Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.3654554527280.0
CAGL0L00671g54354119300.0
YER056C (FCY2)53352519270.0
Scas_715.4953252918960.0
Scas_715.47d53353718950.0
YER060W (FCY21)52851618850.0
YER060W-A (FCY22)53051718190.0
CAGL0J02948g51551417650.0
Sklu_1893.251348016990.0
Kwal_23.581951649416040.0
KLLA0C08283g51949615810.0
Scas_715.47d152352815480.0
CAGL0C00231g54050615000.0
Kwal_34.1573051851714820.0
ADL074W52452014640.0
Scas_715.54d2322365682e-69
Kwal_47.172165425155573e-64
KLLA0D05060g5235245064e-57
YGL186C (TPN1)5795284525e-49
CAGL0L06138g6313904044e-42
Scas_710.305844184009e-42
Scas_701.168682453e-25
Scas_690.1*636682583e-23
KLLA0C14135g27172740.46
Kwal_47.1920323583682.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.36
         (545 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.36                                                          1055   0.0  
CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomy...   748   0.0  
YER056C (FCY2) [1485] chr5 complement(266511..268112) Cytosine/p...   746   0.0  
Scas_715.49                                                           734   0.0  
Scas_715.47d                                                          734   0.0  
YER060W (FCY21) [1490] chr5 (274565..276151) Protein with simila...   730   0.0  
YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine p...   705   0.0  
CAGL0J02948g 282559..284106 highly similar to sp|P40039 Saccharo...   684   0.0  
Sklu_1893.2 YER056C, Contig c1893 1725-3266                           659   0.0  
Kwal_23.5819                                                          622   0.0  
KLLA0C08283g complement(725563..727122) similar to sp|P17064 Sac...   613   0.0  
Scas_715.47d1                                                         600   0.0  
CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces cer...   582   0.0  
Kwal_34.15730                                                         575   0.0  
ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH] complement(...   568   0.0  
Scas_715.54d                                                          223   2e-69
Kwal_47.17216                                                         219   3e-64
KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces c...   199   4e-57
YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of ...   178   5e-49
CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces c...   160   4e-42
Scas_710.30                                                           158   9e-42
Scas_701.1                                                             99   3e-25
Scas_690.1*                                                           103   3e-23
KLLA0C14135g complement(1221902..1222717) similar to sp|P53335 S...    33   0.46 
Kwal_47.19203                                                          31   2.2  

>Scas_704.36
          Length = 545

 Score = 1055 bits (2728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/545 (95%), Positives = 521/545 (95%)

Query: 1   MRLTRRVSVPGPSRDIDLERNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQ 60
           MRLTRRVSVPGPSRDIDLERNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQ
Sbjct: 1   MRLTRRVSVPGPSRDIDLERNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQ 60

Query: 61  EPETYMEETKLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYAL 120
           EPETYMEETKLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYAL
Sbjct: 61  EPETYMEETKLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYAL 120

Query: 121 GGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXX 180
           GGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGN      
Sbjct: 121 GGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNITARIF 180

Query: 181 XXXXXXXCVGWGVVNTVASSQLLNMVNTPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYE 240
                  CVGWGVVNTVASSQLLNMVNTPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYE
Sbjct: 181 AIINIIACVGWGVVNTVASSQLLNMVNTPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYE 240

Query: 241 KWSWVPNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADY 300
           KWSWVPNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLS           WTTYAADY
Sbjct: 241 KWSWVPNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSFGGAVFGFAAGWTTYAADY 300

Query: 301 TVYMPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYA 360
           TVYMPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYA
Sbjct: 301 TVYMPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYA 360

Query: 361 ILVPDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFT 420
           ILVPDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFT
Sbjct: 361 ILVPDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFT 420

Query: 421 LGISIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPI 480
           LGISIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPI
Sbjct: 421 LGISIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPI 480

Query: 481 GIAGTSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEI 540
           GIAGTSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEI
Sbjct: 481 GIAGTSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEI 540

Query: 541 KYTGR 545
           KYTGR
Sbjct: 541 KYTGR 545

>CAGL0L00671g 83129..84760 highly similar to sp|P17064 Saccharomyces
           cerevisiae YER056c FCY2 purine-cytosine permease or
           sp|P40039 Saccharomyces cerevisiae YER060w FCY21,
           hypothetical start
          Length = 543

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/541 (68%), Positives = 429/541 (79%), Gaps = 12/541 (2%)

Query: 14  RDIDLERNTDLERETGYEMNSFGEKASSADIKVIP-GVPDY-----DEYESIQEPETYME 67
           R+ D    +D      YE+N   EK    D+K       D+     D++ +  E  T +E
Sbjct: 6   RNHD-HSGSDGSHSNDYELNEV-EKQPVEDVKTTNVNTNDFEYDYGDDFTNSSEAAT-VE 62

Query: 68  ETKLS--FFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGP 125
           ETKL   F +R    +NAETKGVEPVTDEEKTDDS++NAASMWFSANLV+ASYALG LGP
Sbjct: 63  ETKLKLGFISRLALKMNAETKGVEPVTDEEKTDDSVLNAASMWFSANLVLASYALGALGP 122

Query: 126 IVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXX 185
           IVF LNFGTSVL I+FFN++GL+S+AFFSVFGAEFGLRQMILSR+L+GN           
Sbjct: 123 IVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLRQMILSRFLVGNVTARVFAAINV 182

Query: 186 XXCVGWGVVNTVASSQLLNMVNT-PNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSW 244
             CVGWGVVNTV ++QLL++VN   +  PLW GCL+IVG TV+VTFFGY++IHAYE+WSW
Sbjct: 183 VACVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLVIVGGTVMVTFFGYSIIHAYERWSW 242

Query: 245 VPNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYM 304
           VPNFAVFLVIIARL  SG F+ G WTSG TTAG VLS           WTTYAADYTVYM
Sbjct: 243 VPNFAVFLVIIARLHKSGQFSNGPWTSGATTAGGVLSFGSAIYGFAAGWTTYAADYTVYM 302

Query: 305 PRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVP 364
           PR+ NK+ IFF L AGL+ PL FTMILGAASAMGAVNNP+WM  Y  + MGG+TYAILVP
Sbjct: 303 PRTMNKFKIFFFLCAGLAFPLLFTMILGAASAMGAVNNPEWMALYDKDNMGGLTYAILVP 362

Query: 365 DSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGIS 424
           +SLHGFG+FCCVLLAMST+ANNIPNMYTIALSVQALY+PFS+VPRV WT+AGNA  +GIS
Sbjct: 363 NSLHGFGEFCCVLLAMSTIANNIPNMYTIALSVQALYEPFSRVPRVVWTLAGNAAVVGIS 422

Query: 425 IAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAG 484
           I A YYF+GF+ENFM+SIGYYLAIYIAISLSEHFIYR+GF+GYN+EDWN W +LPIGIAG
Sbjct: 423 IPASYYFEGFLENFMDSIGYYLAIYIAISLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAG 482

Query: 485 TSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTG 544
            SAL VGAFGVALGMSQ+YW GEI + IG HGGDIGFELG SWAFIV+N++RPLEIKY G
Sbjct: 483 CSALFVGAFGVALGMSQTYWTGEISRHIGKHGGDIGFELGMSWAFIVFNIVRPLEIKYFG 542

Query: 545 R 545
           R
Sbjct: 543 R 543

>YER056C (FCY2) [1485] chr5 complement(266511..268112)
           Cytosine/purine permease, member of the purine/cytosine
           permease family of membrane transporters [1602 bp, 533
           aa]
          Length = 533

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/525 (69%), Positives = 421/525 (80%), Gaps = 6/525 (1%)

Query: 23  DLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVASLN 82
           DLE+ +    +S   +   A  +      + D+   ++  E     TKLS+F++F ASLN
Sbjct: 13  DLEKRSPVIGSSLENEKKVAASETFTATSEDDQQYIVESSEA----TKLSWFHKFFASLN 68

Query: 83  AETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFF 142
           AETKGVEPVT++EKTDDSI+NAASMWFSAN+VIASYALG LGP+VF LNFG SVLVIIFF
Sbjct: 69  AETKGVEPVTEDEKTDDSILNAASMWFSANMVIASYALGALGPMVFGLNFGQSVLVIIFF 128

Query: 143 NILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVASSQL 202
           NI+GL+ +AFFSVFGAE GLRQMILSRYL+GN             CVGWG+VNT  S+QL
Sbjct: 129 NIMGLIFVAFFSVFGAELGLRQMILSRYLVGNVTARIFSLINVIACVGWGIVNTSVSAQL 188

Query: 203 LNMVN--TPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKM 260
           LNMVN  + + CP+WAGCLII+G TVLVTFFGY+VIHAYEKWSWVPNFAVFLVIIA+L  
Sbjct: 189 LNMVNEGSGHVCPIWAGCLIIIGGTVLVTFFGYSVIHAYEKWSWVPNFAVFLVIIAQLSR 248

Query: 261 SGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIFFSLTAG 320
           SG F GGEW  G TTAG+VLS           WTTYAADYTVYMP+STNKY IFFSL AG
Sbjct: 249 SGKFKGGEWVGGATTAGSVLSFGSSIFGFAAGWTTYAADYTVYMPKSTNKYKIFFSLVAG 308

Query: 321 LSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAM 380
           L+ PLFFTMILGAASAM A+N+P W  YY  N MGGV YAILVP+SL+GFGQFCCVLLA+
Sbjct: 309 LAFPLFFTMILGAASAMAALNDPTWKAYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLAL 368

Query: 381 STVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMN 440
           ST+ANNIPNMYT+ALS QAL+ P +K+PRV WTMAGNA TLGISI A YYF GFMENFM+
Sbjct: 369 STIANNIPNMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMD 428

Query: 441 SIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMS 500
           SIGYYLAIYIAIS SEHF YR+ F  YN++DW+ W  LPIGIAGT+ALIVGAFGVALGM 
Sbjct: 429 SIGYYLAIYIAISCSEHFFYRRSFSAYNIDDWDNWEHLPIGIAGTAALIVGAFGVALGMC 488

Query: 501 QSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           Q+YWVGEIG+LIG +GGDIGFELGASWAFI+YN+LRPLE+KY GR
Sbjct: 489 QTYWVGEIGRLIGKYGGDIGFELGASWAFIIYNILRPLELKYFGR 533

>Scas_715.49
          Length = 532

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/529 (67%), Positives = 422/529 (79%), Gaps = 4/529 (0%)

Query: 19  ERNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQ-EPETYMEETKLSFFNRF 77
           + N +++  + YEMN    + +S D+K        D Y  I       + ETKL+ FNR 
Sbjct: 6   DANKEIDVGSSYEMNDL--ERNSKDLKSPSKNLSSDYYVDIDSHASEEVLETKLNLFNRI 63

Query: 78  VASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVL 137
            A L+AETKG+EP+TDEEK D S++NAASMWFSAN+VIA+YA+GGLGP+VF LNFGTS L
Sbjct: 64  AAGLSAETKGIEPITDEEKNDASLLNAASMWFSANMVIAAYAIGGLGPLVFGLNFGTSTL 123

Query: 138 VIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTV 197
           VIIFFNILGLL +AFFS+FGA+ GLRQM+LSR+L+GN             CVGWG+VNTV
Sbjct: 124 VIIFFNILGLLPVAFFSIFGAKLGLRQMVLSRFLIGNSTARIFSVINSVACVGWGIVNTV 183

Query: 198 ASSQLLNMVNT-PNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIA 256
           ASSQLLNMVN  P+ CPLWAGC++I+G T+L+TFFGY VIH++EKW WVPNFA FLVIIA
Sbjct: 184 ASSQLLNMVNQGPHKCPLWAGCIVIIGATILITFFGYRVIHSFEKWIWVPNFACFLVIIA 243

Query: 257 RLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIFFS 316
           RL  SG F+ GEWTSGPTTAGNVLS           WTTYAADYTVYMPR+TNK+ IFFS
Sbjct: 244 RLAKSGNFSNGEWTSGPTTAGNVLSFGSAVFGFATGWTTYAADYTVYMPRNTNKFKIFFS 303

Query: 317 LTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCV 376
           L AGLS PLFF MILGAASAMGAVNNPDW NYY  NGMGG+TYAILVP+SLHGFG+FCCV
Sbjct: 304 LVAGLSFPLFFVMILGAASAMGAVNNPDWANYYSENGMGGLTYAILVPNSLHGFGEFCCV 363

Query: 377 LLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFME 436
           +L++S VANN+PNMYTIALSVQA++ P +K+PRV WTMAGN  TLGI+I ACY+F  FME
Sbjct: 364 VLSISIVANNVPNMYTIALSVQAIWAPLAKIPRVFWTMAGNFATLGIAIPACYFFDTFME 423

Query: 437 NFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVA 496
            FM+SI YYLAIYI+I+LSEHFIYR+ F+ YNVEDW+  SKLPIGIAG  A  VG  GVA
Sbjct: 424 YFMDSIAYYLAIYISIALSEHFIYRRSFEAYNVEDWDDNSKLPIGIAGCCAFGVGVIGVA 483

Query: 497 LGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           LGM Q+YW G+IG+LIG++GGD+GFELGA W+FIVYN++RPLE+KY GR
Sbjct: 484 LGMCQTYWTGQIGRLIGEYGGDLGFELGAGWSFIVYNLVRPLELKYFGR 532

>Scas_715.47d
          Length = 533

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/537 (67%), Positives = 427/537 (79%), Gaps = 25/537 (4%)

Query: 15  DIDLERNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEET----- 69
           ++DLERN++           F    +   I + P   +        EP +++E T     
Sbjct: 16  EMDLERNSE-----------FSNLPNDKKIDLGPTFSN--------EPASFIEITEETGS 56

Query: 70  KLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFN 129
           K SFFNR  + LNAETKG+E +TDEEKTD SI++A SMWFSAN+VI++Y LGG+GP+V+ 
Sbjct: 57  KFSFFNRLASQLNAETKGIERITDEEKTDGSILDATSMWFSANMVISAYTLGGIGPLVYG 116

Query: 130 LNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCV 189
           LNFGT VL IIFF+ILGLL +AFFS+FGA+FGLRQM+LSR+L+GN              V
Sbjct: 117 LNFGTCVLTIIFFSILGLLPVAFFSIFGAKFGLRQMVLSRFLIGNSTARIIAVINVISSV 176

Query: 190 GWGVVNTVASSQLLNMVNTPNN-CPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNF 248
           GWGVVN+VASSQLLNMVN  ++ CPLWAGC+II+G T+LVTFFGY+ IHAYE+WSWVPNF
Sbjct: 177 GWGVVNSVASSQLLNMVNQGHHSCPLWAGCVIIIGATILVTFFGYSYIHAYERWSWVPNF 236

Query: 249 AVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRST 308
           AVFLVIIARL MSG F+GGEWTSGPTTAGNVLS           WT YAADYTVYMPR T
Sbjct: 237 AVFLVIIARLHMSGNFSGGEWTSGPTTAGNVLSFGCAIFGFATGWTVYAADYTVYMPRDT 296

Query: 309 NKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLH 368
           NK+ IFFSL  GLS PLFF +ILGAASAMGAVNNP W +YY++NGMGGVTYAILVPDSLH
Sbjct: 297 NKFKIFFSLVGGLSFPLFFCLILGAASAMGAVNNPTWNDYYQNNGMGGVTYAILVPDSLH 356

Query: 369 GFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAAC 428
           GFG+FCCVLLA+ST+ANNIPNMY+I L+VQA+++P +KVPR  WT+AGNA TL ISI AC
Sbjct: 357 GFGEFCCVLLALSTIANNIPNMYSIGLAVQAIWEPLAKVPRAIWTLAGNAATLAISIPAC 416

Query: 429 YYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSAL 488
           YYF GFME+FMNSIGYYLAIY A +L+EHFI+R+GF+GYNVEDW+  SKLP+GIAG +AL
Sbjct: 417 YYFDGFMEDFMNSIGYYLAIYSATALAEHFIFRRGFKGYNVEDWDDNSKLPMGIAGCAAL 476

Query: 489 IVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
            VGAFGVALGMSQ+YWVGEI + IG++GGDIGFELGA WAF+VY +LRPLEIKY GR
Sbjct: 477 FVGAFGVALGMSQTYWVGEIARHIGEYGGDIGFELGAGWAFVVYVILRPLEIKYIGR 533

>YER060W (FCY21) [1490] chr5 (274565..276151) Protein with
           similarity to Fcy2p, member of the purine/cytosine
           family of secondary active transporters [1587 bp, 528
           aa]
          Length = 528

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/516 (67%), Positives = 411/516 (79%), Gaps = 4/516 (0%)

Query: 30  YEMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVASLNAETKGVE 89
           YE+     +A   D K       YD+ ES    E  + E KLSF NR  A L+AETKG+E
Sbjct: 17  YELKDLESRAH--DAKTPSTNEFYDDVESHGTEE--LVEAKLSFLNRIAAGLSAETKGIE 72

Query: 90  PVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLS 149
           P+T++EKTDDSI+NAASMWFSAN+V+ +YA+G LGP+VF+LNFG SV VIIFFN+LGL+S
Sbjct: 73  PITEDEKTDDSILNAASMWFSANMVLPAYAIGALGPMVFDLNFGQSVFVIIFFNLLGLVS 132

Query: 150 IAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMVNTP 209
           +AFFSVFGAE GLRQMILSRYL+GN             C+GWG+VNTVASSQ+LNMVN  
Sbjct: 133 VAFFSVFGAELGLRQMILSRYLVGNIAARIFSFINFIACIGWGIVNTVASSQVLNMVNPG 192

Query: 210 NNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGEW 269
           + CPLWAGC++I+G TV+VTFFGY VIHAYEKW+WVPNFAVFLVIIARL  S  F  GEW
Sbjct: 193 HQCPLWAGCIVIIGATVIVTFFGYGVIHAYEKWAWVPNFAVFLVIIARLARSKKFVLGEW 252

Query: 270 TSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTM 329
           TSGPTTAGNVLS           WTTYAADYTVYMPR TNKY IFFSL  GL+ PL+FTM
Sbjct: 253 TSGPTTAGNVLSFGSTVYGFAAGWTTYAADYTVYMPRKTNKYKIFFSLVVGLATPLYFTM 312

Query: 330 ILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPN 389
           ILGAA AM A+ +P W  YY  N +GG+T+A+LVP+S+HGFGQFCCVLL++ST+ANN+PN
Sbjct: 313 ILGAAVAMAAIGDPAWKTYYDENSIGGLTFAVLVPNSVHGFGQFCCVLLSLSTIANNVPN 372

Query: 390 MYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIY 449
           MYTIALSVQA ++P +KVPRV WT+ GNA  LGI+I ACYYF  FM  FM+SIGYYLAIY
Sbjct: 373 MYTIALSVQATWEPLAKVPRVIWTLLGNAAALGIAIPACYYFSTFMNYFMDSIGYYLAIY 432

Query: 450 IAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEIG 509
           IAI+ SEHFIYR+ F  YNV+DW++W +LPIGIAGT+ALIVGAFGVALGM Q+YWVGEI 
Sbjct: 433 IAIACSEHFIYRRSFSAYNVDDWDSWERLPIGIAGTAALIVGAFGVALGMCQTYWVGEIS 492

Query: 510 KLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           +LIGD+GGDIGFELG SWAFIVYN+ RP E+KY GR
Sbjct: 493 RLIGDYGGDIGFELGLSWAFIVYNIARPFELKYFGR 528

>YER060W-A (FCY22) [1491] chr5 (276570..278162) Purine/cytosine
           permease with similarity to Fcy2p, member of the
           purine/cytosine subfamily of the nucleobase:cation
           symporter-1 (NCS1) family [1593 bp, 530 aa]
          Length = 530

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/517 (66%), Positives = 404/517 (78%), Gaps = 11/517 (2%)

Query: 31  EMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVASLNAETKGVEP 90
           E  +   K+S+AD+        Y E   +     +++  K SFFNR  A+LNAETKG+EP
Sbjct: 23  ESGALDTKSSAADV--------YYEGVELHRTNEFIDN-KPSFFNRIAAALNAETKGIEP 73

Query: 91  VTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSI 150
           VT++EK DDSI+NAA++WFSAN+VI +Y++G LGP+VF LNFG SVLVIIFFNILGL+ +
Sbjct: 74  VTEDEKNDDSILNAATIWFSANMVIVAYSVGALGPLVFGLNFGQSVLVIIFFNILGLIPV 133

Query: 151 AFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMVN--T 208
           A FS+FG E GLRQMILSRYL GN             CVGW V+N   S+QLLNMVN  +
Sbjct: 134 ALFSLFGVELGLRQMILSRYLAGNITARFFSLVNVIACVGWCVLNISVSAQLLNMVNEGS 193

Query: 209 PNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGE 268
            +NCP+WAGCLII G TVLVTFFGY+V+HAYEKWSWVPNFA FLVIIA+L  SG F GGE
Sbjct: 194 GHNCPIWAGCLIIAGGTVLVTFFGYSVVHAYEKWSWVPNFAAFLVIIAQLSRSGKFKGGE 253

Query: 269 WTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFT 328
           W  G TTAG VLS           W TYAADYTVYMP++T+KY IFFS+ AGL+ PLFFT
Sbjct: 254 WVGGATTAGGVLSFGSSVFGSAAGWATYAADYTVYMPKTTSKYKIFFSVVAGLAFPLFFT 313

Query: 329 MILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIP 388
           MILGAA  M A+N+P W +YY  N MGGV YAILVP+SL+GFGQFCCVLLA+STVANN+P
Sbjct: 314 MILGAACGMAALNDPTWKSYYDKNAMGGVIYAILVPNSLNGFGQFCCVLLALSTVANNVP 373

Query: 389 NMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAI 448
            MYT+ALS QAL+ P +K+PRV WTMAGNA TLGISI A YYF GFMENFM+SIGYYLAI
Sbjct: 374 GMYTVALSAQALWAPLAKIPRVVWTMAGNAATLGISIPATYYFDGFMENFMDSIGYYLAI 433

Query: 449 YIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEI 508
           YIAI+ SEHFIYR+ F  YN++DW+ W  LPIGIAGT+ALI GAFGVALGM Q+YWVGEI
Sbjct: 434 YIAIACSEHFIYRRSFSAYNIDDWDNWEHLPIGIAGTAALIAGAFGVALGMCQTYWVGEI 493

Query: 509 GKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
            +LIG++GGDIGFELG SWAFI+YN++RPLE+KY GR
Sbjct: 494 SRLIGEYGGDIGFELGGSWAFIIYNIVRPLELKYFGR 530

>CAGL0J02948g 282559..284106 highly similar to sp|P40039
           Saccharomyces cerevisiae YER060w or sp|P17064
           Saccharomyces cerevisiae YER056c FCY2, hypothetical
           start
          Length = 515

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/514 (64%), Positives = 397/514 (77%), Gaps = 2/514 (0%)

Query: 34  SFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVASLNAETKGVEPVTD 93
           S+ +K    D+++          E+    +  + ETKLS  NR  A ++AETKG+EP+TD
Sbjct: 2   SYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRLAAMISAETKGIEPITD 61

Query: 94  EEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFF 153
           +EK DDS+INAASMWFSAN+V+ + A+GGLGP+VF LNFG SVL I+FFNILGL ++AFF
Sbjct: 62  DEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSVLTIVFFNILGLFAVAFF 121

Query: 154 SVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMVNT-PNNC 212
           SVFGA+FGLRQM+LSRYL+GN             CVGWG+VNTVA+SQLLN +N   +  
Sbjct: 122 SVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVNTVAASQLLNEINPGSHQL 181

Query: 213 PLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGEWTSG 272
           PLW GCL+I+G T+LV+FFGY VIH YEK+SWVPNFAVFLV+IARLK+SG F  G W SG
Sbjct: 182 PLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLVLIARLKISGKFHNGAWGSG 241

Query: 273 PTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTMILG 332
           PTTAG+VLS           WTTYAADYTVYMPR+TN Y IFF+L AGL+ PLFFTMILG
Sbjct: 242 PTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYKIFFALVAGLAFPLFFTMILG 301

Query: 333 AASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPNMYT 392
           +A A  AV+   W  +Y  NGMGG+T+AILVPDSLHGFGQFCCV+LAMST+ANN+PNMYT
Sbjct: 302 SACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFGQFCCVVLAMSTIANNVPNMYT 361

Query: 393 IALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIYIAI 452
           IALS Q+++ PF+K+PRV WTM GN   LGISI ACYYF  FM+ FM+SI YYL+IYI+I
Sbjct: 362 IALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYYFSTFMQYFMDSIAYYLSIYISI 421

Query: 453 SLSEHFIYRK-GFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEIGKL 511
           +L EH IYR   F  YNVEDWN + KLPIGIAGT +L+VGAFGVALGMSQSYWVGEI + 
Sbjct: 422 ALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISLVVGAFGVALGMSQSYWVGEIARH 481

Query: 512 IGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           IG++GGDI  ELGA WAFI YN+ RPLE+KY GR
Sbjct: 482 IGEYGGDIAIELGAGWAFIAYNICRPLELKYFGR 515

>Sklu_1893.2 YER056C, Contig c1893 1725-3266
          Length = 513

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/480 (66%), Positives = 378/480 (78%), Gaps = 1/480 (0%)

Query: 67  EETKLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPI 126
           E T +SF +R+ A L AETKG+EP+TDEEK DDSI+NAASMWFSAN+VIA+YALG LG  
Sbjct: 34  EYTTVSFIDRWAAKLKAETKGIEPITDEEKDDDSILNAASMWFSANMVIAAYALGVLGTG 93

Query: 127 VFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXX 186
           VF LNF  SVL IIFF+ LGL+ +AFFSVFGAE G+RQM+LSR+L+GN            
Sbjct: 94  VFGLNFWESVLTIIFFSFLGLIPVAFFSVFGAELGMRQMVLSRFLMGNVTARIFALINVI 153

Query: 187 XCVGWGVVNTVASSQLLNMVNTPN-NCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWV 245
            CVGWG VNT+AS+ LL+M+N     CP WA CLIIV  T++VTFFGY VIHAYEKWSWV
Sbjct: 154 ACVGWGAVNTIASASLLHMINPGGAQCPPWAACLIIVFSTIIVTFFGYRVIHAYEKWSWV 213

Query: 246 PNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMP 305
           PNFAVFLVIIARLK+SG F+ GEWTSG TTAG VLS           WTTYAADYTVYMP
Sbjct: 214 PNFAVFLVIIARLKISGNFSTGEWTSGATTAGGVLSFGGSIFGFASGWTTYAADYTVYMP 273

Query: 306 RSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPD 365
           RSTNK+ IFF+L  GL+ PL F++ILGAAS  G   N  W  YY+ + +GG+ YAILV D
Sbjct: 274 RSTNKWKIFFALVFGLAFPLCFSLILGAASIAGIEKNALWKQYYEDHSVGGLVYAILVKD 333

Query: 366 SLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISI 425
           SLHGFG+FCCVLLAMSTVANNIPNMY+IAL  Q++++P +KVPRV WT+AGN  TL I+I
Sbjct: 334 SLHGFGEFCCVLLAMSTVANNIPNMYSIALGTQSMWEPLAKVPRVFWTIAGNLVTLAIAI 393

Query: 426 AACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGT 485
            A Y F+ FM +FM +I YYLAIYIAISLSEHF YRKGF+GYNV+DWN W +LPIG AG 
Sbjct: 394 PAYYKFESFMSSFMEAIAYYLAIYIAISLSEHFFYRKGFKGYNVDDWNRWDRLPIGYAGC 453

Query: 486 SALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           +AL +GAFGVA GMSQ+YW G+I + IG++GGDIGFELG  ++FI YN+LRPLEIKYTGR
Sbjct: 454 AALFIGAFGVAFGMSQTYWEGQIARHIGEYGGDIGFELGMGFSFITYNILRPLEIKYTGR 513

>Kwal_23.5819
          Length = 516

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/494 (61%), Positives = 373/494 (75%), Gaps = 5/494 (1%)

Query: 54  DEYESIQEPETYMEETKLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFSANL 113
           D+ + + E   Y   TKLS  +R  ASL AETKG+EPVT+EEK DDSI NAASMWFSAN+
Sbjct: 26  DDSQPVVESTEY---TKLSIVDRIAASLRAETKGIEPVTEEEKDDDSIWNAASMWFSANM 82

Query: 114 VIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLG 173
           VIA+++LG LGP+V+ LNF   VL ++ F+ LG++ +A++SVFGAE GLRQM+LSR+LLG
Sbjct: 83  VIAAFSLGVLGPVVWGLNFWGCVLAVVLFSALGVIPVAYYSVFGAELGLRQMVLSRFLLG 142

Query: 174 NXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMVNTPN-NCPLWAGCLIIVGCTVLVTFFG 232
           N             CVGWG VNT+AS+QLL+M+N     CP WAGCLIIV  T+LVTFFG
Sbjct: 143 NVTARIFALINIIACVGWGAVNTIASAQLLHMINPGGARCPPWAGCLIIVLSTILVTFFG 202

Query: 233 YNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXX 292
           Y VIHAYEKWSW+PNFAVFLVIIARLK+ G+F+ GEW SG   A  VLS           
Sbjct: 203 YRVIHAYEKWSWIPNFAVFLVIIARLKIDGSFSSGEWISGTNGAAAVLSFGGVIFGFASG 262

Query: 293 WTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSN 352
           WTTYAADYTVYMPR+TNK  +FF++  GL  PL F++ILGAA+AM + NN ++   + S 
Sbjct: 263 WTTYAADYTVYMPRTTNKPKVFFAVIFGLMFPLCFSIILGAAAAMASKNNSEYARLHDSG 322

Query: 353 GMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAW 412
           G+GG+ YAILV +SLHGFGQFCCVLLAMSTVANNIPNMY+IAL  QAL++P +K+PRV W
Sbjct: 323 GVGGLIYAILVNNSLHGFGQFCCVLLAMSTVANNIPNMYSIALGTQALWEPLAKIPRVFW 382

Query: 413 TMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRK-GFQGYNVED 471
           TMAGN  TL I+I A Y F  FM NFM++I YYL+IYI ISLSEH  +RK  F+ YNV+D
Sbjct: 383 TMAGNLVTLAIAIPAYYKFNSFMTNFMDAIAYYLSIYIGISLSEHLFFRKMNFRNYNVDD 442

Query: 472 WNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIV 531
           WN W KLPIG AG  AL VGA GVA+GM Q+YW G+I + IGD+G DIGFE+G  ++ IV
Sbjct: 443 WNKWDKLPIGYAGCCALFVGAVGVAVGMEQTYWTGQIARKIGDYGADIGFEIGFCFSVIV 502

Query: 532 YNVLRPLEIKYTGR 545
           YN+LRPLE+KY GR
Sbjct: 503 YNILRPLELKYVGR 516

>KLLA0C08283g complement(725563..727122) similar to sp|P17064
           Saccharomyces cerevisiae YER056c FCY2 purine-cytosine
           permease, start by similarity
          Length = 519

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/496 (61%), Positives = 375/496 (75%), Gaps = 5/496 (1%)

Query: 55  EYESIQEPETYMEET----KLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINAASMWFS 110
           +++ + E E  + ET    KLS+ +   + L+AETKG+EP+TD+EK DD I+NAASMW S
Sbjct: 24  QFDEVLEEEPVIVETTEVTKLSWVDHLASKLHAETKGIEPITDDEKDDDDILNAASMWLS 83

Query: 111 ANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRY 170
           ANLVIA+++LG +G  VF LNFG +VLVI+FF+ LGLL +AFFSVFGAE GLRQ++LSR+
Sbjct: 84  ANLVIAAFSLGCIGTSVFGLNFGEAVLVIVFFSFLGLLPVAFFSVFGAELGLRQLVLSRF 143

Query: 171 LLGNXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMVNTPN-NCPLWAGCLIIVGCTVLVT 229
           LLGN             CVGWG VNT+AS+ LL++VN    +CP WAGCLII+  T++VT
Sbjct: 144 LLGNVTARIFCFINIIACVGWGAVNTIASASLLHIVNPSGPDCPPWAGCLIIIFGTIIVT 203

Query: 230 FFGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXXX 289
           FFGY VIHAYEKWSWVPNFAVFLVIIARL  +G FT G W SG TTAG VLS        
Sbjct: 204 FFGYRVIHAYEKWSWVPNFAVFLVIIARLAKAGTFTAGSWGSGSTTAGGVLSFGSSVFGF 263

Query: 290 XXXWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYY 349
              WTTYA+DYTVYMPR+TNK  +F ++  GL+ PL F+MILGAA+  G   N  W   Y
Sbjct: 264 ATGWTTYASDYTVYMPRTTNKKKVFAAIVLGLAFPLCFSMILGAAAVTGTRTNERWAELY 323

Query: 350 KSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPR 409
               +GG+ YAIL+ DSL GFG FCCV+LA+ST++NNIPNMY+IAL  QAL++P +KVPR
Sbjct: 324 DKYSVGGLCYAILIEDSLWGFGSFCCVVLALSTISNNIPNMYSIALGTQALFEPLAKVPR 383

Query: 410 VAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQGYNV 469
           VAWT+ GN  TL I+I A Y F+ FM  FM+SIGYYLAIY AI+LSEHFIYR GF+GYNV
Sbjct: 384 VAWTIIGNLVTLAIAIPAYYKFETFMTTFMDSIGYYLAIYSAIALSEHFIYRGGFKGYNV 443

Query: 470 EDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAF 529
           +DW+ W KLPIG AGT AL +GAFGVA GM+Q YW G+IG+LIG++GGDIGFELGA +AF
Sbjct: 444 DDWDRWDKLPIGYAGTFALFIGAFGVAFGMNQIYWQGQIGRLIGENGGDIGFELGAGFAF 503

Query: 530 IVYNVLRPLEIKYTGR 545
           I YN+ RPLE KY GR
Sbjct: 504 ITYNIFRPLEKKYVGR 519

>Scas_715.47d1
          Length = 523

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/528 (54%), Positives = 374/528 (70%), Gaps = 15/528 (2%)

Query: 20  RNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVA 79
           + TDLE++         + A  A+  +       D++      E     + ++F  +   
Sbjct: 9   KTTDLEKQ---------DPAFVANEAISNDTTGEDDFSKTVSSEA----SNIAFLQKIAT 55

Query: 80  SLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVI 139
            LNAET+G+EPV D+EKTD +I N   +WFSAN VI++YA+G LGP+VF LNFG + L I
Sbjct: 56  RLNAETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTI 115

Query: 140 IFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVAS 199
           +FFNI+G++ +A+FS+FG E GLRQM+LSRYL+GN             CVGW V+N++ S
Sbjct: 116 VFFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICS 175

Query: 200 SQLLNMVNTP-NNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARL 258
           +QLLNMVN   + CP WAG +++V  T+LVTFFG  VI A+E+WSWVPN AVFLVIIARL
Sbjct: 176 AQLLNMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVIIARL 235

Query: 259 KMSGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIFFSLT 318
             SG F+GG+WTSGPTTAGNVLS           W TY+ADYTVYMPR+TNK  +FF L 
Sbjct: 236 HKSGQFSGGKWTSGPTTAGNVLSLGCVAYGYAGAWATYSADYTVYMPRNTNKVKLFFGLC 295

Query: 319 AGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLL 378
             L++PL FTMILGAA  MG VNN  W  YY SNG+GG+TY +LVP+S+HGFG+FCCVLL
Sbjct: 296 VALTVPLCFTMILGAAVGMGGVNNATWAKYYSSNGIGGLTYEVLVPNSVHGFGEFCCVLL 355

Query: 379 AMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENF 438
           A+ST+ANN PNMYT+  S QA+++P ++VPR   T+ GNA    +   ACYYF  FME F
Sbjct: 356 ALSTIANNTPNMYTLGFSFQAIWEPLARVPRAFCTLFGNAAVFVVGCCACYYFDSFMEKF 415

Query: 439 MNSIGYYLAIYIAISLSEHFIYRK-GFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVAL 497
           M+++ YY AIYI++ ++EH I+RK  F+ Y+V+DW T+SKLPIGIAG     V AFGVAL
Sbjct: 416 MDTLAYYGAIYISLGMAEHLIFRKCSFKAYDVKDWKTFSKLPIGIAGGVGFFVAAFGVAL 475

Query: 498 GMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           GM QSYWVGEIG+ IG  GGD+GFE+GA+W FI Y ++RPLE+KY GR
Sbjct: 476 GMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRPLELKYFGR 523

>CAGL0C00231g 15916..17538 similar to sp|P40039 Saccharomyces
           cerevisiae YER060w or sp|P17064 Saccharomyces cerevisiae
           YER056c, hypothetical start
          Length = 540

 Score =  582 bits (1500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/506 (57%), Positives = 370/506 (73%), Gaps = 4/506 (0%)

Query: 43  DIKVIPGVPDYDEYESIQEPETYMEET--KLSFFNRFVASLNAETKGVEPVTDEEKTDDS 100
           ++K I     ++E ++ +  ET  +ET  K  F      +LNAETKGVEP+ + EK D +
Sbjct: 36  ELKDITFKEKFNELDN-KSTETDKDETCFKSPFIIWLKRTLNAETKGVEPINENEKNDTN 94

Query: 101 IINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEF 160
           I  ++ +WFSANLV+A+Y +G LGP V++LNF  SVL I+FFNILGL+S++FFSVFGAE 
Sbjct: 95  IFGSSFVWFSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFNILGLVSVSFFSVFGAEL 154

Query: 161 GLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMVNTP-NNCPLWAGCL 219
           GLRQMI+SRYL+GN             CVGW V+N   +++L  ++ T  N+ PLW GC+
Sbjct: 155 GLRQMIISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLFAIIKTGGNHLPLWGGCI 214

Query: 220 IIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGEWTSGPTTAGNV 279
           +IVG TV +   GY  IH YEKWSW+PN AVFL+II+R+K+S  F+ G WTSG TTAGNV
Sbjct: 215 VIVGSTVFIAALGYKFIHIYEKWSWIPNLAVFLIIISRIKISREFSNGPWTSGSTTAGNV 274

Query: 280 LSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGA 339
           LS           W TY+ADYTVYMPR TNK+ IFF  + GL+  L FTMI+GAA+ + A
Sbjct: 275 LSFGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFFNSIGLAFSLIFTMIVGAAAGICA 334

Query: 340 VNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQA 399
           VNN  WM  Y    +GGVTYA+LVP+SLHGFG+FCCV+LAMSTVANN+P+MYTIALSVQA
Sbjct: 335 VNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCVILAMSTVANNVPSMYTIALSVQA 394

Query: 400 LYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFI 459
           L++P + VPR  WT+  N   LGISI ACY+FQ FM+NFM SIGY+ A+YI ISL+EH +
Sbjct: 395 LWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQNFMGSIGYFYALYIGISLAEHCV 454

Query: 460 YRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDI 519
           +R+ F  YNV D + W KLPIG AG  ALIVG+FGVALGM+Q+YWVGEI + IG +GGDI
Sbjct: 455 FRRKFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVALGMAQTYWVGEIARKIGTYGGDI 514

Query: 520 GFELGASWAFIVYNVLRPLEIKYTGR 545
           GFELG SWAF+ Y ++RP+EIKY GR
Sbjct: 515 GFELGMSWAFLTYIIIRPIEIKYYGR 540

>Kwal_34.15730
          Length = 518

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/517 (56%), Positives = 374/517 (72%), Gaps = 12/517 (2%)

Query: 31  EMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVASLNAETKGVEP 90
           E+N + ++ +SAD        D     S Q PE  +    ++  NR    L AETKG+EP
Sbjct: 12  ELNVYSQENTSAD--------DATRGSS-QAPEK-LNGGGMAVLNRLAKKLRAETKGIEP 61

Query: 91  VTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSI 150
           VT++EK D SI NAA +WFSAN+VIA++++G LGP+VF+LNF   V+ I+ F  +G+L +
Sbjct: 62  VTEDEKDDSSIWNAAFVWFSANMVIAAFSVGMLGPLVFSLNFWGCVVSIVIFTFIGVLPV 121

Query: 151 AFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMVN-TP 209
             +SVFG +  LRQM+LSR+LLGN             C+GWGVVNTV S+QLL+M+N T 
Sbjct: 122 CLYSVFGVQLSLRQMVLSRFLLGNVTARIFALINVIACIGWGVVNTVTSAQLLHMINPTG 181

Query: 210 NNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGEW 269
             CP WAGCLIIV  T+ VTFFGY VIH + K+SW+PNF VF+VIIARLK+ G+F+ G+W
Sbjct: 182 GRCPPWAGCLIIVFSTIFVTFFGYRVIHTFGKYSWIPNFIVFIVIIARLKIDGSFSVGKW 241

Query: 270 TSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTM 329
            SG TTAG++LS           WTTYAAD+TVYMPR+ N+  +FF++  GL  PL FT+
Sbjct: 242 ESGSTTAGSILSLGGIVFGFATGWTTYAADFTVYMPRTVNRAEVFFAVMLGLVFPLCFTI 301

Query: 330 ILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPN 389
           ILGAA+   A+NNP +  +Y+S+  GG+ YAILVP SLHGFGQFCCVLLAMSTVAN +PN
Sbjct: 302 ILGAAAGCAALNNPVYHEFYESDHAGGLVYAILVPRSLHGFGQFCCVLLAMSTVANMVPN 361

Query: 390 MYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIY 449
           MY+IAL  QAL++P +KVPRV WT+AGN  TL I+I A Y F+ FM NFM+SI YYL+IY
Sbjct: 362 MYSIALGTQALWEPLAKVPRVFWTLAGNLITLAIAIPAYYRFEAFMTNFMDSIAYYLSIY 421

Query: 450 IAISLSEHFIYRKG-FQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEI 508
           I +SLSEHFI+R+  F  Y+  +WN W +LP+G AG +AL VGA GVALGM Q+YW GEI
Sbjct: 422 IGVSLSEHFIFRQNKFSNYDTSEWNDWHRLPLGYAGCAALFVGAIGVALGMHQTYWTGEI 481

Query: 509 GKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           G+LIG+ GGDIGFELG +++ IVY  LRPLEIK+ GR
Sbjct: 482 GRLIGEFGGDIGFELGLAFSMIVYTALRPLEIKFVGR 518

>ADL074W [1667] [Homologous to ScYER056C (FCY2) - SH]
           complement(551981..553555) [1575 bp, 524 aa]
          Length = 524

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/520 (56%), Positives = 366/520 (70%), Gaps = 7/520 (1%)

Query: 28  TGYEMNSFGEKASSADIKVIPG-VPDYDEYESIQEPETYMEETKLSFFNRFVASLNAETK 86
           T   M+   +  S  D++   G + D +E  + Q  ET  E T LS+ NR+ A LNAETK
Sbjct: 10  TRSSMSLTKDDGSYGDLEKKKGFLSDAEEPVTPQVDET--EYTTLSWVNRWAARLNAETK 67

Query: 87  GVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILG 146
           GV PVT++E  D S++NAASMWFSANLVIA++A+G L   VF LN   +VL  + F+ +G
Sbjct: 68  GVSPVTEDECHDSSLLNAASMWFSANLVIAAFAVGVLSTAVFRLNMLEAVLATVVFSFMG 127

Query: 147 LLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMV 206
           +L++AFFSVFGAEFGLRQMILSRYL+GN             CVGW  VNT+AS+ LL+M+
Sbjct: 128 VLAVAFFSVFGAEFGLRQMILSRYLMGNTTARIFCLINVIACVGWSSVNTIASTTLLHMI 187

Query: 207 N-TPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFT 265
           N T   CP WA  LIIV  TV +TFFGY VIHAYEKWSWVPN  VFL+IIARL ++G FT
Sbjct: 188 NPTGARCPPWAASLIIVLSTVFITFFGYRVIHAYEKWSWVPNLVVFLIIIARLAIAGNFT 247

Query: 266 GGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPL 325
            G    G  TAG+ LS           WTTYAADYTVYMP+++NKY IFF + AGL+ PL
Sbjct: 248 AGSSLGGKATAGSFLSYGSVVFGFASGWTTYAADYTVYMPKNSNKYRIFFFMIAGLATPL 307

Query: 326 FFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVAN 385
            FT+ILGAA+      NP W  YYK + +GG+ +AIL  ++L GFGQFCCV+LAMSTVAN
Sbjct: 308 LFTLILGAAAGRCVHTNPTWGEYYKKHSVGGLCFAILAENALGGFGQFCCVVLAMSTVAN 367

Query: 386 NIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYY 445
           NIPNMY+IALS QAL+  F++VPRV WT+ GNA +L I+I A Y F+ FM +FM+SIGYY
Sbjct: 368 NIPNMYSIALSTQALWSRFARVPRVFWTLVGNACSLVIAIVAYYKFETFMTSFMDSIGYY 427

Query: 446 LAIYIAISLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWV 505
           L+IYI I ++EHF++RKGF+GY+V  W+    LP G AG +AL VGA GVA+GMS  Y+ 
Sbjct: 428 LSIYIVICVTEHFVFRKGFRGYDVSHWDRPDLLPAGYAGCAALCVGAVGVAMGMSHEYYT 487

Query: 506 GEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           G I KL    GGDIGF L A ++FIVY   RPLE+KYTGR
Sbjct: 488 GPIAKL---AGGDIGFLLAAGFSFIVYICCRPLELKYTGR 524

>Scas_715.54d
          Length = 232

 Score =  223 bits (568), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 112/236 (47%), Positives = 154/236 (65%), Gaps = 14/236 (5%)

Query: 20  RNTDLERETGYEMNSFGEKASSADIKVIPGVPDYDEYESIQEPETYMEETKLSFFNRFVA 79
           + TDLE++         + A  A+  +       D++      E     + ++F  +   
Sbjct: 10  KTTDLEKQ---------DPAFVANEAISNDTTSEDDFSKTVSSEA----SNIAFLQKIAT 56

Query: 80  SLNAETKGVEPVTDEEKTDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLVI 139
            LNAET+G+EPV D+EKTD +I N   +WFSAN VI++YA+G LGP+VF LNFG + L I
Sbjct: 57  RLNAETRGIEPVRDDEKTDANIWNPCMLWFSANFVISAYAVGALGPMVFGLNFGITSLTI 116

Query: 140 IFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVAS 199
           +FFNI+G++ +A+FS+FG E GLRQM+LSRYL+GN             CVGW V+N++ S
Sbjct: 117 VFFNIIGVVPVAYFSLFGPELGLRQMVLSRYLVGNIVGRFFSFINCIACVGWCVLNSICS 176

Query: 200 SQLLNMVNTP-NNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVI 254
           +QLLNMVN   + CP WAG +++V  T+LVTFFG  VI A+E+WSWVPN AVFLVI
Sbjct: 177 AQLLNMVNLHGHRCPFWAGIMVVVLGTILVTFFGIKVITAFERWSWVPNLAVFLVI 232

>Kwal_47.17216
          Length = 542

 Score =  219 bits (557), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 151/515 (29%), Positives = 238/515 (46%), Gaps = 43/515 (8%)

Query: 70  KLSFFNRFVASLNAETKGVEPVTDEEK-TDDSIINAASMWFSANLVIASYALGGLGPIVF 128
           KLS  ++ + +L  E +G++ +   E+ T    ++ A +W SA   ++S +   LGP++F
Sbjct: 32  KLSVASKRLDALGVEIRGIQRIPAYERGTSKQFLSVAGLWLSAAGGLSSMSSYFLGPLLF 91

Query: 129 NLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXC 188
            L F  S++  +    +G    A+ S  G + G RQM+ +RYL G               
Sbjct: 92  ELTFRQSLVSGLVSMAIGCAVAAYLSTMGPQSGCRQMVTARYLFGWYFVKFVSLASIIGV 151

Query: 189 VGWGVVNTVASSQLLNMVNTPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNF 248
           +GW +VN V   Q+L  ++  +  PLW G +I+   + +V  FG   +   E +  VP  
Sbjct: 152 MGWSIVNCVVGGQMLAAISN-SKIPLWVGIIIVTAVSFIVAIFGIKQVLRVETFLSVPVL 210

Query: 249 AVFLVI-IA---RLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYM 304
             FL++ IA   +  +   F   +     T  GN LS           W +  ADY +  
Sbjct: 211 TCFLLLYIAASDKYYLLDTFKNDD-IDPLTIKGNWLSFFSLCYSITSTWGSITADYYILF 269

Query: 305 PRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVP 364
           P  T  Y +F     G  +P  F  +LG   A  A +   W   Y   GMGG+ ++    
Sbjct: 270 PEDTAHYKVFLLTFFGTLIPTTFVGVLGLILASCAASYEPWKAAYHKYGMGGLLFSGF-- 327

Query: 365 DSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGIS 424
           +  +GFG+FC V+L  S ++NNI N Y+ A ++Q      ++VPR  W +A   F L  +
Sbjct: 328 ERWNGFGKFCVVVLIFSLISNNIINTYSAAFNIQLSSVHMARVPRWLWAIACTIFYLVCA 387

Query: 425 IAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQ------------------- 465
           +    +F   + NF+  IGY++++Y  I L E+ I+R  F+                   
Sbjct: 388 LVGRNHFSEILGNFLPMIGYWISMYFIILLEENLIFRSHFRHLYTEEFPPHPVEEGESPR 447

Query: 466 ---------------GYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEIGK 510
                           YN E WN    L  G A T A +VG  GVAL M+Q+YW+G I +
Sbjct: 448 ALRDIKNKKVSSRKHAYNWEMWNNAEVLTHGYAATFAFLVGVGGVALSMAQAYWIGPIAR 507

Query: 511 LIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
             GD GGD+G  +   ++  VY  LR  E+++ GR
Sbjct: 508 HFGDFGGDLGMWVSMGFSGTVYPALRYWELRHYGR 542

>KLLA0D05060g 436335..437906 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, hypothetical start
          Length = 523

 Score =  199 bits (506), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 146/524 (27%), Positives = 237/524 (45%), Gaps = 36/524 (6%)

Query: 54  DEYESIQEPETYMEETKLSFFNRFVASLNAETKGVEPVTDEEK-TDDSIINAASMWFSAN 112
            E E  +        + +  F+  + +L  E +G++ +   E+ T     + A +W SA 
Sbjct: 4   SEVEVTERSIFVRSASSIRQFSDKLDALGVEARGIQRIQPYERGTAKQFWHVAGLWLSAA 63

Query: 113 LVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLL 172
             ++S +   LGP+VF L F   ++  +    +G    A+ SV G + G RQ++ +RYL 
Sbjct: 64  GGLSSMSSYFLGPMVFQLTFNQCLVSGLISMWIGCGVAAYCSVMGPQSGCRQIVTARYLF 123

Query: 173 GNXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMVNTPNNCPLWAGCLIIVGCTVLVTFFG 232
           G               +GW +VN V   Q+L  V +    PLW G +I+   ++LV+ FG
Sbjct: 124 GWWFVKFIALAAIVGVMGWSIVNCVVGGQMLASV-SDGKVPLWVGIIIVTVVSLLVSIFG 182

Query: 233 YNVIHAYEKWSWVPNFAVFLVIIA----RLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXX 288
              +   E    VP    FL++      + K    F+  +  S  T  G  LS       
Sbjct: 183 IKQVLKVETLFAVPVLTSFLLLYISASDKFKYLYEFSNSDIDS-LTVKGCWLSFFSLCYS 241

Query: 289 XXXXWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNY 348
               W +  ADY +  P  T +  +F     G ++P  F  +LG   A  +++   W   
Sbjct: 242 ITSTWGSITADYYILFPEDTPQIQVFLLTFFGTAVPTTFVGVLGLLLASCSLSYEPWQAA 301

Query: 349 YKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVP 408
           Y   GMGG+  A       +GFG+F  V+L +S ++NNI N Y+ A S+Q      +KVP
Sbjct: 302 YDEYGMGGLMNAGF--SRWNGFGKFLVVVLILSLISNNIVNTYSAAFSIQLSSVMLAKVP 359

Query: 409 RVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQG-- 466
           R  W +    F L  ++     F   + NF+  IGY++++Y  + + E+ I+R  F    
Sbjct: 360 RWIWAIGCTIFYLVCALVGRNSFSTILGNFLPMIGYWISMYFILLVEENVIFRNWFHHLY 419

Query: 467 -------------------------YNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQ 501
                                    YN ++W+    +  G+A ++A  +G  GV LGM Q
Sbjct: 420 KLEFPNDIEVKPHHKLRKLPRHIHRYNWDEWDNSEVITRGLAASAAFCIGVAGVVLGMCQ 479

Query: 502 SYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           +Y+VG +   IG++GGD+G  LG  +A + Y  LR  E+K  GR
Sbjct: 480 TYYVGPLAAKIGEYGGDLGMWLGMGFAGVSYPPLRYCELKKFGR 523

>YGL186C (TPN1) [1806] chr7 complement(151041..152780) Member of the
           purine/cytosine permease family of membrane transporters
           [1740 bp, 579 aa]
          Length = 579

 Score =  178 bits (452), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 147/528 (27%), Positives = 240/528 (45%), Gaps = 55/528 (10%)

Query: 70  KLSFFNRFVASLNAETKGVEPVTDEEK--TDDSIINAASMWFSANLVIASYALGGLGPIV 127
           + ++ ++ V ++  E+ G++ ++  E+  +    ++ A +W SA   ++S +   LGP++
Sbjct: 55  RAAWLSKKVDAMGVESTGIQRISPYERGTSKKQFLHVAGLWLSATGGLSSMSSFLLGPLL 114

Query: 128 FNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXX 187
           F L+F  SV   +    +G L  A+ S+ G + G RQM+ +RYL G              
Sbjct: 115 FGLSFRESVASSLISVTIGCLIAAYCSIMGPQSGCRQMVTARYLFGWWFVKLVALASIIG 174

Query: 188 CVGWGVVNTVASSQLLNMVNTPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPN 247
            +GW VVN+V   ++L  ++  +  PLW G +I+  C+ LV  FG   +   E +  VP 
Sbjct: 175 VMGWSVVNSVVGGEMLAAISN-DKVPLWVGIVIVTVCSFLVAIFGIKQVIKVETYLSVPV 233

Query: 248 FAVFLVIIARLKMSGAFTGGEWTSG----PTTAGNVLSXXXXXXXXXXXWTTYAADYTVY 303
              FL++        +F     + G     T  GN +S           W +  ADY + 
Sbjct: 234 LTAFLLLYISSSDKYSFVNAYVSKGNLDSSTRKGNWMSFFSLCYSITATWGSITADYYIL 293

Query: 304 MPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILV 363
            P  T    IF     G  LP  F  ILG   A  A++   W   Y S+GMGG+ +A   
Sbjct: 294 FPEDTPYIQIFCLTFFGTFLPTCFVGILGLLLASVAMSYKPWSVEYDSHGMGGLLWAGF- 352

Query: 364 PDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGI 423
               +GFG+FC V+L  S V+NNI N Y+ A S+Q      +K+PR  W++      L  
Sbjct: 353 -QRWNGFGKFCVVVLVFSLVSNNIINTYSAAFSIQLSSVFCAKIPRWFWSIVCTIICLVC 411

Query: 424 SIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGF------------------- 464
           ++    +F   + NF+  IGY++++Y  +   E+ ++R+ F                   
Sbjct: 412 ALIGRNHFSTILGNFLPMIGYWISMYFILLFEENLVFRRFFLHLYTKEFPTVTGEINGPE 471

Query: 465 ---------------------------QGYNVEDWNTWSKLPIGIAGTSALIVGAFGVAL 497
                                        YN + W  +  L  G A T A IVG  GV +
Sbjct: 472 LVGSSKEVEKDAVTNIHLLKRKHKVTKHRYNWDKWEDYEVLTHGYAATFAFIVGVAGVVV 531

Query: 498 GMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           GM+Q+YW+G I    G++GGD+   L  +++ +VY   R LE++  GR
Sbjct: 532 GMAQAYWIGPIAAKFGEYGGDVAMWLSMAFSGVVYPPCRYLELRKFGR 579

>CAGL0L06138g 695566..697461 similar to sp|P53099 Saccharomyces
           cerevisiae YGL186c, start by similarity
          Length = 631

 Score =  160 bits (404), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 110/390 (28%), Positives = 183/390 (46%), Gaps = 9/390 (2%)

Query: 80  SLNAETKGVEPVTDEEK-TDDSIINAASMWFSANLVIASYALGGLGPIVFNLNFGTSVLV 138
           S   ET G+E V   E+ T    ++ A +W SA   ++S +   LGP++F L+F  ++  
Sbjct: 86  SFGVETSGIERVPPYERGTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTS 145

Query: 139 IIFFNILGLLSIAFFSVFGAEFGLRQMILSRYLLGNXXXXXXXXXXXXXCVGWGVVNTVA 198
            +    +G L  A+ S+ G + G RQM+ +RYL G               +GW V N+V 
Sbjct: 146 SMISVTVGCLVAAYCSIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVV 205

Query: 199 SSQLLNMVNTPNNCPLWAGCLIIVGCTVLVTFFGYNVIHAYEKWSWVPNFAVFLVIIA-- 256
             ++L  ++  +  PLW G +I+  C+ +V  FG   +   E +  VP    FL++    
Sbjct: 206 GGEMLAAISN-DRVPLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLLYISS 264

Query: 257 --RLKMSGAFTGGEWTSGPTTAGNVLSXXXXXXXXXXXWTTYAADYTVYMPRSTNKYTIF 314
             R  +   +   +     T  GN +S           W +  ADY +  P  T  Y +F
Sbjct: 265 GNRDYLVREYKPID-VPSKTIKGNWISFFSLCYSITSTWGSITADYYILFPEDTPHYQVF 323

Query: 315 FSLTAGLSLPLFFTMILGAASAMGAVNNPDWMNYYKSNGMGGVTYAILVPDSLHGFGQFC 374
               AG  +P  F  ILG   A  A +   +   Y ++GMGG+ +A       +GFG+F 
Sbjct: 324 LLTLAGTLIPTTFVGILGLTLASIAKSYQPYGEEYDTHGMGGLLWAGF--SRWNGFGKFL 381

Query: 375 CVLLAMSTVANNIPNMYTIALSVQALYQPFSKVPRVAWTMAGNAFTLGISIAACYYFQGF 434
            V+L +S ++NNI N Y+ A  +Q      ++VPR  W +      L  ++    +F   
Sbjct: 382 VVVLILSLISNNIINTYSAAFGIQLSAVWAARVPRWFWCIVCTIVYLVCALVGRNHFATI 441

Query: 435 MENFMNSIGYYLAIYIAISLSEHFIYRKGF 464
           + NF+  IGY++++Y  +   E+ I+R+ F
Sbjct: 442 LGNFLPMIGYWISMYFILLFEENVIFRRYF 471

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 3/94 (3%)

Query: 453 SLSEHFIYRKGFQGYNVEDWNTWSKLPIGIAGTSALIVGAFGVALGMSQSYWVGEIG-KL 511
           +L    I+ K    YN ++W+    L  G A T A + G  GV +GM+Q+YWVG I  KL
Sbjct: 540 TLKRKHIHTK--HRYNWDEWDNPDVLTHGYAATFAFLCGVAGVVVGMAQTYWVGPIARKL 597

Query: 512 IGDHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
            G +GGDI   L   ++ IVY  LR  E+   GR
Sbjct: 598 GGPYGGDIAMWLSMGFSGIVYPWLRYWELVRYGR 631

>Scas_710.30
          Length = 584

 Score =  158 bits (400), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 116/418 (27%), Positives = 199/418 (47%), Gaps = 10/418 (2%)

Query: 55  EYESIQEPETYMEE--TKLSFFNRFVASLNAETKGVEPVTDEEK--TDDSIINAASMWFS 110
           E+ ++++  +Y+       +  ++ + SL  E  G+E ++  E+       I+ A  W +
Sbjct: 15  EFTTVKKSPSYLRRLLHTANLLSKKLDSLGVEATGIERISPYERGSKRKQFIHVAGYWLA 74

Query: 111 ANLVIASYALGGLGPIVFNLNFGTSVLVIIFFNILGLLSIAFFSVFGAEFGLRQMILSRY 170
           A   ++S +   LGP++F L F  S++  I    +G L  A+ S+ G + G RQM+ +RY
Sbjct: 75  ATGSLSSMSSFLLGPLLFGLTFNESMVSGIVSMAIGCLVAAYCSIMGPQSGCRQMVTARY 134

Query: 171 LLGNXXXXXXXXXXXXXCVGWGVVNTVASSQLLNMVNTPNNCPLWAGCLIIVGCTVLVTF 230
           L G               +GW VVN+V   ++L  ++  +  PLW G LI+   + LV  
Sbjct: 135 LFGWWFVKFVALAAIIGVMGWSVVNSVVGGEMLASISN-DKVPLWVGVLIVTLFSFLVAV 193

Query: 231 FGYNVIHAYEKWSWVPNFAVFLVIIARLKMSGAFTGGEWTSGP---TTAGNVLSXXXXXX 287
           FG   +   E +  +P + +F+++         +     +  P   T  GN LS      
Sbjct: 194 FGIKQVLKVETYLSIPVWLMFILLYISSSDKYHYIDDFKSPIPDRLTLKGNWLSFFSLCY 253

Query: 288 XXXXXWTTYAADYTVYMPRSTNKYTIFFSLTAGLSLPLFFTMILGAASAMGAVNNPDWMN 347
                W +  ADY +  P  T+K+ +F     G  +P  F  +LG   +  A     W +
Sbjct: 254 SITATWGSITADYYILFPEDTSKFQVFMLTFLGTVVPTLFVGVLGLCLSTVAATYEPWND 313

Query: 348 YYKSNGMGGVTYAILVPDSLHGFGQFCCVLLAMSTVANNIPNMYTIALSVQALYQPFSKV 407
            Y   GMGG+ +A       +GFG+FC V+L +S ++NNI N Y+ A SVQ      +KV
Sbjct: 314 DYNKYGMGGLLHAGF--KRWNGFGKFCVVVLLLSLISNNIINTYSAAFSVQLASVKAAKV 371

Query: 408 PRVAWTMAGNAFTLGISIAACYYFQGFMENFMNSIGYYLAIYIAISLSEHFIYRKGFQ 465
           PR  W++      L  ++    +F   + NF+  IGY++++Y  + L E+ I+R+ F 
Sbjct: 372 PRWFWSIVCMIICLVCALVGRNHFSTILGNFLPMIGYWISMYFILLLEENVIFREYFH 429

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 50/92 (54%), Gaps = 3/92 (3%)

Query: 457 HFIYRKGFQGYNVEDWNTWSK---LPIGIAGTSALIVGAFGVALGMSQSYWVGEIGKLIG 513
           H + R+     +  +WN W     L  G A T A + G  GV +GM+Q+YW+G + +  G
Sbjct: 493 HLLKRRHLATSHKYNWNKWDDPEVLTHGYAATFAFLCGVAGVVVGMAQAYWIGPLARKFG 552

Query: 514 DHGGDIGFELGASWAFIVYNVLRPLEIKYTGR 545
           + GGDI   L  +++ +VY  LR  E++  GR
Sbjct: 553 ETGGDIAMWLSMAFSGLVYPPLRYWELRRYGR 584

>Scas_701.1
          Length = 68

 Score = 99.0 bits (245), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 54/68 (79%)

Query: 478 LPIGIAGTSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRP 537
           LPIGIAG     V AFGVALGM QSYWVGEIG+ IG  GGD+GFE+GA+W FI Y ++RP
Sbjct: 1   LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 60

Query: 538 LEIKYTGR 545
           LE+KY GR
Sbjct: 61  LELKYFGR 68

>Scas_690.1*
          Length = 636

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 54/68 (79%)

Query: 478 LPIGIAGTSALIVGAFGVALGMSQSYWVGEIGKLIGDHGGDIGFELGASWAFIVYNVLRP 537
           LPIGIAG     V AFGVALGM QSYWVGEIG+ IG  GGD+GFE+GA+W FI Y ++RP
Sbjct: 569 LPIGIAGGVGFFVAAFGVALGMCQSYWVGEIGRRIGKDGGDVGFEMGAAWGFIAYVLVRP 628

Query: 538 LEIKYTGR 545
           LE+KY GR
Sbjct: 629 LELKYFGR 636

>KLLA0C14135g complement(1221902..1222717) similar to sp|P53335
           Saccharomyces cerevisiae YGR280c singleton, start by
           similarity
          Length = 271

 Score = 33.1 bits (74), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 13/72 (18%)

Query: 67  EETKLSFFNRFVASLNAETKGVEPVTDEEKTDDSIINA------------ASMWFSANLV 114
           E T L  F R +  LN   + +    D+++T D+IIN             AS W + N  
Sbjct: 83  ECTGLDVFQRLLGRLNGNEQTISDELDKQRT-DNIINGKWGIHFVKGEVLASTWDAENKQ 141

Query: 115 IASYALGGLGPI 126
           + SY++G   P+
Sbjct: 142 LISYSMGKKRPV 153

>Kwal_47.19203
          Length = 235

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 38/83 (45%), Gaps = 12/83 (14%)

Query: 295 TYAADYTVYMPRSTNKYTIFFSLTAGLSLPL-----FFTMILGAASAMGAVNNPDWMNYY 349
           TY     ++   S N+ TI + +   L+LP+     F+ ++L        V  P++ +Y+
Sbjct: 155 TYCHWCKLFKSPSKNRNTILWKIDTFLTLPILYLSEFYLLLLN-------VQTPNFHSYH 207

Query: 350 KSNGMGGVTYAILVPDSLHGFGQ 372
               +  V   I +P SLH F +
Sbjct: 208 WLEIVNKVVLIIFIPISLHAFRK 230

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.323    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,784,368
Number of extensions: 688302
Number of successful extensions: 1722
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1715
Number of HSP's successfully gapped: 39
Length of query: 545
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 438
Effective length of database: 12,891,983
Effective search space: 5646688554
Effective search space used: 5646688554
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)