Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.3725125113060.0
YIL049W (DFG10)2532507771e-104
CAGL0L00693g2492517531e-101
ADL073W2772474891e-60
Sklu_1893.32812764324e-52
Kwal_23.58252432524121e-49
KLLA0C08261g2332463632e-42
AFR620W210764635.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.37
         (251 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.37                                                           507   0.0  
YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in...   303   e-104
CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces cer...   294   e-101
ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH] complement...   192   1e-60
Sklu_1893.3 YIL049W, Contig c1893 3492-4337                           171   4e-52
Kwal_23.5825                                                          163   1e-49
KLLA0C08261g complement(724399..725100) similar to sp|P40526 Sac...   144   2e-42
AFR620W [3812] [Homologous to ScYCR032W (BPH1) - SH] complement(...    29   5.0  

>Scas_704.37
          Length = 251

 Score =  507 bits (1306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/251 (100%), Positives = 251/251 (100%)

Query: 1   MSTDTILNLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHF 60
           MSTDTILNLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHF
Sbjct: 1   MSTDTILNLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHF 60

Query: 61  TVPKSYFSHFYYLSAILSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCKYTSKSRMNWS 120
           TVPKSYFSHFYYLSAILSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCKYTSKSRMNWS
Sbjct: 61  TVPKSYFSHFYYLSAILSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCKYTSKSRMNWS 120

Query: 121 HYVVGIWFYTVLHLILNICLYFERISPTINISALFILILASWDQYKNHRVLAHLRKYSLP 180
           HYVVGIWFYTVLHLILNICLYFERISPTINISALFILILASWDQYKNHRVLAHLRKYSLP
Sbjct: 121 HYVVGIWFYTVLHLILNICLYFERISPTINISALFILILASWDQYKNHRVLAHLRKYSLP 180

Query: 181 TQRLFKIVCCPHYLDEMIIYSTFLSYNAEFIWPLIWVVVSLSISAIETKNFYKSKFVEEN 240
           TQRLFKIVCCPHYLDEMIIYSTFLSYNAEFIWPLIWVVVSLSISAIETKNFYKSKFVEEN
Sbjct: 181 TQRLFKIVCCPHYLDEMIIYSTFLSYNAEFIWPLIWVVVSLSISAIETKNFYKSKFVEEN 240

Query: 241 VPDYSIIPYIL 251
           VPDYSIIPYIL
Sbjct: 241 VPDYSIIPYIL 251

>YIL049W (DFG10) [2618] chr9 (260157..260918) Protein involved in
           filamentous growth, cell polarity, and cellular
           elongation [762 bp, 253 aa]
          Length = 253

 Score =  303 bits (777), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 148/250 (59%), Positives = 190/250 (76%)

Query: 2   STDTILNLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHFT 61
             + +L   +  YR SFF+G+ SL IAK  LP+FLQYGKT    ++    ++ ++I  FT
Sbjct: 4   DEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFT 63

Query: 62  VPKSYFSHFYYLSAILSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCKYTSKSRMNWSH 121
           VPK+YFSHFYYL+  LS+ TLY YPK+P+VW++  HSLRRLYETL+V  YTS SRMNWSH
Sbjct: 64  VPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSH 123

Query: 122 YVVGIWFYTVLHLILNICLYFERISPTINISALFILILASWDQYKNHRVLAHLRKYSLPT 181
           Y+VGIWFY+VL LILNI LY   I  T+N++A  I  +ASWDQYKNH +LA+L KYSLPT
Sbjct: 124 YLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLPT 183

Query: 182 QRLFKIVCCPHYLDEMIIYSTFLSYNAEFIWPLIWVVVSLSISAIETKNFYKSKFVEENV 241
            RLF++VCCPHYLDE+IIYST L Y  EF   L+WV+ SL+ISA+ETKN+Y+ KF + +V
Sbjct: 184 GRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVITSLTISALETKNYYRHKFKDNHV 243

Query: 242 PDYSIIPYIL 251
             Y+IIP+I+
Sbjct: 244 APYAIIPFII 253

>CAGL0L00693g 85333..86082 similar to sp|P40526 Saccharomyces
           cerevisiae YIL049w DFG10, hypothetical start
          Length = 249

 Score =  294 bits (753), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 142/251 (56%), Positives = 189/251 (75%), Gaps = 3/251 (1%)

Query: 1   MSTDTILNLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHF 60
           +    IL L+ I  R S  +GL+SL IAK+YLPDFL+YGKT   A++G+   +WDKI +F
Sbjct: 2   IDNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFTFAKNGN-ENIWDKIKNF 60

Query: 61  TVPKSYFSHFYYLSAILSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCKYTSKSRMNWS 120
           +VPKSYF+HFY LS++L++ TL  YP   +VW L  HS RRLYETL++ KYT KS+MNWS
Sbjct: 61  SVPKSYFAHFYILSSVLALVTLASYPTDILVWQLFLHSSRRLYETLYISKYTEKSKMNWS 120

Query: 121 HYVVGIWFYTVLHLILNICLYFERISPTINISALFILILASWDQYKNHRVLAHLRKYSLP 180
           HY VG+WFY+ L+++  + L  +R + T  +  + +++LASWDQYKNH VL+ L+KYSLP
Sbjct: 121 HYAVGLWFYSQLNIL--VYLRVQRENTTARVLPILVMVLASWDQYKNHVVLSKLKKYSLP 178

Query: 181 TQRLFKIVCCPHYLDEMIIYSTFLSYNAEFIWPLIWVVVSLSISAIETKNFYKSKFVEEN 240
             RLF++VCCPHYLDEMIIY + +SY  EF+WPLIWV+ SLSISA+E++ FY SKF +  
Sbjct: 179 RSRLFELVCCPHYLDEMIIYGSLVSYGHEFVWPLIWVIASLSISALESRKFYLSKFKDTE 238

Query: 241 VPDYSIIPYIL 251
           VP Y+ IPYIL
Sbjct: 239 VPRYAAIPYIL 249

>ADL073W [1668] [Homologous to ScYIL049W (DFG10) - SH]
           complement(553708..554541) [834 bp, 277 aa]
          Length = 277

 Score =  192 bits (489), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/247 (44%), Positives = 155/247 (62%), Gaps = 16/247 (6%)

Query: 17  SFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHFTVPKSYFSHFYYLSAI 76
           S+ +GL SL +AK+ LP  LQYGKT      G +   +  I    VP+ YFSHFY LS +
Sbjct: 35  SYGIGLFSLWLAKYRLPKLLQYGKTRQKKLVGVIEPWYTSI---AVPRRYFSHFYVLSFV 91

Query: 77  LSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCKYTSKSRMNWSHYVVGIWFYTVLHLIL 136
           L+ + LY +P+  +   + FHSLRRL E+  V K+ S+SRM+ +HY+VG+WFY+VL+L +
Sbjct: 92  LATANLYWFPEDVITSCIFFHSLRRLVESARVTKWGSESRMHAAHYLVGLWFYSVLNLSV 151

Query: 137 NICLYFE---RISPTIN-----ISALFILILASWDQYKNHRVLAHLRKYSLPTQRLFKIV 188
            + L      R   T+N     + A+  L LASWDQ +NH  LAH+ KY+LP + LFKIV
Sbjct: 152 YLQLNSRQRTRSPSTVNKVFGAVGAVGFL-LASWDQARNHIHLAHMIKYTLPRRGLFKIV 210

Query: 189 CCPHYLDEMIIYSTFLSYNAEFIWPL----IWVVVSLSISAIETKNFYKSKFVEENVPDY 244
            C HY DE++IY++  +  A   W L    IWV  +L +SA+ETK +Y +KF  + V  Y
Sbjct: 211 ACAHYFDEIVIYASLAAMEATTRWSLTVAVIWVCANLGVSAVETKRYYDAKFKGQAVAPY 270

Query: 245 SIIPYIL 251
           ++IPYI+
Sbjct: 271 ALIPYIM 277

>Sklu_1893.3 YIL049W, Contig c1893 3492-4337
          Length = 281

 Score =  171 bits (432), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 100/276 (36%), Positives = 160/276 (57%), Gaps = 30/276 (10%)

Query: 4   DTILNLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTL----NTAQSGD---------V 50
           D  +  + +   +SF + +  + +AK+ L  FL+YGKTL    +    G+         V
Sbjct: 8   DRAIKCITLLIDASFVVAISCVLLAKWKLTGFLKYGKTLLSVDDKKHDGNEKEKREMTNV 67

Query: 51  MTLWDKIIHFTVPKSYFSHFYYLSAILSVSTLYVYPKYPVVWLLAFHSLRRLYETLFVCK 110
           + + D      VP+++FSHFY +S   S+     YP + + WL  FHSLRRLYE+  + K
Sbjct: 68  LQILDFFESIVVPRAWFSHFYIISTFFSLVNGIWYPGHLIAWLPLFHSLRRLYESYCISK 127

Query: 111 YTSKSRMNWSHYVVGIWFYTVLHLILNICLYFERI------SPTINISALFILILASWDQ 164
           + ++S+MN SHY+VGIWFYT L+LI +I L  +        +    + ALF+ + +S++Q
Sbjct: 128 FGAESKMNISHYLVGIWFYTSLNLIFSIGLSKDNKITSLSSNSAFQLIALFVFLASSYNQ 187

Query: 165 YKNHRVLAHLRKYSLPTQRLFKIVCCPHYLDEMIIYSTFLSYNA---------EFIWPLI 215
           Y+NH  L+ L KY+ P + LFK V C HY DE++IYS+   Y              + L+
Sbjct: 188 YQNHVYLSQLVKYTNPKKGLFKWVSCAHYFDEILIYSSLFGYARVSRYGYLADGLKYCLL 247

Query: 216 WVVVSLSISAIETKNFYKSKFVEENVPDYSIIPYIL 251
           WV ++LS+SAIET+N+Y  ++  ++V  ++IIP++L
Sbjct: 248 WVGINLSVSAIETRNYYSHRY--QDVAPHAIIPFVL 281

>Kwal_23.5825
          Length = 243

 Score =  163 bits (412), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 154/252 (61%), Gaps = 19/252 (7%)

Query: 8   NLLVIGYRSSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQS-GDVMTLWDKIIHFTVPKSY 66
            LL   + +SF +G+ S+ +AK+ LP  L+YGKTL  +++   ++  ++++   TVPK +
Sbjct: 3   TLLDAAFYASFLVGIASVHLAKWQLPALLKYGKTLEGSRTQKGLLGFFEQL---TVPKQW 59

Query: 67  FSHFYYLSAILSVSTLYVYPKYPVVWLL-AFHSLRRLYETLFVCKYTSKSRMNWSHYVVG 125
           F+HFY  S  L++  L VY +  +V LL   HS RRLYET  V KY   SRM+ SHY+VG
Sbjct: 60  FTHFYVYSTTLAI--LNVYCQRNLVSLLFLIHSGRRLYETQCVTKYGENSRMHLSHYLVG 117

Query: 126 IWFYTVLHLILNICLYFERIS----PTINISALFILILASWDQYKNHRVLAHLRKYSLPT 181
           +WFY+V +  +     FE  S    P +   A+ +  L+S DQY NH  L+ L KY++PT
Sbjct: 118 LWFYSVANWAV-----FESKSRSQLPLVRFLAVLVFALSSVDQYMNHLHLSKLVKYTMPT 172

Query: 182 QRLFKIVCCPHYLDEMIIYSTFLSYNA--EFIWPLIWVVVSLSISAIETKNFYKSKFVEE 239
             LF I   PHY DE+++Y +  +Y    +    L+WV+V+LS SA+ET+ +Y  KF  +
Sbjct: 173 YGLFSITTSPHYFDEVLLYLSLTAYTGSLKLFACLVWVIVNLSTSALETRAWYLKKF-PQ 231

Query: 240 NVPDYSIIPYIL 251
             P Y+IIP++L
Sbjct: 232 TTPPYAIIPFVL 243

>KLLA0C08261g complement(724399..725100) similar to sp|P40526
           Saccharomyces cerevisiae YIL049w DFG10 singleton, start
           by similarity
          Length = 233

 Score =  144 bits (363), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 145/246 (58%), Gaps = 34/246 (13%)

Query: 16  SSFFLGLLSLAIAKFYLPDFLQYGKTLNTAQSGDVMTLWDKIIHFTVPKSYFSHFYYLSA 75
           S+F++G++S+ +A+FY+P  L+YGKT   + +      W  +   T PKS F HFY LS+
Sbjct: 10  STFYVGIISVFVAEFYIPQLLKYGKTWEASNN-----FWYSL---TCPKSNFGHFYLLSS 61

Query: 76  ILSVSTLYVYPKYPVVWLLAF-------HSLRRLYETLFVCKYTSKSRMNWSHYVVGIWF 128
           I S+        Y ++W+ +        HS+RRLYE   V K+  +S+++ SHY+VGIWF
Sbjct: 62  IFSI--------YNLLWIRSLLTLSVFIHSVRRLYECYCVTKW-GQSKIHLSHYLVGIWF 112

Query: 129 YTVLHLILNICLYFERISPTINISALFILILASWDQYKNHRVLAHLRKYSLPTQRLFKIV 188
           YT L+L   I LY      ++    LFI+  +S DQ  NH  L+ L+KYS P+  LFK +
Sbjct: 113 YTTLNL--GIMLYHGETQYSLISVILFIM--SSLDQATNHDYLSKLKKYSQPSYGLFKYI 168

Query: 189 CCPHYLDEMIIYSTFLSYNAE----FIWPLIWVVVSLSISAIETKNFYKSKFVEENVPDY 244
           C  HY DE++IY++F+  +       I  ++W++V+L  S+ ET N+Y+ KF   +   +
Sbjct: 169 CSAHYFDELLIYTSFMLMDKGSRMLLIHCILWILVNLGTSSFETGNWYQEKFGYRS--RW 226

Query: 245 SIIPYI 250
            +IPY+
Sbjct: 227 YLIPYV 232

>AFR620W [3812] [Homologous to ScYCR032W (BPH1) - SH]
           complement(1553521..1559844) [6324 bp, 2107 aa]
          Length = 2107

 Score = 28.9 bits (63), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 5/64 (7%)

Query: 133 HLILNICLYF--ERISPTINISALFILILASWDQYKNHRVLAHLRKYSLPTQRLFKIVCC 190
           HL+LN+ L+   +  +P +  +  F+L    W Q  NHR   H  +  L   RL +    
Sbjct: 516 HLVLNLELWMSGDHKTPEVREAVRFLLFQLDWLQNSNHR---HFNRLQLTNLRLLETFTI 572

Query: 191 PHYL 194
             +L
Sbjct: 573 QQHL 576

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.330    0.142    0.453 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,340,884
Number of extensions: 340193
Number of successful extensions: 1097
Number of sequences better than 10.0: 18
Number of HSP's gapped: 1078
Number of HSP's successfully gapped: 19
Length of query: 251
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 152
Effective length of database: 13,168,927
Effective search space: 2001676904
Effective search space used: 2001676904
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)