYD 749
            +   +++ EGLR L    K         F KD        VN DQ  N    +   E D
Sbjct: 594 RKNVYSLSNEGLRVLGFASK--------SFTKD-------QVNDDQLKNITSNRATAESD 638

Query: 750 LELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHI 809
           L  LGL G+ D  +N+   +++    AGI + MLTGD V TA+ ++         Q V I
Sbjct: 639 LVFLGLIGIYDPPRNETAGAVKKFHQAGINVHMLTGDFVGTAKAIA---------QEVGI 689

Query: 810 ITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTP 869
           +          N   Y +    + ++   +  G+       E  D +  LP V+A RC+P
Sbjct: 690 LPT--------NLYHYSQEIVDSMVMTGSQFDGL-----SEEEVDDLPVLPLVIA-RCSP 735

Query: 870 QQKADVALVIREFTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 918
           Q K  V ++      K+ C + GDG ND   ++ A+VG+  GI G +  K+AS
Sbjct: 736 QTK--VRMIEALHRRKKFCTMTGDGVNDSPSLKMANVGIAMGINGSDVSKEAS 786

>Kwal_23.3160
          Length = 1100

 Score = 93.2 bits (230), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 191/812 (23%), Positives = 317/812 (39%), Gaps = 199/812 (24%)

Query: 209 NLYFLVVALSQAIPALRIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNS---EL 265
           N   LV+ +S  I      ++S  V+  AFV+ + ++  +  + +  +  N   S     
Sbjct: 78  NAMILVLFISMVITLAIRDWISGGVI--AFVVFINVAIGSYQEYKASKTMNSLKSLSTPS 135

Query: 266 YHVL--NQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQ--LDGET 321
            HV+     + +PSK L  GDL  +  GD +PADL L++          +TD+  L GE+
Sbjct: 136 AHVIRDGNDETIPSKQLVPGDLCVVKAGDTVPADLRLIECVN------FETDEALLTGES 189

Query: 322 ----DWKLRIAPALTQNLTEPDLMN---------KVSITASAPEKAIHNFLGKVTYKDTS 368
                   ++ PA T++    D +N         K   T    +  ++  +GK+      
Sbjct: 190 LPIAKEASQVYPA-TEDTPVGDRLNLAFASSTVSKGRATGIVVKTGLNTEIGKIAQSLKG 248

Query: 369 SNPL---SIDNTLWAN---TVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEIN 422
            N L     + T WAN   T+ A+ G  +G              TTT T     L  +++
Sbjct: 249 DNSLISKDENKTFWANAGITLAATIGSFLG--------------TTTGTP----LHRKLS 290

Query: 423 SISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFS-TIIPVSLRVNLDLAKSVYA 481
            ++ +L       +I+++    F  +    +V  Y I  + ++IP SL V L +  SV A
Sbjct: 291 KLAVLLFFIAVVFAIVVMATQKFVVNK---EVAIYAICVAVSMIPSSLVVVLTITMSVGA 347

Query: 482 HQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSE 538
             +   + +    VR     E LG +  + SDKTGTLTQ  M +K+      GT++ +  
Sbjct: 348 KIMATRNVV----VRKLDSLEALGAVNDVCSDKTGTLTQGKMIVKQAWVPSFGTITVS-- 401

Query: 539 TLDIVSDYVDALVNSSNSANPSGKSV-------PSTSRKD-------------------- 571
                        NSSN  +P+   +       P   + D                    
Sbjct: 402 -------------NSSNPFDPTDGGIELIPRFSPHQYKHDSTEDVGIITSFKNKFYNDKL 448

Query: 572 ---LSARVRDMVVTLAICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGL---SLFK 623
              L++++    +  A   N+   ++D E     A   P EIAI  F   + +   +L  
Sbjct: 449 PAGLNSKLFLNWLKTAALANIAHVYQDPETEEWKAHGDPTEIAIQVFAHKLDMPRNALTA 508

Query: 624 RDRXXXXXXXXXXXXXXT------YEILQVFPFNSDSKRM-GIIVHDEQKDEYWFMQKGA 676
            D+              T      Y+ +  FPF+S  KRM  + V  ++ + +    KGA
Sbjct: 509 EDKSDSESDEDAALGEKTSSVEPHYKHIAEFPFDSSIKRMSAVYVSLDEDNAHRVFTKGA 568

Query: 677 DTVMARIVEN-NDWL-----------------EEETGN---MAREGLRTLVVGRKKLSRN 715
                R+++    WL                 EE   N   ++ EGLR L    K  + +
Sbjct: 569 ---FERVLDCCTKWLPDGCNESDAKPMTEEDKEEVFKNVETLSSEGLRVLAFATKSFTES 625

Query: 716 IYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRN 775
              +  +D         NRD         ++E DL   GL G+ D  + +   +++    
Sbjct: 626 QALKVSEDLRK------NRD---------FVESDLIFQGLVGIYDPPRQETAGAVKQFHK 670

Query: 776 AGIKIWMLTGDKVETARCVSISAKLISRGQYVH---IITKLTKPEGALNQLEYLKVNKGA 832
           AGI + MLTGD   TA+ ++    ++ R  Y +   ++  +       +QL         
Sbjct: 671 AGINVHMLTGDFPGTAKAIAQEVGILPRNLYHYPKEVVDSMVMTAAQFDQL--------- 721

Query: 833 CLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADV--ALVIREFTGKRVCCI 890
                             E  D ++ LP V+A RC PQ K  +  AL  RE    + C +
Sbjct: 722 ----------------TDEEIDNLLLLPLVIA-RCAPQTKVRMIDALHRRE----KFCAM 760

Query: 891 -GDGGNDVSMIQCADVGV--GIVGKE-GKQAS 918
            GDG ND   ++ A+VG+  GI G +  K AS
Sbjct: 761 TGDGVNDSPSLKKANVGIAMGINGSDVAKDAS 792

>AFR567W [3759] [Homologous to ScYOR291W - SH]
            complement(1455295..1459644) [4350 bp, 1449 aa]
          Length = 1449

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 161/712 (22%), Positives = 285/712 (40%), Gaps = 132/712 (18%)

Query: 275  VPSKDLKVGDLIKISKGDR--LPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALT 332
            VPS DL  GD+ +++      LP D +L+     SG+  +    L GE+       P   
Sbjct: 552  VPSSDLVPGDIYELTDPSLSLLPCDSILI-----SGDCLVNESMLTGES------VP--- 597

Query: 333  QNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIG 392
                    ++KV+ T     + + +F+      DT  +     + L+  T L       G
Sbjct: 598  --------VSKVAATRETMLQLLDDFM------DTQLSSFVSKSFLFNGTKLIRVRATAG 643

Query: 393  CVVYTGRDTRQAMNTTTATV--------KTGLLELEINSISKILCASVFALSIILVVFAG 444
              +  G   R   +TT  ++         TG    E +S   I   S+ AL    V F  
Sbjct: 644  QSIALGMVARTGFSTTKGSLVRSMVFPKPTGFKFYE-DSFKYIGYISIIALFGFAVSFIQ 702

Query: 445  FH--NSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPE 502
            F     D    ++R L + + ++P +L  +L +      ++++       +  R +    
Sbjct: 703  FLRLGLDKRTMILRALDIITVVVPPALPASLSIGTGFALNRLKKKGIFCISPTRVNV--- 759

Query: 503  DLGRIEYLLSDKTGTLTQNDMQLKKIHL-GTVSYTSETLDIVSDYVDALVNSSNSANPSG 561
              G+I+ +  DKTGTLT++ + +  +H+   +    +   +V+D  D L + S S     
Sbjct: 760  -GGKIDVMCFDKTGTLTEDGLDVLGVHVVQPLQQEMKISKLVTDVKDLLQSLSLSD---- 814

Query: 562  KSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT-----ES 616
                  S +D+ A+  + +V+L  CH++     D EL      P +  +V+FT     E 
Sbjct: 815  ----CVSTRDMKAK--NFLVSLLTCHSLR--MVDGELL---GDPFDFKMVQFTKWSDEEE 863

Query: 617  VG----LSLFKRDRXXXXXXXXXXXXXXTYE-----------------ILQVFPFNSDSK 655
             G     SL++                                     I++ F F S+ +
Sbjct: 864  TGNRKVHSLYEERHDGSTMPENSRFAPAIVHPSGKGRFIEREPSNVIGIVRSFEFLSNLR 923

Query: 656  RMGIIVHDEQKDEYWFMQKGADTVMARIVENNDW---LEEETGNMAREGLRTLVVGRKKL 712
            RM +IV    ++ +    KGA  V+  +          E    +    G R +    KKL
Sbjct: 924  RMSVIVKPFSENVFMSFTKGAPEVIFELCSKQTLPLDYEALLHHYTHNGYRVIACAGKKL 983

Query: 713  SRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIEL 772
            +R  +   +K         V+R++         +E +LE LG    E+KL+   K ++E 
Sbjct: 984  TRQSWLYSQK---------VSREE---------IESNLEFLGFIIFENKLKGTTKETLES 1025

Query: 773  LRNAGIKIWMLTGDKVETARCVSISAKLISRGQ-YVHIITKL-TKPEGAL---------- 820
            L  A I+  M TGD V TA  V   A L+   + +V +I  + T  EG +          
Sbjct: 1026 LHRADIRTIMCTGDNVLTAISVGREAGLVESPRVFVSVINDIDTSQEGDIITWQNVANSS 1085

Query: 821  NQLEYLKVNKGA------CLLIDGESLGMFLRYYKREFFDVV--ICLPTVVACRCTPQQK 872
            + L+ + +   +       L + GE   +  +  K +  +V+  I L T +  R +P +K
Sbjct: 1086 DTLDSVTLRPLSGDTDDYTLAVTGEVFRLLFKTDKSQIEEVINNILLKTSIYARMSPDEK 1145

Query: 873  ADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 924
             ++   ++   G +V   GDG ND   ++ AD+G+ +   E   AS+AA F+
Sbjct: 1146 HELVERLQSI-GYQVGFCGDGANDCGALKAADIGISLSEAE---ASVAAPFT 1193

>KLLA0B08217g complement(724364..728683) similar to sp|Q12697
            Saccharomyces cerevisiae YOR291w, start by similarity
          Length = 1439

 Score = 90.9 bits (224), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 152/702 (21%), Positives = 281/702 (40%), Gaps = 113/702 (16%)

Query: 275  VPSKDLKVGDLIKISKGDR--LPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALT 332
            V S DL  GDL +IS      LP D VL+     SG+  +    L GE+       P   
Sbjct: 551  VNSSDLVPGDLFEISDPSLVVLPCDAVLI-----SGDCIVNESMLTGES------VPVSK 599

Query: 333  QNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIG 392
               TE  +   +    S+    + +F+ K ++    +  + + N           G  + 
Sbjct: 600  YAATEATMAQLLQDFKSS---QVSSFVSK-SFLFNGTKIIRVRNQ-------PGQGMALA 648

Query: 393  CVVYTGRDTRQAMNTTTAT----VKTGLLELEINSISKILCASVFALSIILVVFAGFHNS 448
             V+ TG  T +     +      V     E     I  +   ++F  SI  + F      
Sbjct: 649  LVIRTGFSTTKGSLVRSMVFPKPVGFKFYEDSFKYIGFMTLIAMFGFSISCIQFIRL-GL 707

Query: 449  DWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIE 508
            ++ + ++R L + + ++P +L   L +  S    +++       +  R +      G+++
Sbjct: 708  EYKVMILRALDIITIVVPPALPATLTIGTSFALGRLKKKGIFCISPTRVNV----GGKVD 763

Query: 509  YLLSDKTGTLTQNDMQLKKIHLGTVSYTSETL---DIVSDYVDALVNSSNSANPSGKSVP 565
             +  DKTGTLT+  + +  IH      +S  L   D+++D  + L   + S   S +   
Sbjct: 764  MMCFDKTGTLTEEGLDVLGIHFAKPEGSSTILQLSDLITDCDEVLQKHTLSDCNSAEEF- 822

Query: 566  STSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESV---GLSLF 622
                     + ++ +V+L  CH++     D EL      P ++ + +FT+     G   +
Sbjct: 823  ---------KAKNFLVSLLTCHSLKHI--DGELL---GDPLDLKMFEFTKWAYEEGYESW 868

Query: 623  K----RDRXXXXXXXXXXXXXXTY---------EILQVFPFNSDSKRMGIIVHDEQKDEY 669
            K     D+               +          +++ F F S+ +RM +IV   +++ Y
Sbjct: 869  KFKNAEDKTGISPAVVHPTSNCNFIENDPDNLIGVIRSFEFLSELRRMSVIVKGFKENTY 928

Query: 670  WFMQKGADTVMARIVENNDW---LEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDD 726
            W   KGA  V+A I           E   +    G R +    K L ++ +   +K    
Sbjct: 929  WSFTKGAPEVIADICNPATIPKDFHELLHHYTHNGFRIIACAGKTLPKSSWLYSQK---- 984

Query: 727  ASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGD 786
                 V+R++         +E +LE LG    E+KL++  K++++ L+NA I+  M TGD
Sbjct: 985  -----VSREE---------VEDNLEFLGFIVFENKLKSRTKAALKELQNANIRTVMCTGD 1030

Query: 787  KVETARCVSISAKLISRGQYV------------HIIT-KLTKPEGALNQLEYLK----VN 829
             V TA  V   + LIS  +              H+++ +    EG++     LK      
Sbjct: 1031 NVLTAVSVGRDSGLISSERVFIPFLNDNLEESRHLLSWRDVDEEGSVLDAVTLKPLNDPE 1090

Query: 830  KGACLLIDGESLGMFLR---YYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKR 886
            K   L I G+   +  R       ++   V+   ++ A R +P +K ++   +++     
Sbjct: 1091 KSYTLAITGDIFRILFRNDEILPDDYISTVLMKGSIYA-RMSPDEKHELVEQLQKLDYNV 1149

Query: 887  VCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEF 928
              C GDG ND   ++ A++G+ +   E   AS+AA F+   F
Sbjct: 1150 GFC-GDGANDCGALKAANIGISLSEAE---ASVAAPFTSAVF 1187

>Scas_665.30
          Length = 1439

 Score = 87.4 bits (215), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 162/750 (21%), Positives = 282/750 (37%), Gaps = 143/750 (19%)

Query: 249 MDDIQRRRRDNESNSELYHVLNQSKL--------VPSKDLKVGDLIKISKGDR--LPADL 298
           +D +   RR  +S +++ H   + ++        V S DL  GD+ +IS       P D 
Sbjct: 306 VDTLVETRRTQKSLADMSHFACEVRVFRDEFWTNVNSADLVPGDIYEISDPSLTVFPCDS 365

Query: 299 VLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNF 358
           +LL     SG+  +    L GE       +  +++   EP+ M  + +        I ++
Sbjct: 366 LLL-----SGDCIVNESMLTGE-------SVPVSKFPAEPETM--LQLLDDFQNTQISSY 411

Query: 359 LGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQA--MNTTTATVKTGL 416
           L K        + L    T+    +       +  VV TG  T +   + +      TG 
Sbjct: 412 LSK--------SFLFNGTTIIRARIPYGQSAALAMVVRTGFSTTKGSLVRSMVFPKPTGF 463

Query: 417 --LELEINSISKILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLD 474
              E     I  +   ++F  SI  + F      D    ++R L + + ++P +L   L 
Sbjct: 464 KFYEDSFKYIGVMALIALFGFSISCIQFIKI-GLDKRTMILRALDIITIVVPPALPATLT 522

Query: 475 LAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVS 534
           +       +++       +  R +      G+I+ L  DKTGTLT+N + +  + L   S
Sbjct: 523 IGTGFALSRLKKKGIFCISPTRVNI----GGKIDILCFDKTGTLTENGLDVLGVQLCVPS 578

Query: 535 YTS--ETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLSA----RVRDMVVTLAICHN 588
             +  +  D+V D                K  P  S  D S+    R ++  ++L  CH+
Sbjct: 579 SHNSFQFADLVQDV--------------HKLFPKFSLNDCSSPRDYRAKNFFISLLTCHS 624

Query: 589 VTPTFEDDELTYQAASPDEIAIVKFT---------ESVGLSLFKRDRXXXXXXXXXXXXX 639
           +     D+EL      P +  + +FT         E    S ++  R             
Sbjct: 625 LRVV--DNELI---GDPLDFKMFQFTKWSYEEDFQEKEFHSTYEERRHDNALPENIDIIP 679

Query: 640 XTYE--------------------ILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTV 679
                                   I++ F F S+ +RM +IV    +D YW   KGA  V
Sbjct: 680 AVVHPNSADPENTFIDNDPHNFLGIIRSFEFLSELRRMSVIVKPSNEDVYWAFTKGAPEV 739

Query: 680 MARIVENNDW---LEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQ 736
           + +I          EE       +G R +    + L RN +   +K         V+R++
Sbjct: 740 ITQICNKATLPANFEEMLNYYTHKGYRVIACAGRVLPRNTWLYSQK---------VSREE 790

Query: 737 QMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSI 796
                    +E ++E LG    E+KL+ +   +++ L+ A I+  M TGD V TA  V  
Sbjct: 791 ---------VESNMEFLGFIIFENKLKKETAKTLQTLQEASIRTVMCTGDNVLTAISVGR 841

Query: 797 SAKLI--------------SRGQYVHIITKLTKPEGALNQLEYLKVNKGA----CLLIDG 838
              LI              S GQ   I   +   +  L+    L +N  +     L I G
Sbjct: 842 QCNLIKSKKVYVPSLEEIDSTGQTSIIWRDVDNMDDTLDSRTLLPINNSSSTSYTLAITG 901

Query: 839 ESLGMFL----RYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGG 894
           +   +           ++ + V+   T+ A R +P +K ++   ++        C GDG 
Sbjct: 902 DIFRIIFGDENNSISEDYINTVLLKGTIYA-RMSPDEKHELMEQLQRLNYTVGFC-GDGA 959

Query: 895 NDVSMIQCADVGVGIVGKEGKQASLAADFS 924
           ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 960 NDCGALKAADVGISLSEAE---ASVAAPFT 986

>CAGL0A00517g 58830..62198 similar to sp|P38929 Saccharomyces
           cerevisiae YGL006w PMC1, hypothetical start
          Length = 1122

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 169/773 (21%), Positives = 301/773 (38%), Gaps = 140/773 (18%)

Query: 274 LVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDW--KLRIAPAL 331
           L+   +L VGDL+K+  GD +PAD VL++     GE       L GE++   KL +A AL
Sbjct: 169 LISIHNLLVGDLLKLQTGDVVPADCVLVR-----GECETDESALTGESNTIKKLPLADAL 223

Query: 332 TQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLS--IDNTLWANTVLAS--- 386
                                   H+  G     DTS++  S   D++   + +L S   
Sbjct: 224 E----------------------YHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSR 261

Query: 387 --TGFCIGCVVYTGRDT--RQAMNTTTATVKTGLLELEINSISKILC--ASVFALSIILV 440
             +G     V   G ++   + M +     +   L++ ++ ++  +     V A+++ +V
Sbjct: 262 VLSGLASAIVTNVGVNSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVV 321

Query: 441 VFAGF-----HNSDWYLDV---------MRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 486
           +FA +      +   Y D+         M   I   T+I V++   L LA ++       
Sbjct: 322 LFARYLSYILPSGGKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATT 381

Query: 487 DDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSD- 545
             T    +VR     E +G    + SDKTGTLT+N M + +  LG   +     DI +D 
Sbjct: 382 RMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFD----DIGADP 437

Query: 546 -------------------YVDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAIC 586
                              Y + ++NS+   N   K   + +  D S   R +       
Sbjct: 438 SKSNLVFKKKCSDLLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTL 497

Query: 587 HNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRD-----RXXXXXXXXXXXXXXT 641
               P  E++ L + A    E  I   TE+  LSL ++                      
Sbjct: 498 QKKKPDDEENLLAHAAEGRQEPYIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPTV 557

Query: 642 YEILQVFPFNSDSKRMGIIVH-----DEQKDEYWFMQKGADTVMARIV------------ 684
             I+Q+ PF S  K   I+V      + +  ++    KGA  ++A+              
Sbjct: 558 ETIVQIIPFESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISE 617

Query: 685 ---ENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAV 741
              ++ D +EE+  ++A++ LR + +       N +    K+  D   S      ++   
Sbjct: 618 IDQKSKDDIEEQIFSLAKDALRAISLAHMDFDVNEWP--PKELADPENSHEALAVKLIDP 675

Query: 742 ITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLI 801
              +LE  L L  + G++D L+ +VK+S+   + AG+ + M+TGD + TA+ ++ +  ++
Sbjct: 676 KKPHLE-GLTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGIL 734

Query: 802 SRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPT 861
           S                         +N  AC + +G +        ++        LP 
Sbjct: 735 SSKS----------------------LNDSACAM-EGPAFRKLSDSERKRI------LPK 765

Query: 862 V-VACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQAS 918
           + V  R +P+ K  +   ++E  G+ V   GDG ND   ++ ADVG  +GI G E  + +
Sbjct: 766 LRVLARSSPEDKKILVRALKEM-GEVVAVTGDGTNDAPALKLADVGFSMGITGTEVAREA 824

Query: 919 LAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICS 971
                   +F  +   + W GR       K  QF +   +   +   V S+ S
Sbjct: 825 SDIILMTDDFSAIVNAIKW-GRCVAASIKKFIQFQLIVNVTAVLLTFVTSVIS 876

>AFL011W [3182] [Homologous to ScYGL006W (PMC1) - SH]
           complement(415265..418993) [3729 bp, 1242 aa]
          Length = 1242

 Score = 87.0 bits (214), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 172/795 (21%), Positives = 313/795 (39%), Gaps = 129/795 (16%)

Query: 250 DDIQRRRR-----DNESNSELYHVLNQSKLVPS-KDLKVGDLIKISKGDRLPADLVLLQS 303
           +D Q+ R+       + ++E+  V N  K V S  DL VGDL+ +  GD +P D +L++ 
Sbjct: 165 NDYQKERQFARLNRKKEDTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVDCILVEG 224

Query: 304 SEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVT 363
                E+ I      GE+D   +++ A++  +         ++ A  P   I +      
Sbjct: 225 KCECDESGIT-----GESDTIKKVSLAMSLQVYR-------TVAADNPSADIGS------ 266

Query: 364 YKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTTTATVKTGLLELEINS 423
             D   + +     +  + +L+  G  +   V       + M    +  +T  L+  +N+
Sbjct: 267 -SDNGHSLVPDPMLISGSKLLSGIGHAVVTAVGPHSVHGKMMLALKSEPETTPLQERLNT 325

Query: 424 ISKILC--ASVFALSIILVVFAGF----------HNSDWYLDVMRYLILFSTII------ 465
           ++  +    SV A  + +V+F  F          H+        R++ +F T +      
Sbjct: 326 LADDISIYGSVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVA 385

Query: 466 -PVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQ 524
            P  L + + LA +    ++  D  +    VR     E +G    + SDKTGTLTQN M 
Sbjct: 386 VPEGLPLAVTLALAFATTRMTKDGNL----VRVLRACETMGSATTVCSDKTGTLTQNKMV 441

Query: 525 LKKIHLGTVSYTSETLDIVSDYVDALVN--SSNSANPSGKSVPSTSRKDLSARVRDMVVT 582
           + K  LG+  +   + D      DAL    S ++ N    ++   S    + +V D V+T
Sbjct: 442 VVKGFLGSSHFDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFENKQVADPVIT 501

Query: 583 LAICH----NVTPTFEDDELTYQAASPDEIAIVKF-----TESVGLSLFKRDRXXXXXXX 633
               H    ++ P   +++  Y A     +   +F     TE+  LSL K          
Sbjct: 502 ENPYHKPRRSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQA 561

Query: 634 XX--XXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARI----VENN 687
                       I+Q+ PF S  K  G++V     +  +F++  ++T+          N+
Sbjct: 562 LRDDPHHIGIASIVQMIPFESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSND 621

Query: 688 DWLE---EETG-------NMAREGLRTLVVGRKKLSRNIYDQFKKDYDDAS-LSMVNRDQ 736
           D ++   ++ G       N+A + LRT+ +  K  + +I      +  DAS  S  + D 
Sbjct: 622 DVIKLSPQKHGEIFGLINNLASDALRTISLAHKDFT-DISSWPPAELRDASDPSTASPDL 680

Query: 737 QMN-----------AVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTG 785
            +            ++IT      L L G+ G+ D L+  VK S++  + +G+ + M+TG
Sbjct: 681 LLGDEYVPTATDRPSIITNN-NSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITG 739

Query: 786 DKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFL 845
           D + T R ++ +  ++S  +Y      +  P                          +F 
Sbjct: 740 DNITTGRAIARACGILSESEYADHECAMEGP--------------------------VFR 773

Query: 846 RYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADV 905
           +  +R+  D    L   V  R +P+ K     ++++   + V   GDG ND   +  ADV
Sbjct: 774 KLSRRQMMDAAPKLK--VLARSSPEDKRIFVDILKKMN-EVVAVTGDGTNDAPALTLADV 830

Query: 906 G--VGIVG----KEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLV 959
           G  +GI G    +E     L  D    +F  +   + W GR       K  QF +   + 
Sbjct: 831 GFSMGISGTGVAREASDIILMTD----DFTSIVNAIKW-GRCVSLSIKKFIQFQLTVNIT 885

Query: 960 IAICQAVYSICSKFE 974
                 V ++ S  E
Sbjct: 886 AVTLTCVTAVTSTEE 900

>Scas_707.48*
          Length = 741

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 168/692 (24%), Positives = 272/692 (39%), Gaps = 177/692 (25%)

Query: 267 HVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLR 326
           HVL  S LVP      GDL+    GDR+PADL ++++ + S    I    L GE      
Sbjct: 163 HVL-ASGLVP------GDLVHFKIGDRIPADLRIIEAVDLS----IDESNLTGEN----- 206

Query: 327 IAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSN--PLSIDNTLWANTVL 384
                     EP       +  SA E      + K ++ D  ++  P+S    +     L
Sbjct: 207 ----------EP-------VHKSAKE------VNKDSFNDQPNSIIPISDRTCVAYMGTL 243

Query: 385 ASTGFCIGCVVYTGRDTRQA----MNTTTATVKTGLLELEINSISKILCASVFALSII-L 439
              G   G VV  G++T       M +     KT L +  ++ + K L  S+F+  +I L
Sbjct: 244 VKEGHGKGIVVGIGKNTSFGAIFEMLSNIEKPKTPL-QNAMDKLGKDL--SLFSFIVIGL 300

Query: 440 VVFAGFHNSDWYLDVMRYLILFSTI-----IPVSLRVNLDLAKSVYAHQIEHDDTIPETI 494
           +   G      +L++ +  +  +       +P+ + V L L     A +        + I
Sbjct: 301 ICLVGILQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAI 352

Query: 495 VRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSS 554
           VR     E LG +  + SDKTGTLT N M   KI                  +D++ N +
Sbjct: 353 VRRLPSVETLGSVNVICSDKTGTLTSNHMTASKIWC----------------LDSMANKA 396

Query: 555 NSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT 614
           N  +   KS   + +  L+  V+  +    IC+N +  F  +   Y   +P +IA+++  
Sbjct: 397 NVLSLE-KSKSGSLKNYLTEDVKSTLTIGNICNNAS--FSQEHGKY-LGNPTDIALLEQL 452

Query: 615 ESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGI-IVHDEQKDEYWFMQ 673
               LS  +                 T++ +Q  PFNS  K M + IV+ E K  Y    
Sbjct: 453 SKFDLSDIR----------------PTFKKVQEIPFNSKRKFMAVKIVNSEGK--YSLCV 494

Query: 674 KGA-DTVMARIVE--------------NNDWLEEETGNMAREGLRTLVVGRKKLSRNIYD 718
           KGA + V+++                   D + E   ++A EGLR L   +  L      
Sbjct: 495 KGAFEKVLSQCSHYLNQKGKTEKLTQGQRDVIIETANSLASEGLRMLAFAKTTLP----- 549

Query: 719 QFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGI 778
                 D  +L            +T+    DL   GL G+ D  +  VK +IE L   G+
Sbjct: 550 ------DSPTL------------LTEESVGDLIFTGLIGMNDPPRPTVKPAIEQLLQGGV 591

Query: 779 KIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKP--EGALNQLEYLKVNKGACLLI 836
            I M+TGD   TA               V+I  ++  P  +  L+ L   K+N+     +
Sbjct: 592 HIIMITGDSENTA---------------VNIARQIGIPVLDPKLSVLSGDKLNE-----M 631

Query: 837 DGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGND 896
             + L   + +               +  R TP+ K ++   +R+  G  V   GDG ND
Sbjct: 632 SDDQLANVIDHVN-------------IFARATPEHKLNIVRALRK-RGDVVAMTGDGVND 677

Query: 897 VSMIQCADVGVGIVGKEGKQ-ASLAADFSITE 927
              ++ AD+GV + G+ G   A  A+D  +T+
Sbjct: 678 APALKLADIGVSM-GRMGTDVAKEASDMVLTD 708

>Kwal_14.1498
          Length = 939

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 174/797 (21%), Positives = 317/797 (39%), Gaps = 184/797 (23%)

Query: 169 PSTTPVYDRN-RYPGNEISNAKYNAFTFIPTLLYEQFKFFYNLYFLVVALSQAIPALRIG 227
           P+ + V +R  +Y  NEIS+ +         L ++    F     +++ +  A+ +  +G
Sbjct: 54  PTMSVVEERRAQYGKNEISSEEDEP------LWWKFVTTFVGDPLILLLIGSAVISFIMG 107

Query: 228 YLSSYV-VPLAFVLTVTM-------SKEAMDDIQRRRRDNESNSELYHVLNQSKLVPSKD 279
            +   V + LA V+ VT+       S+++++ + R   D      L     +SKL+ S  
Sbjct: 108 NIDDAVSITLAIVIVVTVGFVQEYRSEKSLEALNRLVPDQ---CHLIRCGQESKLLASV- 163

Query: 280 LKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPD 339
           L  GD+++   GDR+PADL ++++ + S    I+   L GE +   +    + +   + +
Sbjct: 164 LVPGDVVRFRVGDRIPADLRIIEAVDLS----IEESNLTGENEPVHKSTATVNKEFYKEN 219

Query: 340 LMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGR 399
           L + V ++    E++   F+G                       L   G   G V+ T +
Sbjct: 220 LGSIVPVS----ERSCIAFMG----------------------TLVREGHGRGIVIGTAK 253

Query: 400 DTR-----QAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNSDWY--- 451
           +T      + MN      KT L +  ++ + K L    F +  I+ +        W    
Sbjct: 254 NTAFGKVFEMMNAIEKP-KTPL-QTAMDKLGKDLSFMSFIVIGIICLIGVIQGRSWLEMF 311

Query: 452 -LDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYL 510
            + V   +      +P+ + V L L     A +          I+R     E LG +  +
Sbjct: 312 QISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------RAIIRRLPSVETLGSVNVI 363

Query: 511 LSDKTGTLTQNDMQLKKIH-LGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSR 569
            SDKTGTLT N M + K+  LG++S  S  L +                   K+   + +
Sbjct: 364 CSDKTGTLTANHMSVNKVWCLGSMSNKSNILKL------------------DKATSGSFK 405

Query: 570 KDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRXXX 629
           K+L+  +R  + T  +C+N T + E  +      +P +IA+++     GL          
Sbjct: 406 KNLTEDLRATLRTGNLCNNSTYSHEHAKYL---GNPTDIALLEVLHKFGLE--------- 453

Query: 630 XXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA------------- 676
                      + EI     FNS  K M + V  E   ++    KGA             
Sbjct: 454 ---DERPQVTRSDEI----SFNSKRKFMAVKVK-EANGKFVVHVKGAYEKILEKSTHFIN 505

Query: 677 -DTVMARIVEN-NDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNR 734
            +  + ++  N    + +    +A +GLRTL   + +LS     +  +D           
Sbjct: 506 AENKVVKLDSNLRQAITDSADALASDGLRTLAFAQLELSNGNSKKLTED----------- 554

Query: 735 DQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCV 794
              +N          L   GL G+ D  +  VK+++E L    + I M+TGD   TA  V
Sbjct: 555 --DING---------LTFAGLLGMNDPPRPSVKAAVERLSEGSVHIIMITGDAENTA--V 601

Query: 795 SISAKLISRGQYVHIITKLTKPEGAL---NQLEYLKVNKGACLLIDGESLGMFLRYYKRE 851
           SI+ +         I   +  PE A+   ++L+++  ++ A ++   + + +F       
Sbjct: 602 SIARQ---------IGIPVVNPETAVLTGDKLDHMSEDQLASII---DHVNIF------- 642

Query: 852 FFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVG 911
                         R TP+ K ++   +++  G  V   GDG ND   ++ AD+GV + G
Sbjct: 643 -------------ARATPEHKLNIVRALQK-RGDIVAMTGDGVNDAPALKLADIGVSM-G 687

Query: 912 KEGKQ-ASLAADFSITE 927
           K G   A  A+D  +T+
Sbjct: 688 KMGTDVAKEASDMVLTD 704

>CAGL0I04312g complement(382354..385209) highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1 Ca2+-transporting
           P-type ATPase, start by similarity
          Length = 951

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 155/687 (22%), Positives = 261/687 (37%), Gaps = 176/687 (25%)

Query: 275 VPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQN 334
           V + +L  GDL++   GDR+PAD+ +++ ++ +    I    L GETD            
Sbjct: 172 VLATNLVPGDLVRFRIGDRIPADIRIIECNDLT----IDESNLTGETD------------ 215

Query: 335 LTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSN--PLSIDNTLWANTVLASTGFCIG 392
                           P    +  L + +Y D  ++  P++    +     L   G   G
Sbjct: 216 ----------------PVHKSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRG 259

Query: 393 CVVYTGRDTRQA----MNTTTATVKTGLLELEINSISKILCASVFALSIILVVFAGFHNS 448
            VV TGR+T       M ++    KT L +L ++ + K L  + F +  I+ V       
Sbjct: 260 IVVGTGRETSFGNVFEMMSSIEKPKTPL-QLTMDKLGKDLSLASFVVIGIICVVGIIQGR 318

Query: 449 DWY----LDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDL 504
            W     + V   +      +P+ + V L L     A +        + IVR     E L
Sbjct: 319 SWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVRRLPSVETL 370

Query: 505 GRIEYLLSDKTGTLTQNDMQLKKI-HLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKS 563
           G +  + SDKTGTLT N M + KI  LG+++     L +               N  G  
Sbjct: 371 GSVNVICSDKTGTLTSNHMTVSKIWCLGSMANKLNVLSL-------------DKNKGG-- 415

Query: 564 VPSTSRKDLSARVRDMVVTLAICHNV--TPTFEDDELTYQAASPDEIAIVKFTESVGLSL 621
                  +L   + D V T  +C N+    ++  +   Y   +P ++A+++  +   L+ 
Sbjct: 416 -------NLKNYLTDDVKTTLLCGNLCNNASYSQEHAKY-LGNPTDVALLEQLQKFELAD 467

Query: 622 FKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMA 681
            + +                Y  ++   FNS  K M   + D +K    F+ KGA     
Sbjct: 468 VRSE----------------YTKVKELSFNSKRKMMATKIQDNEKKTTLFI-KGA---FE 507

Query: 682 RIVENNDWLEEETG------------------NMAREGLRTLVVGRKKLSRNIYDQFKKD 723
           RI++ +     E G                   +A EGLR L   ++ ++          
Sbjct: 508 RILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMT---------- 557

Query: 724 YDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWML 783
             D+S  +V  D             DL   GL G+ D  ++ VK +I+     GI I M+
Sbjct: 558 --DSSSKLVEDDIS-----------DLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMI 604

Query: 784 TGDKVETARCVSISAKLISRGQYVHIITKLTKP--EGALNQLEYLKVNKGACLLIDGESL 841
           TGD   TA               V+I  ++  P  +  L+ L   K+N+     +  + L
Sbjct: 605 TGDSENTA---------------VNIARQIGIPVIDPKLSVLSGDKLNE-----MTDDQL 644

Query: 842 GMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQ 901
              + +               +  R TP+ K ++   +R   G  V   GDG ND   ++
Sbjct: 645 ANVIDHVN-------------IFARATPEHKLNIVRALRR-RGDVVAMTGDGVNDAPALK 690

Query: 902 CADVGVGIVGKEGKQ-ASLAADFSITE 927
            AD+GV + G+ G   A  A+D  +T+
Sbjct: 691 LADIGVSM-GRMGTDVAKEASDMILTD 716

>YGL167C (PMR1) [1823] chr7 complement(187620..190472)
           Ca2+-transporting P-type ATPase of Golgi membrane
           involved in Ca2+ and Mn2+ import into Golgi [2853 bp,
           950 aa]
          Length = 950

 Score = 80.5 bits (197), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 168/691 (24%), Positives = 278/691 (40%), Gaps = 168/691 (24%)

Query: 267 HVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLR 326
           HVL  S LVP      GDL+    GDR+PAD+ ++++ + S    I    L GE      
Sbjct: 163 HVL-ASTLVP------GDLVHFRIGDRIPADIRIIEAIDLS----IDESNLTGEN----- 206

Query: 327 IAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLAS 386
                     EP     V  T+   EK+  N       +  S  P+S  + +     L  
Sbjct: 207 ----------EP-----VHKTSQTIEKSSFN------DQPNSIVPISERSCIAYMGTLVK 245

Query: 387 TGFCIGCVVYTGRDTR-----QAMNTTTATVKTGLLELEINSISKILCASVFALSIILVV 441
            G   G VV TG +T      + MN      KT L +L ++ + K L    F + I ++ 
Sbjct: 246 EGHGKGIVVGTGTNTSFGAVFEMMNNIEKP-KTPL-QLTMDKLGKDLSLVSF-IVIGMIC 302

Query: 442 FAGFHNSDWYLDVMRYLILFSTI-----IPVSLRVNLDLAKSVYAHQIEHDDTIPETIVR 496
             G      +L++ +  +  +       +P+ + V L L     A +        + IVR
Sbjct: 303 LVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKR--------KAIVR 354

Query: 497 TSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNS 556
                E LG +  + SDKTGTLT N M + K+           LD +S+ ++ L   S  
Sbjct: 355 RLPSVETLGSVNVICSDKTGTLTSNHMTVSKLW---------CLDSMSNKLNVL---SLD 402

Query: 557 ANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTES 616
            N   K+     +  L+  VR+ +    +C+N +  F  +   +   +P ++A+++   +
Sbjct: 403 KNKKTKNSNGNLKNYLTEDVRETLTIGNLCNNAS--FSQEHAIF-LGNPTDVALLEQLAN 459

Query: 617 VGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA 676
             +   +                 T + +Q  PFNS  K M   + +   ++     KGA
Sbjct: 460 FEMPDIRN----------------TVQKVQELPFNSKRKLMATKILNPVDNKCTVYVKGA 503

Query: 677 DTVMARIVE-------------------NNDWLEEETGNMAREGLRTLVVGRKKLSRNIY 717
                RI+E                       + E   +MA EGLR  V G  KL+    
Sbjct: 504 ---FERILEYSTSYLKSKGKKTEKLTEAQKATINECANSMASEGLR--VFGFAKLT---- 554

Query: 718 DQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAG 777
                   D+S  +           T+ L  DL   GL G+ D  + +VK +IE L   G
Sbjct: 555 ------LSDSSTPL-----------TEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGG 597

Query: 778 IKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLID 837
           + I M+TGD   TA  V+I+ ++   G  V I  KL+   G  ++L+ +  ++ A ++  
Sbjct: 598 VHIIMITGDSENTA--VNIAKQI---GIPV-IDPKLSVLSG--DKLDEMSDDQLANVI-- 647

Query: 838 GESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDV 897
            + + +F                     R TP+ K ++   +R+  G  V   GDG ND 
Sbjct: 648 -DHVNIF--------------------ARATPEHKLNIVRALRK-RGDVVAMTGDGVNDA 685

Query: 898 SMIQCADVGVGIVGKEGKQ-ASLAADFSITE 927
             ++ +D+GV + G+ G   A  A+D  +T+
Sbjct: 686 PALKLSDIGVSM-GRIGTDVAKEASDMVLTD 715

>KLLA0F20658g 1919851..1923099 similar to sp|Q12691 Saccharomyces
           cerevisiae YDR038c ENA5 P-type ATPase involved in Na+
           efflux, start by similarity
          Length = 1082

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 126/492 (25%), Positives = 202/492 (41%), Gaps = 75/492 (15%)

Query: 463 TIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 522
           ++IP SL V L +  S  A  +   + I    VR     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGAKVMATRNVI----VRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 523 MQLKKIHLG-----TVSYTSETLDIVSDYVDALVNSS-----NSANPSGKSVPSTSRKDL 572
           M  K++ +      TV  ++E  +     +  +   S     +        +P    K L
Sbjct: 379 MIAKQVWIPQFGTITVQESNEPFNPTIGEIHLIPKFSPYQYKHDDEEDVGIIPDFKSKYL 438

Query: 573 SARVRDMVVTL-------AICHNVTPTFEDDELTYQAA--SPDEIAIVKFTESVGLS--- 620
           +  +  + V+L       A   N+   F+D E     A   P EIAI  F   + L    
Sbjct: 439 AGELGPLNVSLFDQWLYTATLANIATVFQDSETQDWKAHGDPTEIAIQVFATRMDLPRHV 498

Query: 621 LFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGII---VHDEQKDEYWFMQKGAD 677
           L   D+              ++E +  FPF+S  KRM  I     D     Y    KGA 
Sbjct: 499 LTGEDKDDEKDARANS----SFEHVAEFPFDSSVKRMSAIYKNTEDPATPIYEVFTKGA- 553

Query: 678 TVMARIVENND-WLEEETGN---MAREGLRTLVVGRKKLSRN---IYDQFKKDYDDASLS 730
               R+++  D W     G    +++E L T+      LS     +    KK ++++  +
Sbjct: 554 --FERVLQCCDSWYTTPDGKPSPLSKEDLETIQKNVDTLSSEGLRVLAFAKKSFNESEFN 611

Query: 731 MVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVET 790
             N+D+ +      ++E  L  LGL G+ D  + +  ++++    AGI + MLTGD   T
Sbjct: 612 -ANKDKLLKE--RDFVECKLTFLGLIGIYDPPRQESLAAVKKCHQAGINVHMLTGDFPGT 668

Query: 791 ARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKR 850
           A+ ++    ++    Y +       P+  +N +     +  A  L D E           
Sbjct: 669 AKSIAQEVGILPHNLYHY-------PKEVVNFMVMAATDFDA--LSDQE----------- 708

Query: 851 EFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCI-GDGGNDVSMIQCADVGV-- 907
              D +  LP V+A RC PQ K  V ++       + C + GDG ND   ++ A+VG+  
Sbjct: 709 --IDDLRVLPLVIA-RCAPQTK--VRMIEALHRRSKFCAMTGDGVNDSPSLKIANVGIAM 763

Query: 908 GIVGKE-GKQAS 918
           GI G +  K AS
Sbjct: 764 GINGSDVAKDAS 775

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 7/100 (7%)

Query: 209 NLYFLVVALSQAIPALRIGYLSSYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNS---EL 265
           N   +V+ +S  I      ++S  V  LAFV+ + +   A  +    +  N   S     
Sbjct: 74  NAMIMVLIISMVITLAIKDWISGGV--LAFVVGINVVIGAYQEYNASKTMNSLKSLSTPS 131

Query: 266 YHVLNQSK--LVPSKDLKVGDLIKISKGDRLPADLVLLQS 303
            HV+       + SK+L  GD+  I  GD +PADL LL+S
Sbjct: 132 AHVIRDGNDITIQSKELVPGDICIIKVGDTVPADLRLLES 171

>YOR291W (YOR291W) [5075] chr15 (861172..865590) Member of the
            cation-translocating P-type ATPase superfamily of
            membrane transporters [4419 bp, 1472 aa]
          Length = 1472

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 107/530 (20%), Positives = 211/530 (39%), Gaps = 98/530 (18%)

Query: 454  VMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSD 513
            ++R L + + ++P +L   L +  +    +++       +  R +      G+I+ +  D
Sbjct: 726  ILRALDIITIVVPPALPATLTIGTNFALSRLKEKGIFCISPTRLNIS----GKIDVMCFD 781

Query: 514  KTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRKDLS 573
            KTGTLT++ + +  + +      SE   +       L++      P       +S  D  
Sbjct: 782  KTGTLTEDGLDVLGVQI------SEPNGVRGQKFGELLSDIRQVFPKFSLNDCSSPLDFK 835

Query: 574  ARVRDMVVTLAICHNVTP--------------------TFEDD------ELTYQAASPDE 607
            +R  +  ++L  CH++                      +FE+D         Y+    D+
Sbjct: 836  SR--NFFMSLLTCHSLRSVDGNLLGDPLDFKMFQFTGWSFEEDFQKRAFHSLYEGRHEDD 893

Query: 608  IAIVKFTESVGL--SLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQ 665
            +    F E+  +  ++   D                  +++ F F S+ +RM +IV    
Sbjct: 894  V----FPENSEIIPAVVHPDSNNRENTFTDNDPHNFLGVVRSFEFLSELRRMSVIVKTNN 949

Query: 666  KDEYWFMQKGADTVMARIVENNDW---LEEETGNMAREGLRTLVVGRKKLSRNIYDQFKK 722
             D YW   KGA  V++ I   +      EE        G R +    K L +  +   +K
Sbjct: 950  DDVYWSFTKGAPEVISEICNKSTLPADFEEVLRCYTHNGYRVIACAGKTLPKRTWLYSQK 1009

Query: 723  DYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWM 782
                     V+R++         +E +LE LG    ++KL+ +   +++ L++A I+  M
Sbjct: 1010 ---------VSREE---------VESNLEFLGFIIFQNKLKKETSETLKSLQDANIRTIM 1051

Query: 783  LTGDKVETARCVSISAKLIS--------------RGQYVHIITKLTKPEGALN--QLEYL 826
             TGD + TA  V   A LI                G+ V +   + +P+  L+   L+ +
Sbjct: 1052 CTGDNILTAISVGREAGLIQCSRVYVPSINDTPLHGEPVIVWRDVNEPDKILDTKTLKPV 1111

Query: 827  KVNKGAC---------LLIDGESLGMFLR---YYKREFFDVVICLPTVVACRCTPQQKAD 874
            K+   +          L + G+   +  R       E+ + ++ L + +  R +P +K +
Sbjct: 1112 KLGNNSVESLRECNYTLAVSGDVFRLLFRDENEIPEEYLNEIL-LNSSIYARMSPDEKHE 1170

Query: 875  VALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 924
            + + +++       C GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 1171 LMIQLQKLDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1216

>AEL301W [2204] [Homologous to ScYGL167C (PMR1) - SH]
           complement(75104..77977) [2874 bp, 957 aa]
          Length = 957

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 152/692 (21%), Positives = 267/692 (38%), Gaps = 169/692 (24%)

Query: 267 HVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLR 326
           HVL  S LVP      GDL+    GDR+PAD+ +++S++ S    +    L GET+    
Sbjct: 169 HVL-ASCLVP------GDLVYFKVGDRIPADVRIIESTDLS----LDESTLTGETE---- 213

Query: 327 IAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSN--PLSIDNTLWANTVL 384
                                   P       +   TY D      P+    ++     L
Sbjct: 214 ------------------------PVHKSCTPVNSATYSDVPGGIIPIGERTSIAYMGTL 249

Query: 385 ASTGFCIGCVVYTGRDTR-----QAMNTTTATVKTGLLELEINSISKILCASVFALSIIL 439
              G   G VV TG+ T      + MN+     KT L ++ ++++ + L    F LS I+
Sbjct: 250 VREGHGKGIVVATGKHTMFGAVFEMMNSIEKP-KTPL-QMAMDTLRRDLSYVRFVLSGII 307

Query: 440 VVFAGFHNSDWY----LDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIV 495
            +        W     + V   +      +P+ + V L L     A++        + IV
Sbjct: 308 FLLGVIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMANR--------KAIV 359

Query: 496 RTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIH-LGTVSYTSETLDIVSDYVDALVNSS 554
           R     E LG +  + SDKTGTLT N M   KI  LG+++  +  L +          + 
Sbjct: 360 RRLPSVETLGSVNVICSDKTGTLTANHMTASKIWCLGSMANKNNVLSL---------EAK 410

Query: 555 NSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT 614
           +S    GK +P+  +  LS  V+  +   +IC+N   +F  +   Y   +P +IA+++  
Sbjct: 411 SSGGLPGK-LPNL-KNYLSDDVKATLRIGSICNNA--SFSHEHGKY-LGNPTDIALLEVL 465

Query: 615 ESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHD-EQKDEYWFMQ 673
           +   L                     T   +    FNS  K M + V       ++    
Sbjct: 466 QKFDL----------------VDERPTTTRVDELTFNSKRKYMAVKVDSPANSGKHIIYV 509

Query: 674 KGADTVMARIVE------------------NNDWLEEETGNMAREGLRTLVVGRKKLSRN 715
           KGA     RI+E                  +   + +   ++A EGLRTL   + + S N
Sbjct: 510 KGA---FERILERSASFIGGAGKVEKLSDSHKSLINDCAKSLASEGLRTLAFAQLECSTN 566

Query: 716 IYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRN 775
                 K  +D+++                   +L  +GL G++D  ++ V+ +IE L  
Sbjct: 567 ------KPMNDSTIQ------------------NLTFVGLIGMKDPPRSTVRPAIEELLQ 602

Query: 776 AGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLL 835
            G+ + M+TGD   TA  ++    +      + ++T         ++L+ +  ++ A ++
Sbjct: 603 GGVHVIMITGDAENTAVNIARQIGIPVINPEISVLTG--------DRLDQMTDDQLAGVI 654

Query: 836 IDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGN 895
              + + +F                     R TP+ K ++   +++  G  V   GDG N
Sbjct: 655 ---DHVNIF--------------------ARATPEHKLNIVRALQK-RGDIVAMTGDGVN 690

Query: 896 DVSMIQCADVGVGIVGKEGKQASLAADFSITE 927
           D   ++ AD+GV +       A  A+D  +T+
Sbjct: 691 DAPALKLADIGVAMGHMGTDVAKEASDMVLTD 722

>AGL097C [4215] [Homologous to ScYDR039C (ENA2 ) - NSH]
           (520915..524205) [3291 bp, 1096 aa]
          Length = 1096

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 175/764 (22%), Positives = 293/764 (38%), Gaps = 147/764 (19%)

Query: 268 VLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQS-SEPSGETFIKTDQLDGETDWKLR 326
           V+  +++VP      GD++++  GD +PADL L+++ +  + E  +  + L    D    
Sbjct: 144 VMASAQVVP------GDIVQVRVGDTVPADLRLVEALNLETDEALLTGEALPVAKD---- 193

Query: 327 IAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLAS 386
            A    Q+    D +N ++  +S   K      G V      S    I  +L     L S
Sbjct: 194 PAAVFEQDTPVGDRLN-LAFASSTVSKG--RATGIVVRTGLRSEIGKIAESLQGKQSLIS 250

Query: 387 TGFCIGCVVYTGRD-TRQAMNTTTATVKTGLLELEINSISKILCASVFALSIIL----VV 441
                       RD  +  +  T  TVK  +      ++   L   +  L++IL    V+
Sbjct: 251 ------------RDENKSGLQNTVLTVKASVGSFLGTNVGTPLHRKLAKLALILFAIAVL 298

Query: 442 FAGFHNSDWYLDVMRYLILFS-----TIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVR 496
           FA    +     V R + +++     ++IP SL V L +  S  A  +   + I    VR
Sbjct: 299 FALIVMATQKFIVNREVAIYAICVALSMIPSSLVVVLTITMSAGAKVMSTRNVI----VR 354

Query: 497 TSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKI---HLGTVSYTSETLDIVSDYVDALVNS 553
                E LG +  + SDKTGTLTQ  M LK++     GTV      +       D  +  
Sbjct: 355 RLDSLEALGAVNDICSDKTGTLTQGKMILKQLWVPEFGTVVVNRSNVPFDPTVGDVSLIP 414

Query: 554 SNS---------------ANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFED-DE 597
             S               AN   +   ++  K L+ R  +  +  A   N+   F+D D 
Sbjct: 415 RFSPWEYQHDEEEDVGIIANFKQRWQSNSLPKGLNPRKFESWLHTATLANIATVFKDSDS 474

Query: 598 LTYQA-ASPDEIAIVKFTESVGL---SLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSD 653
             ++A   P EIAI  F   +     +L                    YE    FPF+S 
Sbjct: 475 KEWRAHGDPTEIAIQVFATRMDHPHHALTTEQDEEDSDSSQQNDAARIYEHAAEFPFDSS 534

Query: 654 SKRMGIIV---------HDEQKDEY---------WFMQKGADTVMARIVENNDWLEEETG 695
            KRM  +          H   K  +         W +  G         ++ + +++   
Sbjct: 535 IKRMSAVYINLRDKNTRHVFTKGAFERVLKCCTRWKLDPGTGVTHPLTEDDLEIIQKNVD 594

Query: 696 NMAREGLRTLVVGRKKL----SRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLE 751
            ++ EGLR L    K +    + ++ ++  KD D                   ++E DL 
Sbjct: 595 TLSNEGLRVLAFATKTIPAEEAESLGERLTKDRD-------------------FVESDLI 635

Query: 752 LLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIIT 811
             GL G+ D  + +   +++    AGI + MLTGD   TA+ ++    ++    Y +   
Sbjct: 636 FQGLVGIYDPPRVETAGAVKKCHRAGINVHMLTGDFPGTAKAIAQEVGILPHNLYHY--- 692

Query: 812 KLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQ 871
               P+  ++ +        +  L D E              D +  LP V+A RC PQ 
Sbjct: 693 ----PKEVVDIMVMTATQFDS--LTDEE-------------LDQLPVLPLVIA-RCAPQT 732

Query: 872 KADV--ALVIREFTGKRVCCI-GDGGNDVSMIQCADVGV--GIVGKE-GKQAS--LAADF 923
           K  +  AL  RE    + C + GDG ND   ++ A+VG+  GI G +  K AS  + +D 
Sbjct: 733 KVRMIDALHRRE----KFCAMTGDGVNDSPSLKKANVGIAMGINGSDVAKDASDIVLSDD 788

Query: 924 SITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVY 967
           +     +  E     GR   + S  + +F++   L   + QA+Y
Sbjct: 789 NFASILNAVE----EGR---RMSDNIQKFVLQL-LAANVAQAIY 824

>CAGL0M11308g 1110211..1114569 similar to sp|Q12697 Saccharomyces
            cerevisiae YOR291w, hypothetical start
          Length = 1452

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 109/525 (20%), Positives = 212/525 (40%), Gaps = 96/525 (18%)

Query: 454  VMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSD 513
            ++R L + + ++P +L   L +  S   ++++          R +      G+I+ +  D
Sbjct: 714  ILRALDIITIVVPPALPATLTIGTSFALNRLKEKGIFCIAPTRVNI----GGKIDVMCFD 769

Query: 514  KTGTLTQNDMQLKKIHLGTVSYTSETL--DIVSDYVDALVNSSNSANPSGKSVPSTSRKD 571
            KTGTLT++ + +  + +   +  ++    D++SD  D                P  S KD
Sbjct: 770  KTGTLTEDGLDVLGVRVSCAATRNKASFSDLISDTHDIF--------------PKFSLKD 815

Query: 572  LSA----RVRDMVVTLAICHNVTP--------------------TFEDDELTYQAAS--P 605
             S     + R+ +++L  CH++                      ++E+D   +Q  S   
Sbjct: 816  CSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQFTGWSYEEDFQNHQFHSLYE 875

Query: 606  DEIAIVKFTESVGL--SLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHD 663
            +      F E+  +  ++   +                  I++ F F S+ +RM +IV  
Sbjct: 876  ERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNILGIIRSFEFLSELRRMSVIVKP 935

Query: 664  EQKDEYWFMQKGADTVMARIVENNDWLEEETGNM----AREGLRTLVVGRKKLSRNIYDQ 719
              ++ YW   KGA  V+  I  N   L  +  ++       G R +    K L +N +  
Sbjct: 936  NNENVYWAYTKGAPEVIIDIC-NPATLPSDYDDILNFYTHSGYRVIACAGKTLPKNTWLY 994

Query: 720  FKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIK 779
             +K         V R++         +E ++E LG    ++KL++    ++  L+ A I+
Sbjct: 995  SQK---------VRREE---------VESNMEFLGFIIFQNKLKDATSPTLSKLKTANIR 1036

Query: 780  IWMLTGDKVETARCVSISAKLISRGQ-YVHIIT-------------KLTKPEGALNQLEY 825
              M TGD V TA  V    +LI+  + YV  +              +++  E  L+    
Sbjct: 1037 TVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAEHILDTFTL 1096

Query: 826  LKVNKGA---CLLIDGESLGMFLR---YYKREFFDVVICLPTVVACRCTPQQKADVALVI 879
              ++  +    L I GE   +       Y  E+ + ++   ++ A R +P +K ++   +
Sbjct: 1097 QPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFA-RMSPDEKHELVEQL 1155

Query: 880  REFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFS 924
            ++       C GDG ND   ++ ADVG+ +   E   AS+AA F+
Sbjct: 1156 QKMDYTVGFC-GDGANDCGALKAADVGISLSEAE---ASVAAPFT 1196

>Kwal_26.9207
          Length = 1469

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 119/556 (21%), Positives = 218/556 (39%), Gaps = 100/556 (17%)

Query: 454  VMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDD--TIPETIVRTSTIPEDLGRIEYLL 511
            ++R L + + ++P +L   L +  S    +++      I  T V  S      G+I+ + 
Sbjct: 732  ILRALDIITIVVPPALPATLSIGASFAIARLKKKGIFCIAPTRVNVS------GKIDVMC 785

Query: 512  SDKTGTLTQNDMQLKKIHLGTV-SYTSETLDIVSDYVDALVNSSNSANPSGKSVPSTSRK 570
             DKTGTLT++ + +  +H+     + +     +   V  L N   S N  G  +   SR 
Sbjct: 786  FDKTGTLTEDGLDVLGVHVAEPQGHQNFRFGALITNVRGLFNKY-SLNDCGSPIDFKSR- 843

Query: 571  DLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFT---------------- 614
                   + +V+L  CH++     D EL      P +  + +FT                
Sbjct: 844  -------NFLVSLLTCHSLRVV--DGELL---GDPLDFKMFQFTNWSYAEDFQDFKFHSL 891

Query: 615  -----------ESVGLS--LFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIV 661
                       E+ G++  +   +                  +++ F F S+ +RM +IV
Sbjct: 892  NEERNNKSTLPENAGIAPAVVHPNAESTENKFTENDPHNLLGVIRSFEFVSELRRMSVIV 951

Query: 662  HDEQKDEYWFMQKGADTVMARIVENNDW---LEEETGNMAREGLRTLVVGRKKLSRNIYD 718
                ++ +W   KGA  V++ I   +      E+        G R +    K L +  + 
Sbjct: 952  KPYGENVFWGFTKGAPEVISEICNKSTLPANYEQILQQYTHNGYRVIACAGKTLPKRTWR 1011

Query: 719  QFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGI 778
              +K         V+R++         +E ++E LG    E+KL+     ++  L++AGI
Sbjct: 1012 FAQK---------VSREE---------VESNMEFLGFVVFENKLKPSTTPTLASLQDAGI 1053

Query: 779  KIWMLTGDKVETARCVSISAKLISRGQ-YVHIITKLTKPEGAL---------------NQ 822
            +  M TGD V TA  V   + LI+    +V  I     P   L                 
Sbjct: 1054 RSIMCTGDNVLTAISVGRESGLITESHVFVPQINDNMDPNEDLIIWRDVDDCDLILDGVT 1113

Query: 823  LEYLKVNKGACLLIDGESLGMFLRYYK--REFFDVVICLPTVVACRCTPQQKADVALVIR 880
            LE +  +    + + G+   +  +  +   E +  ++ L + +  R +P +K ++   ++
Sbjct: 1114 LEPMNGSSDYTIAVTGDVFRLLFKNNEVLPESYINMVLLKSSIYARMSPDEKHELVGQLQ 1173

Query: 881  EFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEF---CHLTELLLW 937
                    C GDG ND   ++ ADVGV +   E   AS+AA F+ + F   C L   ++ 
Sbjct: 1174 GLDYVVGFC-GDGANDCGALKAADVGVSLSEAE---ASVAAPFTSSVFEISCILD--VIK 1227

Query: 938  HGRNSYKRSAKLAQFI 953
             GR S   S    Q++
Sbjct: 1228 EGRASLTTSFSCFQYM 1243

>KLLA0A03157g complement(281313..284129) gi|3288523|emb|CAA04476.1
           Kluyveromyces lactis Ca++ ATPase, start by similarity
          Length = 938

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 166/700 (23%), Positives = 264/700 (37%), Gaps = 183/700 (26%)

Query: 262 NSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGET 321
           + +L HVL  S LVP      GDL++   GDR+PADL +++S +      +    L GE 
Sbjct: 153 SGQLSHVL-ASNLVP------GDLVRFKVGDRIPADLRIVESID----LCVDESNLTGEN 201

Query: 322 DWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLSI-----DN 376
                          EP                +H   G V  K+ S  P SI      N
Sbjct: 202 ---------------EP----------------VHKSSGAVDPKNYSHIPGSIIPVGDRN 230

Query: 377 TLWANTVLASTGFCIGCVVYTGRDTRQA----MNTTTATVKTGLLELEINSISKILCASV 432
            +     L   G   G V+ TG+ T       M +     KT L +  ++ + + L    
Sbjct: 231 CIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPL-QTAMDKLGQDLSYMS 289

Query: 433 FALSIILVVFAGFHNSDWYLDVMRYLILFSTI-----IPVSLRVNLDLAKSVYAHQIEHD 487
           F L  I+ +        W L++ +  +  +       +P+ + V L L     A +    
Sbjct: 290 FVLIGIICLIGIIQGRSW-LEMFQIAVSLAVAAIPEGLPIIVTVTLALGVLRMAKR---- 344

Query: 488 DTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIH-LGTVSYTSETLDIVSDY 546
               + IVR     E LG +  + SDKTGTLT N M + KI  LG++   +  L      
Sbjct: 345 ----KAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTNCL------ 394

Query: 547 VDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPD 606
                     A    K  P    +D++  +R       IC+N   T+  + L Y   +P 
Sbjct: 395 ----------ALSKVKERPIKMEQDVATTLR----IGNICNN--GTYSQEHLKY-LGNPT 437

Query: 607 EIAIVKFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQK 666
           +IAI++  +  G++  +                 +   +   PFNS  K M +   D   
Sbjct: 438 DIAILESLQHFGINDCRN----------------SVNKINEIPFNSKRKFMAVKTIDAN- 480

Query: 667 DEYWFMQKGADTVMARIVEN----------------ND--WLEEETGNMAREGLRTLVVG 708
           D+     KGA     +IVE                 ND   + +    +A EGLRTL   
Sbjct: 481 DKVVVYVKGA---FEKIVEKSINYIGRDGKVHKLKPNDKAIINDAAVALASEGLRTLA-- 535

Query: 709 RKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKS 768
                          + +  +S  + D++ N  + + L +     GL  + D  +  V+S
Sbjct: 536 ---------------FAELEVSATHGDKEFNEDMVEGLTF----TGLIAMNDPPRPTVRS 576

Query: 769 SIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKV 828
           +IE L    + + M+TGD   TA  VSI+ +         I   +  PE +         
Sbjct: 577 AIEELLQGSVHVIMITGDAENTA--VSIARQ---------IGIPVINPEYS--------- 616

Query: 829 NKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVC 888
                 ++ G+ L            D V      V  R TP+ K ++   +++  G  V 
Sbjct: 617 ------VLSGDKLDQMTDDQLASVIDHV-----NVFARATPEHKLNIVRALQK-RGDIVA 664

Query: 889 CIGDGGNDVSMIQCADVGVGIVGKEGKQ-ASLAADFSITE 927
             GDG ND   ++ AD+GV + GK G   A  A+D  +T+
Sbjct: 665 MTGDGVNDAPALKLADIGVSM-GKMGTDVAKEASDMVLTD 703

>KLLA0E14630g complement(1297636..1300884) similar to sp|Q01896
           Saccharomyces cerevisiae YDR039c ENA2 P-type ATPase
           involved in Na+ efflux, hypothetical start
          Length = 1082

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 127/507 (25%), Positives = 200/507 (39%), Gaps = 105/507 (20%)

Query: 463 TIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQND 522
           ++IP SL V L +  S  A  +         I+R     E LG +  + SDKTGTLTQ  
Sbjct: 323 SMIPSSLVVVLTITMSAGAKVM----ATRHVIIRKLDSLEALGAVNDICSDKTGTLTQGK 378

Query: 523 MQLKKI---HLGTVSYTSETLDIVSDYVDALVNSSNSANPS-------GKSVPSTSRKD- 571
           M  K++     GT++               + NS+   NP+        K  P   + D 
Sbjct: 379 MIAKQVWIPQFGTIN---------------VQNSNEPFNPTIGEIQLIPKFSPYQYKHDD 423

Query: 572 ---------------------LSARVRDMVVTLAICHNVTPTFEDDELTYQAA--SPDEI 608
                                L+  +    +  A   N+   F D E     A   P EI
Sbjct: 424 EEDVGMITDFKSKYYADELGPLNVSLFTQWLYTATLANIATVFRDPETQDWKAHGDPTEI 483

Query: 609 AIVKFTESVGLS---LFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGII---VH 662
           AI  F   + L    L   D               T+E +  +PF+S  KRM  I   V 
Sbjct: 484 AIQVFATRMDLPRRVLTGEDNDDEKNIHNDI----TFEHVAEYPFDSSVKRMSAIYKNVE 539

Query: 663 DEQKDEYWFMQKGADTVMARIVEN-NDWLEEETGN---MAREGLRTLVVGRKKLSRN--- 715
           + +   Y    KGA     R+++  N W     G+   +  E L T+      LS     
Sbjct: 540 EPKAPIYEVFTKGA---FERVLQCCNSWYTTPDGSPQPLTEEDLETVQKNVDTLSSEGLR 596

Query: 716 IYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRN 775
           +    KK ++++  + +N+D+ +      ++E +L  LGL G+ D  + +  ++++    
Sbjct: 597 VLAFAKKTFNESQFT-INKDKLLKE--RDFVENNLTFLGLVGIYDPPRRESLAAVKKCHL 653

Query: 776 AGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLL 835
           AGI + MLTGD   TA+ ++    ++    Y +       P+  +N +     +  A  L
Sbjct: 654 AGINVHMLTGDFPGTAKSIAQEVGILPHNLYHY-------PKEVVNFMVMTATDFDA--L 704

Query: 836 IDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCI-GDGG 894
            D E              D +  LP V+A RC PQ K  V ++       R C + GDG 
Sbjct: 705 SDKE-------------IDELPVLPLVIA-RCAPQTK--VRMIEALHRRNRFCAMTGDGV 748

Query: 895 NDVSMIQCADVGV--GIVGKE-GKQAS 918
           ND   ++ A+VG+  GI G +  K AS
Sbjct: 749 NDSPSLKIANVGIAMGINGSDVAKDAS 775

>CAGL0J01870g 181666..184506 highly similar to sp|P13586
           Saccharomyces cerevisiae YGL167c PMR1, hypothetical
           start
          Length = 946

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 168/747 (22%), Positives = 282/747 (37%), Gaps = 189/747 (25%)

Query: 207 FYNLYFLVVALSQAIPALRIGYLSSYV-VPLAFVLTVTMSKEAMDDIQRRRRDNESNSEL 265
           F     +++ +  A+ +  IG +   V + LA ++ VT+       IQ  R +       
Sbjct: 102 FVEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGF-----IQEYRSEKS----- 151

Query: 266 YHVLNQSKLVPSK---------------DLKVGDLIKISKGDRLPADLVLLQSSEPSGET 310
              LN  KLVP+K               +L  GDL++   GDR+PAD+ ++++ + S   
Sbjct: 152 LEALN--KLVPTKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLS--- 206

Query: 311 FIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSN 370
            I    L GE               TEP  ++K + T   PE+            D  + 
Sbjct: 207 -IDESNLTGE---------------TEP--LHKDAQTID-PEEY-----------DNRNV 236

Query: 371 PLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQA----MNTTTATVKTGLLELEINSISK 426
           P+S  + +     L   G   G V+ TG +T       M  +    KT L E  ++ +  
Sbjct: 237 PVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEKPKTPLQE-TMDRLGT 295

Query: 427 ILCASVFALSIILVVFAGFHNSDWYLDVMRYLILFSTIIPVSLRVNLDLAKSVYAHQIEH 486
            L    F +  I+ +      +   +     + L    IP  L + + +  ++   ++  
Sbjct: 296 ELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPIIVTVTLALGVLRM-- 353

Query: 487 DDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDY 546
             T    IVR     E LG +  + +DKTGTLT N M + K+     S T E        
Sbjct: 354 --TKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSSGTYE-------- 403

Query: 547 VDALVNSSNSANPSGKSVPSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPD 606
                   N+ +P   S       D    V++ +    IC+N   +   +E      +P 
Sbjct: 404 --------NAISPEEDSEFDVHDND----VKETLTIANICNNAKYS---EEHNLYIGNPT 448

Query: 607 EIAIVKFTESVGLSLFKRDRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQK 666
           ++A+++     G+   +RD               ++E ++   FNS  K M I    E  
Sbjct: 449 DVALIEVLTKFGIP-DQRD---------------SHEKMEELSFNSKRKYMAIKSSKESG 492

Query: 667 DEYWFMQKGADTVMARIVENNDWLEEETGNM------------------AREGLRTLVVG 708
           +   ++ KGA     RI++ + +  ++ G +                  A +GLRT+   
Sbjct: 493 EHVLYI-KGA---FERILDKSSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACA 548

Query: 709 RKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKS 768
                      FK    D  +S    +  +N          L   GL G+ D  + +VK+
Sbjct: 549 -----------FKPTDSDNVIS----EDDING---------LTFTGLFGLADPPRPNVKA 584

Query: 769 SIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKV 828
           SIE L   G+ I M+TGD V TA  VSI+ K+                         L V
Sbjct: 585 SIEKLHRGGVHIIMITGDSVNTA--VSIAEKI------------------------GLSV 618

Query: 829 NKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVC 888
                 ++ G+ +         +  D V      +  R TP+ K ++   +R+  G  V 
Sbjct: 619 QDRESSVMTGDKVSELTEDELSKVIDKV-----NIFARATPENKLNIVKALRK-RGDIVA 672

Query: 889 CIGDGGNDVSMIQCADVGV--GIVGKE 913
             GDG ND   ++ AD+G+  GI G +
Sbjct: 673 MTGDGVNDAPALKLADIGIAMGISGTD 699

>Kwal_47.17547
          Length = 1240

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 76/358 (21%), Positives = 145/358 (40%), Gaps = 57/358 (15%)

Query: 643 EILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMAR------------IVENNDWL 690
           +I+Q+ PF S  K  GI+V  +     ++++  A+ ++ R            ++   D+ 
Sbjct: 585 KIVQIIPFESSRKWGGIVVKYKNGLHRFYIKGAAELLLRRCMQKRASDSKLTLISQKDFD 644

Query: 691 EEETG--NMAREGLRTLVVGRKKLSR-------NIYDQFKKDYDDASLSMVNRDQQMNAV 741
           EE     N+A E LR + +  +            + D+ + +     L   +   + ++V
Sbjct: 645 EESQTITNLAAEALRAISLAHRDYPNCPNWPPSELQDEVEPEAASPDLLFGDEVSRSDSV 704

Query: 742 --ITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAK 799
               + L   + L G+ G++D L+  V+ S+E  + AG+ + M+TGD + TA  ++    
Sbjct: 705 SEPAQELVSPMVLDGIVGIQDPLRKGVRKSVEQCQKAGVTVRMVTGDNILTATAIAKKCS 764

Query: 800 LISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICL 859
           ++S  Q  +  + +  P                             R+ K    + V  L
Sbjct: 765 ILSEEQAENPESSMEGP-----------------------------RFRKLSNKERVRIL 795

Query: 860 PTV-VACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQ 916
           P + V  R +P+ K  +   +++  G  V   GDG ND   ++ ADVG  +GI G E  +
Sbjct: 796 PNLRVLARSSPEDKRILVETLKKM-GDVVAVTGDGTNDAPALKLADVGFSMGIAGTEVAR 854

Query: 917 ASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFE 974
            +        +F  +   + W GR       K  QF +   +   +   V ++ S  E
Sbjct: 855 EASDIILMTDDFSAIVNAIKW-GRCVSTSIKKFIQFQLTVNVTAVVLTFVSAVASSEE 911

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 70/324 (21%), Positives = 128/324 (39%), Gaps = 42/324 (12%)

Query: 231 SYVVPLAFVLTVTMSKEAMDDIQRRRRDNESNSELYHVLNQS--KLVPSKDLKVGDLIKI 288
           + ++ +  V+ V  + +   ++Q  + +++ N     VL      L+   D+ VGD++ +
Sbjct: 153 AIMIAVLVVILVGSANDYQKELQFSKLNDKKNDREVIVLRNGDEHLISIHDILVGDILSL 212

Query: 289 SKGDRLPADLVLLQSSEPSGETFIKTDQLDGETDWKLRIAPALTQNLTEPDLMNKVSITA 348
             GD +PAD +L++ S    E+      L GE+          T      D+  +     
Sbjct: 213 QTGDVVPADCILVKGSCECDES-----ALTGES---------ATIKKAAIDVCYEKYKQL 258

Query: 349 SAPEKAIHNFLGKVTYKDTSSNPLSIDNTLWANTVLASTGFCIGCVVYTGRDTRQAMNTT 408
           SA + AI   +G     +   +P+ I  +   + +  +    +G     GR         
Sbjct: 259 SATDAAID--IG-TPGAEKVPDPMLISGSKLLSGLGRAVVTSVGVNSMHGRTLMALKVEA 315

Query: 409 TATVKTGLLELEINSISKILCASVFALSIILVVFAGF----------HNSDWYLDVMRYL 458
             T     L+   NSIS  +  S  AL +  ++F  F          H+        R++
Sbjct: 316 ETTPLQERLDSLANSIS--VYGSAAALLLFFILFMRFLANLKKGGELHDLTPAQKGSRFM 373

Query: 459 ILF-------STIIPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLL 511
            +F          +P  L + + LA +    ++  D      +VR     E +G    + 
Sbjct: 374 NIFIVGITVIVVAVPEGLPLAVTLALAFATTRMAKDG----NLVRVLRACETMGSATAVC 429

Query: 512 SDKTGTLTQNDMQLKKIHLGTVSY 535
           SDKTGTLT+N M + K  LG+  +
Sbjct: 430 SDKTGTLTENRMTVVKGFLGSTFF 453

>YGL006W (PMC1) [1966] chr7 (485923..489444) Vacuolar
           Ca2+-transporting P-type ATPase, member of the cation
           transporting (E1-E2) P-type ATPase superfamily,
           functions to pump Ca2+ into the vacuole [3522 bp, 1173
           aa]
          Length = 1173

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 85/354 (24%), Positives = 148/354 (41%), Gaps = 59/354 (16%)

Query: 643 EILQVFPFNSDSKRMGIIV-HDEQKDE---YWFMQKGADTVMARIV----ENNDWLEE-- 692
           +++Q  PF S  K  G++V + E K++   Y F  KGA  ++++       ++D LEE  
Sbjct: 608 KVVQTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYKRNSDDTLEEIN 667

Query: 693 ---------ETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVIT 743
                    E  N+A + LR + V  K          ++  D  S ++   D   N+   
Sbjct: 668 EDNKKETDDEIKNLASDALRAISVAHKDFCECDSWPPEQLRDKDSPNIAALDLLFNS--- 724

Query: 744 KYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 803
              +  L L GL G++D L+  V+ S++  + AG+ + M+TGD + TA+ ++ +  ++S 
Sbjct: 725 ---QKGLILDGLLGIQDPLRAGVRESVQQCQRAGVTVRMVTGDNILTAKAIARNCAILST 781

Query: 804 GQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTV- 862
                     ++   A+   E+ K+ K   + I                      LP + 
Sbjct: 782 DIS-------SEAYSAMEGTEFRKLTKNERIRI----------------------LPNLR 812

Query: 863 VACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVG--VGIVGKEGKQASLA 920
           V  R +P+ K  +   ++   G  V   GDG ND   ++ ADVG  +GI G E  + +  
Sbjct: 813 VLARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASD 871

Query: 921 ADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVYSICSKFE 974
                 +F  +   + W GR       K  QF +   +   I   V S+ S  E
Sbjct: 872 IILMTDDFSAIVNAIKW-GRCVSVSIKKFIQFQLIVNITAVILTFVSSVASSDE 924

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 118/290 (40%), Gaps = 54/290 (18%)

Query: 256 RRDNESNSELYHVLNQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTD 315
           R D E    ++HVL            VGD+I +  GD +PAD V++     SG+      
Sbjct: 198 RNDQEILISIHHVL------------VGDVISLQTGDVVPADCVMI-----SGKCEADES 240

Query: 316 QLDGETD--WKLRIAPALTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPLS 373
            + GE++   K  +  +L       D     SI +       HN    +   D + +   
Sbjct: 241 SITGESNTIQKFPVDNSLR------DFKKFNSIDS-------HNHSKPLDIGDVNEDGNK 287

Query: 374 IDNTLWANTVLASTGFCIGCVVYTGRDT--RQAMNTTTATVKTGLLELEI----NSISKI 427
           I + +  +     +G   G +   G ++   Q M +  A  ++  L+L +    ++IS  
Sbjct: 288 IADCMLISGSRILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY 347

Query: 428 LCASVFALSIILVVF-----------AGFHNSDWYLDVMRYLILF---STIIPVSLRVNL 473
            C S  A+ + LV+F             FH+ D      +++ +F    T+I V++   L
Sbjct: 348 GCVS--AIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVIVVAVPEGL 405

Query: 474 DLAKSVYAHQIEHDDTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDM 523
            LA ++         T    +VR     E +G    + SDKTGTLT+N M
Sbjct: 406 PLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKTGTLTENVM 455

>YGL008C (PMA1) [1965] chr7 complement(479913..482669)
           H+-transporting P-type ATPase of the plasma membrane
           required for nutrient uptake and pH homeostasis,
           activity is rate limiting for growth at low pH [2757 bp,
           918 aa]
          Length = 918

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 75/157 (47%), Gaps = 11/157 (7%)

Query: 375 DNTLWANTVLASTGFCIGCVVYTGRDT---RQAMNTTTATVKTGLLELEINSISKILCAS 431
           D T  ++TV    GF +  V  TG +T   R A     A    G     +N I  IL   
Sbjct: 243 DQTFSSSTVKRGEGFMV--VTATGDNTFVGRAAALVNKAAGGQGHFTEVLNGIGIILLVL 300

Query: 432 VFALSIILVVFAGFHNSDWYLDVMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDDTI 490
           V A +++LV  A F+ ++  + ++RY +  + I +PV L   +    +V A  +      
Sbjct: 301 VIA-TLLLVWTACFYRTNGIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--- 356

Query: 491 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 527
            + IV+  +  E L  +E L SDKTGTLT+N + L +
Sbjct: 357 -QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 392

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 65/151 (43%), Gaps = 27/151 (17%)

Query: 642 YEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREG 701
           Y++L+  PF+  SK++  +V +  + E     KGA   + + VE +  + E+        
Sbjct: 443 YKVLEFHPFDPVSKKVTAVV-ESPEGERIVCVKGAPLFVLKTVEEDHPIPEDV------- 494

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
                               ++Y++    + +R  +   V  K  E   E+LG+    D 
Sbjct: 495 -------------------HENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDP 535

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETAR 792
            ++D   ++   R+ G+++ MLTGD V  A+
Sbjct: 536 PRDDTAQTVSEARHLGLRVKMLTGDAVGIAK 566

>AFR354C [3546] [Homologous to ScYEL031W (SPF1) - SH]
           (1078275..1081907) [3633 bp, 1210 aa]
          Length = 1210

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 116/284 (40%), Gaps = 42/284 (14%)

Query: 644 ILQVFPFNSDSKRMGII-VHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGL 702
           IL+ F F+S  KR   I VH++Q   Y  ++   +T+  R+ +     ++   +  R G 
Sbjct: 577 ILRRFQFSSALKRSSTIAVHNKQ--HYSAVKGAPETIRERLSQVPTDYDQVYKSFTRAGS 634

Query: 703 RTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKL 762
           R L +  KKL      Q +K   +A                  +E DLE  G       L
Sbjct: 635 RVLALASKKLPSMSIKQIEKLEREA------------------VESDLEFKGFLVFHCPL 676

Query: 763 QNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYV---------HIITKL 813
           ++D   +I++L  +  +  M+TGD   TA  V+    ++ R   +         H +   
Sbjct: 677 KDDAIETIKMLNESSHRCIMITGDNPLTAVHVAKEVAIVERETLILDEPIDGSSHALVFR 736

Query: 814 TKPEGALN-------QLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACR 866
              E  +N         E+ K+     + + G +L +   + +       +   T V  R
Sbjct: 737 NIEETIVNPFNPEKDTFEHSKLFAKYDIAVTGHALQLLSGHSQLN----ELIRHTWVYAR 792

Query: 867 CTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIV 910
            +P QK  +   +++   + + C GDG NDV  ++ A VG+ ++
Sbjct: 793 VSPAQKEFIMNSLKDMGYQTLMC-GDGTNDVGALKQAHVGIALL 835

>Scas_583.14*
          Length = 875

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 72/300 (24%), Positives = 123/300 (41%), Gaps = 52/300 (17%)

Query: 643 EILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA-DTVMARIVENNDWLEEETGNMAREG 701
           +IL+ F F+S  KR   +     KD+ +   KGA +T+  R+       +E   +  R G
Sbjct: 229 QILRRFQFSSALKRSSSVA--SHKDKLFTAVKGAPETIRERLAVVPKNYDEIYKSFTRSG 286

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
            R L +  K L     +   K  DD     ++RD+         +E  L   G       
Sbjct: 287 SRVLALASKSLP----NLSSKQLDD-----LDRDE---------IETGLTFNGFLVFHCP 328

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALN 821
           L+ D   +I++L  +  +  M+TGD   TA  V+    +++ G+ + +    T  +G   
Sbjct: 329 LKPDAVETIKMLNESAHRSIMITGDNPLTAVHVAKEVAIVT-GETLILDKSETVGDG--- 384

Query: 822 QLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVV--------------------ICLPT 861
           +L +  V +   +  D  S     ++  RE FD                      +   T
Sbjct: 385 KLLFFNVEETIKIPFDPAS----DKFDHRELFDKYDIAVTGYALNLLEDHSQLKDLIRHT 440

Query: 862 VVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAA 921
            V  R +P QK  +   ++E   + + C GDG NDV  ++ A VGV ++   G + S+ A
Sbjct: 441 WVYARVSPSQKEFILNNLKEMGYQTLMC-GDGTNDVGALKQAHVGVALL--NGTEESMTA 497

>AGL085C [4226] [Homologous to ScYGL008C (PMA1) - SH; ScYPL036W
           (PMA2) - NSH] (546285..549014) [2730 bp, 909 aa]
          Length = 909

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 66/151 (43%), Gaps = 27/151 (17%)

Query: 642 YEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREG 701
           Y++L+  PF+  SK++  IV +  + E     KGA   + + VE N  + E+        
Sbjct: 424 YKVLEFHPFDPVSKKVTAIV-ESPEGERIVCVKGAPLFVLKTVEENHLIPEDV------- 475

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
                              K++Y++    + +R  +   V  K  E   E+LG+    D 
Sbjct: 476 -------------------KENYENKVAELASRGYRALGVARKRGEGHWEILGVMPCMDP 516

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETAR 792
            ++D   ++   R+ G+++ MLTGD V  A+
Sbjct: 517 PRDDTAQTVNEARHLGLRVKMLTGDAVGIAK 547

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 73/157 (46%), Gaps = 11/157 (7%)

Query: 375 DNTLWANTVLASTGFCIGCVVYTGRDT---RQAMNTTTATVKTGLLELEINSISKILCAS 431
           D T  ++TV    GF I  V  TG  T   R A     A+  +G     +N I  IL   
Sbjct: 224 DATFSSSTVKRGEGFMI--VTATGDSTFVGRAAALVNKASAGSGHFTEVLNGIGTILLIL 281

Query: 432 VFALSIILVVFAGFHNSDWYLDVMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDDTI 490
           V    +++ V A F+ S   + ++RY +  + + +PV L   +    +V A  +      
Sbjct: 282 VILTLLVVYV-ACFYRSIDIVTILRYTLAITVVGVPVGLPAVVTTTMAVGAAYLAKK--- 337

Query: 491 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 527
            + IV+  +  E L  +E L SDKTGTLT+N + L +
Sbjct: 338 -KAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 373

>YPL036W (PMA2) [5403] chr16 (482839..485682) H[+]-transporting
           P-type ATPase of the plasma membrane, expression not
           detected under normal growth conditions [2844 bp, 947
           aa]
          Length = 947

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 68/145 (46%), Gaps = 9/145 (6%)

Query: 387 TGFCIGCVVYTGRDT---RQAMNTTTATVKTGLLELEINSISKILCASVFALSIILVVFA 443
           TG     V  TG +T   R A     A+   G     +N I  IL   V A +++LV  A
Sbjct: 282 TGEAFMVVTATGDNTFVGRAAALVGQASGVEGHFTEVLNGIGIILLVLVIA-TLLLVWTA 340

Query: 444 GFHNSDWYLDVMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIPE 502
            F+ +   + ++RY +  + I +PV L   +    +V A  +       + IV+  +  E
Sbjct: 341 CFYRTVGIVSILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAIE 396

Query: 503 DLGRIEYLLSDKTGTLTQNDMQLKK 527
            L  +E L SDKTGTLT+N + L +
Sbjct: 397 SLAGVEILCSDKTGTLTKNKLSLHE 421

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 65/151 (43%), Gaps = 27/151 (17%)

Query: 642 YEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREG 701
           Y++L+  PF+  SK++  +V +  + E     KGA   + + VE +  + E+        
Sbjct: 472 YKVLEFHPFDPVSKKVTAVV-ESPEGERIVCVKGAPLFVLKTVEEDHPIPEDV------- 523

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
                               ++Y++    + +R  +   V  K  E   E+LG+    D 
Sbjct: 524 -------------------HENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDP 564

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETAR 792
            ++D   +I   RN G++I MLTGD V  A+
Sbjct: 565 PRDDTAQTINEARNLGLRIKMLTGDAVGIAK 595

>KLLA0E22352g 1984522..1988142 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           start by similarity
          Length = 1206

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/289 (21%), Positives = 120/289 (41%), Gaps = 52/289 (17%)

Query: 644 ILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA-DTVMARIVENNDWLEEETGNMAREGL 702
           IL+ F F+S  KR   I    Q + ++   KGA +T+  R+       ++   +  R G 
Sbjct: 574 ILRRFQFSSSLKRSASIA--SQSNRFFAAVKGAPETIRERLNSVPSDYDDIYKSFTRSGS 631

Query: 703 RTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDKL 762
           R L +  K L +           ++ +  ++RD+         +E  L           L
Sbjct: 632 RVLALAYKDLPK---------MSNSQIDNIDRDE---------IETGLTFGAFLVFHCPL 673

Query: 763 QNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKP-EGALN 821
           ++D   +I++L  +  +  M+TGD   TA  V+    ++ R   +     L +P +G+ +
Sbjct: 674 KDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLI-----LDEPIDGSSH 728

Query: 822 QLEYLKVNKGAC--------------------LLIDGESLGMFLRYYKREFFDVVICLPT 861
            L    VN+                       L + G +L +   +  ++  DV+    T
Sbjct: 729 ALVMRDVNETIVKPFNPDADTFDEKEIFQKYDLAVTGHALKLLQGH--KQLRDVI--RHT 784

Query: 862 VVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGIV 910
            +  R +P QK  + + +++   + + C GDG NDV  ++ A VG+ ++
Sbjct: 785 WIYARVSPSQKEFILITLKDMGYQTLMC-GDGTNDVGALKQAHVGIALL 832

>CAGL0L01419g 156123..159767 highly similar to sp|P39986
           Saccharomyces cerevisiae YEL031w SPF1 P-type ATPase,
           hypothetical start
          Length = 1214

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 90/426 (21%), Positives = 161/426 (37%), Gaps = 90/426 (21%)

Query: 505 GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSV 564
           GRI+    DKTGTLT  D+  +    G    +S+  DI   Y             S    
Sbjct: 477 GRIDVCCFDKTGTLTGEDLVFE----GLAGLSSDPKDIRHLY-------------SATDC 519

Query: 565 PSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKR 624
           P+++            + +   H +    ED E+         +  +K+T   G  +F  
Sbjct: 520 PNSTS-----------LVVGAAHALV-RLEDGEIVGDPMEKATLKALKWTVEKGDKVFNE 567

Query: 625 DRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMG-IIVHDEQKDEYWFMQKGADTVMARI 683
                              IL+ F F+S  KR   +  HD +   Y  ++   +T+  R+
Sbjct: 568 KNGQVT-------------ILRRFQFSSALKRSSSVATHDGKL--YSAVKGAPETIRERL 612

Query: 684 VENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVIT 743
                  +E   +  R G R L +  KKL +    Q     +DA                
Sbjct: 613 FTIPANYDEIYKSFTRSGSRVLALASKKLEKMSQSQI----EDAD--------------R 654

Query: 744 KYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 803
           ++ E DLE  G       L++D   +I++L  +  +  M+TGD   TA  V+    ++ +
Sbjct: 655 EHFERDLEFNGFLIFHCPLKHDAIETIQMLNESAHRCVMITGDNPLTAVHVAKEVGIV-K 713

Query: 804 GQYVHIITKLTKPEGALNQLEYLKVNKGAC--LLIDGESLGMFLRYYKREFFDVVICLPT 861
           G+   +I  +    G  ++L +  V +      ++  +S   F +Y   + +D+ +    
Sbjct: 714 GE--TLIVDMVD-NGNDDKLVFRNVEETLSFEFVVSKDS---FEKYGIFDKYDLAVTGHA 767

Query: 862 VVA-----------------CRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCAD 904
           + A                  R +P QK  +   +++   + + C GDG NDV  ++ A 
Sbjct: 768 LEALKGHHQLQDLIRHAWIYARVSPAQKEFILNNLKDMGYQTLMC-GDGTNDVGALKQAH 826

Query: 905 VGVGIV 910
           VGV ++
Sbjct: 827 VGVALL 832

>YEL031W (SPF1) [1394] chr5 (90258..93905) Putative
           Ca2+-transporting ATPase, member of the P-type ATPase
           superfamily of membrane transporters [3648 bp, 1215 aa]
          Length = 1215

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 91/424 (21%), Positives = 166/424 (39%), Gaps = 86/424 (20%)

Query: 505 GRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVDALVNSSNSANPSGKSV 564
           GRI+    DKTGTLT  D+  +    G    ++++ +I   Y             S    
Sbjct: 479 GRIDVCCFDKTGTLTGEDLVFE----GLAGISADSENIRHLY-------------SAAEA 521

Query: 565 PSTSRKDLSARVRDMVVTLAICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKR 624
           P ++           ++ +   H +    ED ++      P E A +K   +VG ++ ++
Sbjct: 522 PEST-----------ILVIGAAHALV-KLEDGDIV---GDPMEKATLK---AVGWAVERK 563

Query: 625 DRXXXXXXXXXXXXXXTYEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGA-DTVMARI 683
           +                 +I++ F F+S  KR   I      D  +   KGA +T+  R+
Sbjct: 564 N-------SNYREGTGKLDIIRRFQFSSALKRSASIA--SHNDALFAAVKGAPETIRERL 614

Query: 684 VENNDWLEEETGNMAREGLRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVIT 743
            +     +E   +  R G R L +  K L +      +   DD     +NRD        
Sbjct: 615 SDIPKNYDEIYKSFTRSGSRVLALASKSLPK----MSQSKIDD-----LNRDD------- 658

Query: 744 KYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISR 803
             +E +L   G       L++D   +I++L  +  +  M+TGD   TA  V+    ++  
Sbjct: 659 --VESELTFNGFLIFHCPLKDDAIETIKMLNESSHRSIMITGDNPLTAVHVAKEVGIVF- 715

Query: 804 GQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVIC----- 858
           G+ + I+ +  K +   NQL +  V +   +  D  S   F      + +D+ +      
Sbjct: 716 GETL-ILDRAGKSDD--NQLLFRDVEETVSIPFD-PSKDTFDHSKLFDRYDIAVTGYALN 771

Query: 859 ------------LPTVVACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVG 906
                         T V  R +P QK  +   +++   + + C GDG NDV  ++ A VG
Sbjct: 772 ALEGHSQLRDLLRHTWVYARVSPSQKEFLLNTLKDMGYQTLMC-GDGTNDVGALKQAHVG 830

Query: 907 VGIV 910
           + ++
Sbjct: 831 IALL 834

>KLLA0A09031g 787768..790467 gi|1346734|sp|P49380|PMA1_KLULA
           Kluyveromyces lactis Plasma membrane ATPase (Proton
           pump), start by similarity
          Length = 899

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 68/319 (21%), Positives = 120/319 (37%), Gaps = 78/319 (24%)

Query: 642 YEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREG 701
           Y++L+  PF+  SK++  IV +  + E     KGA   + + VE    + E+        
Sbjct: 424 YKLLEFHPFDPVSKKVTAIV-ESPEGERIICVKGAPLFVLKTVEEEHPIPEDV------- 475

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
                              +++Y++    + +R  +   V  K  E   E+LG+    D 
Sbjct: 476 -------------------RENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDP 516

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKV----ETARCVSISAKLISRGQYVHIITKLTKPE 817
            ++D   ++   R+ G+++ MLTGD V    ET R + +    I   + + +      P 
Sbjct: 517 PRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTN-IYNAERLGLGGGGDMP- 574

Query: 818 GALNQLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVAL 877
                               G  L  F+     + F  V            PQ K +V  
Sbjct: 575 --------------------GSELADFVE--NADGFAEVF-----------PQHKYNVVE 601

Query: 878 VIREFTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLW 937
           ++++  G  V   GDG ND   ++ AD G+ + G      S AAD           + L 
Sbjct: 602 ILQQ-RGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARS-AADI----------VFLA 649

Query: 938 HGRNSYKRSAKLAQFIMHR 956
            G ++   + K ++ I HR
Sbjct: 650 PGLSAIIDALKTSRQIFHR 668

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 443 AGFHNSDWYLDVMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIP 501
           A F+ ++  + ++RY +  + + +PV L   +    +V A  +       + IV+  +  
Sbjct: 292 ASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 347

Query: 502 EDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLD 541
           E L  +E L SDKTGTLT+N + L +       YT E +D
Sbjct: 348 ESLAGVEILCSDKTGTLTKNKLSLHE------PYTVEGVD 381

>Scas_688.1
          Length = 913

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 67/315 (21%), Positives = 120/315 (38%), Gaps = 70/315 (22%)

Query: 642 YEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREG 701
           Y++L+  PF+  SK++  +V   + +      KGA   + + VE +  + E+        
Sbjct: 438 YKVLEFHPFDPVSKKVTAVVESPEGERI-ICVKGAPLFVLKTVEEDHPIPED-------- 488

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
                               ++Y++    + +R  +   V  K  E   E+LG+    D 
Sbjct: 489 ------------------IHENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDP 530

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALN 821
            ++D   ++   R  G+++ MLTGD V  A+    + + +  G  V+             
Sbjct: 531 PRDDTGETVAEARRLGLRVKMLTGDAVGIAKE---TCRQLGLGTNVY------------- 574

Query: 822 QLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIRE 881
             E L ++ G  +   G  L  F+      F +V             PQ K  V  +++ 
Sbjct: 575 NAERLGLSGGGDM--PGSELADFVENADG-FAEVF------------PQDKYRVVEILQT 619

Query: 882 FTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITEFCHLTELLLWHGRN 941
             G  V   GDG ND   ++ AD G+ + G     A  AAD           + L  G +
Sbjct: 620 -RGYLVAMTGDGVNDAPSLKKADTGIAVEGAT-DAARSAADI----------VFLAPGLS 667

Query: 942 SYKRSAKLAQFIMHR 956
           +   + K ++ I HR
Sbjct: 668 AIIDALKTSRQIFHR 682

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 443 AGFHNSDWYLDVMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIP 501
           A F+ +D  + ++RY +  + + +PV L   +    +V A  +       + IV+  +  
Sbjct: 306 ASFYRTDGIVRILRYTLGITIVGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 361

Query: 502 EDLGRIEYLLSDKTGTLTQNDMQLKK 527
           E L  +E L SDKTGTLT+N + L +
Sbjct: 362 ESLAGVEILCSDKTGTLTKNKLSLHE 387

>KLLA0F07447g 700685..703612 similar to sp|P38995 Saccharomyces
           cerevisiae YDR270w CCC2 probable copper-transporting
           ATPase, start by similarity
          Length = 975

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 15/90 (16%)

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
           + T+ +G KKL           + D SLS    D   + +   Y+  D  L+G   + D+
Sbjct: 706 IHTITIGNKKL-----------FPDESLS----DIASSTLTESYVSIDGSLVGKFEISDR 750

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETA 791
           ++ D    +E L+N GIK  M+TGD  ++A
Sbjct: 751 VKEDAHFVVEYLQNLGIKCCMVTGDAHQSA 780

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 26/42 (61%)

Query: 868 TPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCADVGVGI 909
           TP+QK D+ + ++    +RV  +GDG ND   +  AD+G+ I
Sbjct: 799 TPEQKRDIVIQLQNNGTERVAFVGDGINDSPALVEADLGISI 840

>Kwal_47.17522
          Length = 899

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 72/157 (45%), Gaps = 11/157 (7%)

Query: 375 DNTLWANTVLASTGFCIGCVVYTGRDT---RQAMNTTTATVKTGLLELEINSISKILCAS 431
           D T  ++TV    GF I  V  TG +T   R A     A    G     +N I  IL   
Sbjct: 224 DTTFSSSTVKRGEGFMI--VTATGDNTFVGRAAALVNQAAGDQGHFTEVLNGIGTILLVL 281

Query: 432 VFALSIILVVFAGFHNSDWYLDVMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDDTI 490
           V    +++   A F+ +D  + ++RY +  + I +PV L   +    +V A  +      
Sbjct: 282 VIVTLLLVWT-ACFYRTDRIVRILRYTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK--- 337

Query: 491 PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKK 527
            + IV+  +  E L  +E L SDKTGTLT+N + L +
Sbjct: 338 -QAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHE 373

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 63/151 (41%), Gaps = 27/151 (17%)

Query: 642 YEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREG 701
           Y++L   PF+  SK++  +V +  + E     KGA   + + VE +  + E+        
Sbjct: 424 YKVLDFHPFDPVSKKVTAVV-ESPEGERIICVKGAPLFVLKTVEEDHPIPEDV------- 475

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
                               ++Y++    + +R  +   V  K  E   E+LG+    D 
Sbjct: 476 -------------------HENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDP 516

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETAR 792
            ++D   ++   R  G+++ MLTGD V  A+
Sbjct: 517 PRDDTAQTVHEARRLGLRVKMLTGDAVGIAK 547

>Scas_297.1
          Length = 800

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 77/193 (39%), Gaps = 34/193 (17%)

Query: 785 GDKVETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNKGACLLIDGESLGMF 844
           GD + TAR ++ +  ++S   Y+        PE A+   ++  + K        E + M 
Sbjct: 1   GDNILTARAIARNCNILSEETYLI-------PECAIEGPKFRTLTKQ-------ERIKM- 45

Query: 845 LRYYKREFFDVVICLPTV-VACRCTPQQKADVALVIREFTGKRVCCIGDGGNDVSMIQCA 903
                         LP + V  R +P+ K  +   ++   G  V   GDG ND   ++ A
Sbjct: 46  --------------LPNLRVMARSSPEDKRLLVETLKGM-GDVVAVTGDGTNDAPALKLA 90

Query: 904 DVG--VGIVGKEGKQASLAADFSITEFCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIA 961
           DVG  +GI G E  + +        +F  + + + W GR       K  QF +   +   
Sbjct: 91  DVGFSMGISGTEVAREASDIILMTDDFAAIVDAIKW-GRCVSISIKKFIQFQLIVNITAV 149

Query: 962 ICQAVYSICSKFE 974
           I   V SI S+ E
Sbjct: 150 ILAFVSSIASEDE 162

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 6/69 (8%)

Query: 255 RRRDNESNSELYHVLNQSKLVPS-KDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIK 313
           R    + N ++  + N  +L+ S  +L VGD+I +  GD +PAD VL++     G+  + 
Sbjct: 590 RLNKKKENRKIIVIRNSQELLTSIHNLLVGDIITLQTGDVIPADGVLVE-----GQCEVD 644

Query: 314 TDQLDGETD 322
              + GE+D
Sbjct: 645 ESSITGESD 653

>Scas_227.0d
          Length = 307

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 12/80 (15%)

Query: 643 EILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMAR------------IVENNDWL 690
           EI Q+ PF S  K  GIIV  ++ + Y F  KGA  +++             +  N D +
Sbjct: 184 EIAQIIPFESTRKWGGIIVKYKESNLYRFFIKGAAEIVSNNCHSKRNSDDSIVTLNKDQI 243

Query: 691 EEETGNMAREGLRTLVVGRK 710
            +E  N+A + LR L +  +
Sbjct: 244 NKEIENLANDALRALSLAHR 263

>CAGL0A00495g complement(55014..57722) highly similar to sp|P05030
           Saccharomyces cerevisiae YGL008c PMA1 or sp|P19657
           Saccharomyces cerevisiae YPL036w PMA2, hypothetical
           start
          Length = 902

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 64/151 (42%), Gaps = 27/151 (17%)

Query: 642 YEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREG 701
           Y++++  PF+  SK++  +V +  + E     KGA   + + VE +  + E+        
Sbjct: 427 YKVIEFHPFDPVSKKVTAVV-ESPEGERIVCVKGAPLFVLKTVEEDHPIPEDV------- 478

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
                               ++Y++    + +R  +   V  K  E   E+LG+    D 
Sbjct: 479 -------------------HENYENKVAELASRGFRALGVARKRGEGHWEILGVMPCMDP 519

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETAR 792
            ++D   ++   R  G+++ MLTGD V  A+
Sbjct: 520 PRDDTAETVNEARRLGLRVKMLTGDAVGIAK 550

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 443 AGFHNSDWYLDVMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIP 501
           A F+ +D  + ++R+ +  + I +PV L   +    +V A  +       + IV+  +  
Sbjct: 295 ACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 350

Query: 502 EDLGRIEYLLSDKTGTLTQNDMQLKK 527
           E L  +E L SDKTGTLT+N + L +
Sbjct: 351 ESLAGVEILCSDKTGTLTKNKLSLHE 376

>Scas_710.41
          Length = 904

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 59/270 (21%), Positives = 101/270 (37%), Gaps = 59/270 (21%)

Query: 642 YEILQVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREG 701
           Y+IL+  PF+  SK++  +V   + +    + KGA   + + VE +  + E+        
Sbjct: 430 YKILEFHPFDPVSKKVTAVVKSPEGETITCV-KGAPLFVLKTVEEDHPVPEDV------- 481

Query: 702 LRTLVVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNAVITKYLEYDLELLGLTGVEDK 761
                               ++Y++    + +R  +   V  K  E   E+LG+    D 
Sbjct: 482 -------------------HENYENKVAELASRGFRSLGVARKRGEGYWEILGVMPCMDP 522

Query: 762 LQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKPEGALN 821
            ++D   +I   R  G+++ MLTGD V  A+  S    L                   +N
Sbjct: 523 PRDDTARTIAEARTLGLRVKMLTGDAVGIAKETSRQLGL------------------GVN 564

Query: 822 QLEYLKVNKGACLLIDGESLGMFLRYYKREFFDVVICLPTVVACRCTPQQKADVALVIRE 881
                K+  G    + G  L  F+      F +V             PQ K  V  +++ 
Sbjct: 565 IYNAEKLGLGGGGDMPGSELADFVENADG-FAEVF------------PQHKYKVVEILQN 611

Query: 882 FTGKRVCCIGDGGNDVSMIQCADVGVGIVG 911
             G  V   GDG ND   ++ AD G+ + G
Sbjct: 612 -RGYLVAMTGDGVNDAPSLKKADTGIAVEG 640

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 5/86 (5%)

Query: 443 AGFHNSDWYLDVMRYLILFSTI-IPVSLRVNLDLAKSVYAHQIEHDDTIPETIVRTSTIP 501
           A F+ +D  + ++R+ +  + I +PV L   +    +V A  +       + IV+  +  
Sbjct: 298 ACFYRTDGIVMILRFTLGITIIGVPVGLPAVVTTTMAVGAAYLAKK----QAIVQKLSAI 353

Query: 502 EDLGRIEYLLSDKTGTLTQNDMQLKK 527
           E L  +E L SDKTGTLT+N + L +
Sbjct: 354 ESLAGVEILCSDKTGTLTKNKLSLHE 379

>AGL041C [4270] [Homologous to ScYDR270W - NSH] (628428..632129) [3702
            bp, 1233 aa]
          Length = 1233

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 757  GVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHIITKLTKP 816
             V D+L+ + K  ++ L   GI+ WM++GD    A  V++   +       H+I  +  P
Sbjct: 1015 AVRDELRPEAKEVVQALHERGIECWMISGDNSLAANAVALEVGI------KHVIADVL-P 1067

Query: 817  EGALNQLEYLKVNKGACLLIDGESLGM 843
            EG   ++++++   G  + I     GM
Sbjct: 1068 EGKAEKIQWIRETSGQGVAIAMVGDGM 1094

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 869  PQQKADVALVIREFTGKRVCC--IGDGGNDVSMIQCADVGVGI 909
            P+ KA+    IRE +G+ V    +GDG ND   I  ADVG+ +
Sbjct: 1067 PEGKAEKIQWIRETSGQGVAIAMVGDGMNDAPAIAAADVGISL 1109

>Scas_569.0d
          Length = 468

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 60/124 (48%), Gaps = 11/124 (8%)

Query: 851 EFFDVVICLPTVVACRCTPQQKADVALVIREFTGKRVCCI-GDGGNDVSMIQCADVGVGI 909
           E  D +  LP V+A RC+PQ K  V ++       + C + GDG ND   ++ A+VG+ +
Sbjct: 93  EQIDNLPVLPLVIA-RCSPQTK--VRMIEALHRRDKFCAMTGDGVNDSPSLKMANVGIAM 149

Query: 910 VGKEGKQASLAADFSITE--FCHLTELLLWHGRNSYKRSAKLAQFIMHRGLVIAICQAVY 967
                  A  A+D  +++  F  +   +   GR   + S  + +F++   L   + QA+Y
Sbjct: 150 GINGSDVAKDASDIVLSDDNFASILNAIE-EGR---RMSDNIQKFVLQL-LAENVAQALY 204

Query: 968 SICS 971
            IC 
Sbjct: 205 LICG 208

>KLLA0D04092g complement(344666..348124) some similarities with
           sp|P38995 Saccharomyces cerevisiae YDR270w CCC2 probable
           copper-transporting ATPase P16.2.f2.1, hypothetical
           start
          Length = 1152

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 755 LTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVS 795
           +   +D+++ + K  I+ LR +GI+ WM++GD   TAR V+
Sbjct: 924 MCAAKDEIRPEAKDVIKELRRSGIECWMISGDNEVTARAVA 964

>CAGL0M08602g complement(856349..859387) similar to sp|P38995
           Saccharomyces cerevisiae YDR270w CCC2, start by
           similarity
          Length = 1012

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 42/83 (50%), Gaps = 5/83 (6%)

Query: 745 YLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRG 804
           YL  D ++ G   + D++++D K  I  LRN   +++M+TGD  ++A  V+    +    
Sbjct: 748 YLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNN 807

Query: 805 QYVHIITKLTKPEGALNQLEYLK 827
            Y  +      P+G    +EYL+
Sbjct: 808 VYSEV-----TPDGKSQTVEYLR 825

>AER067C [2572] [Homologous to ScYLR398C (SKI2) - SH]
           (757163..761011) [3849 bp, 1282 aa]
          Length = 1282

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 6/95 (6%)

Query: 646 QVFPFNSDSKRMGIIVHDEQKDEYWFMQKGADTVMARIVENNDWLEEETGNMAREGLRTL 705
           + +PF  D  +   I H EQ D  +     A T   + V     +   T NM +    + 
Sbjct: 333 RTWPFELDIFQKQAIYHLEQGDSVFV---AAHTSAGKTVVAEYAIAMSTRNMTKTIYTSP 389

Query: 706 VVGRKKLSRNIYDQFKKDYDDASLSMVNRDQQMNA 740
           +   K LS   +  FK+D+DD S+ ++  D Q+NA
Sbjct: 390 I---KALSNQKFRDFKEDFDDVSVGLITGDVQINA 421

>YBR295W (PCA1) [472] chr2 (792805..796455) P-type copper-transporting
            ATPase, involved in resistance to cadmium [3651 bp, 1216
            aa]
          Length = 1216

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 757  GVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKL 800
             +ED L+ D  S+I LLR  GI + +L+GD     R  S++A+L
Sbjct: 1021 ALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVR--SMAARL 1062

>Kwal_55.21575
          Length = 989

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 28/48 (58%)

Query: 270 NQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQL 317
            +++ +P + L+VGD ++I  G ++P D V+++      E+ I  + L
Sbjct: 417 GKAREIPVEFLQVGDTVEIKPGAKIPTDGVIIEGESEVDESLITGESL 464

>YDR270W (CCC2) [1102] chr4 (1005667..1008681) Copper-transporting
           P-type ATPase, member of the heavy-metal transporting
           P-type ATPases in the superfamily of P-type ATPases
           [3015 bp, 1004 aa]
          Length = 1004

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 5/52 (9%)

Query: 270 NQSKLVPSKDLKVGDLIKISKGDRLPADLVLLQSSEPSGETFIKTDQLDGET 321
           N++K +P + L+V D+++I  G ++PAD ++ +     GE+ I    + GE+
Sbjct: 421 NETKEIPIELLQVNDIVEIKPGMKIPADGIITR-----GESEIDESLMTGES 467

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 31/51 (60%)

Query: 745 YLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDKVETARCVS 795
           Y+  +  + GL  + D++++D  ++++ L+  G + +M+TGD    A+ V+
Sbjct: 748 YVSVNGHVFGLFEINDEVKHDSYATVQYLQRNGYETYMITGDNNSAAKRVA 798

>Scas_657.21*
          Length = 737

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 331 LTQNLTEPDLMNKVSITASAPEKAIHNFLGKVTYKDTSSNPL-SIDNTLWANTVLA 385
            +Q+   P   N + IT S+P +   N    ++Y++TSSNP+ S D+TL  +++ +
Sbjct: 229 FSQSSLSPSFFNSL-ITTSSPNQVTSNTKSFISYRNTSSNPMTSSDHTLSKHSITS 283

>Scas_615.9
          Length = 942

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 15/112 (13%)

Query: 733 NRDQQMNAVITKYLEYDLELLGLTGVEDKLQNDVKSSIELLRNAGIKIWMLTGDK----V 788
           N D   +     Y+  +  L+G   + D ++ DV   I+ L+     I+M+TGD     +
Sbjct: 675 NSDNTSDDFTKSYVSINDTLVGKFEIRDSVKEDVADIIQYLQGLHYDIYMVTGDSHGAAM 734

Query: 789 ETARCVSISAKLISRGQYVHIITKLTKPEGALNQLEYLKVNK--GACLLIDG 838
           + A+ V I+A  +  G           P G    +E L+ +   G   + DG
Sbjct: 735 KVAQQVGIAANNVYSG---------VTPSGKCEIVESLQADSVGGVAFVGDG 777

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 36,621,386
Number of extensions: 1595580
Number of successful extensions: 5436
Number of sequences better than 10.0: 93
Number of HSP's gapped: 5367
Number of HSP's successfully gapped: 179
Length of query: 1161
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1048
Effective length of database: 12,684,275
Effective search space: 13293120200
Effective search space used: 13293120200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)