Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.3544844821440.0
CAGL0M12342g4572247734e-98
Kwal_23.58074652047195e-90
YER059W (PCL6)4202477121e-89
ADL075W2072036756e-87
KLLA0C08305g4092146745e-84
YIL050W (PCL7)2852406364e-80
Scas_715.513412115536e-67
KLLA0D01287g3451571742e-13
ACR001C3461541723e-13
CAGL0E02541g3421201635e-12
Sklu_2373.43071201572e-11
Scas_392.13031201562e-11
Kwal_56.224432801201543e-11
YOL001W (PHO80)2931651492e-10
YGL134W (PCL10)4331401361e-08
YPL219W (PCL8)4921571361e-08
CAGL0E05918g4811601342e-08
Scas_720.474731251333e-08
Scas_706.34511411316e-08
CAGL0H08998g5471461244e-07
Kwal_56.24151480581201e-06
KLLA0B02024g5271171201e-06
AFL115W3861231031e-04
YNL289W (PCL1)279126967e-04
CAGL0E02233g266125760.22
Scas_240.126961740.35
YHR071W (PCL5)22957710.84
Kwal_34.1599623161701.1
Sklu_2426.923361681.8
Scas_646.23238117654.0
YDR515W (SLF1)44796648.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.35
         (448 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.35                                                           830   0.0  
CAGL0M12342g complement(1232642..1234015) weakly similar to sp|P...   302   4e-98
Kwal_23.5807                                                          281   5e-90
YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associat...   278   1e-89
ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W (...   264   6e-87
KLLA0C08305g complement(728996..730225) some similarities with s...   264   5e-84
YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates w...   249   4e-80
Scas_715.51                                                           217   6e-67
KLLA0D01287g 112866..113903 some similarities with sp|P20052 Sac...    72   2e-13
ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH] (357962..3...    71   3e-13
CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces c...    67   5e-12
Sklu_2373.4 YOL001W, Contig c2373 11960-12883                          65   2e-11
Scas_392.1                                                             65   2e-11
Kwal_56.22443                                                          64   3e-11
YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that intera...    62   2e-10
YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associa...    57   1e-08
YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associa...    57   1e-08
CAGL0E05918g complement(585723..587168) some similarities with t...    56   2e-08
Scas_720.47                                                            56   3e-08
Scas_706.3                                                             55   6e-08
CAGL0H08998g 877952..879595 weakly similar to tr|Q08966 Saccharo...    52   4e-07
Kwal_56.24151                                                          51   1e-06
KLLA0B02024g 176585..178168 some similarities with sp|P53124 Sac...    51   1e-06
AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W (...    44   1e-04
YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin ...    42   7e-04
CAGL0E02233g 215697..216497 similar to sp|P24867 Saccharomyces c...    34   0.22 
Scas_240.1                                                             33   0.35 
YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associat...    32   0.84 
Kwal_34.15996                                                          32   1.1  
Sklu_2426.9 YHR071W, Contig c2426 11461-12162                          31   1.8  
Scas_646.23                                                            30   4.0  
YDR515W (SLF1) [1328] chr4 (1473417..1474760) Ribosome-associate...    29   8.0  

>Scas_704.35
          Length = 448

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/448 (92%), Positives = 414/448 (92%)

Query: 1   MQDNTLPLSSSGGMXXXXXXXXXXXXXXXXXXQQHENDTNRVKQRNSASLVSSDVGDTTL 60
           MQDNTLPLSSSGGM                  QQHENDTNRVKQRNSASLVSSDVGDTTL
Sbjct: 1   MQDNTLPLSSSGGMTPKTTVSTTTTPINIPNPQQHENDTNRVKQRNSASLVSSDVGDTTL 60

Query: 61  HSFTEDQTNIISDKIINSYQSTSSIPNDPTAXXXXXXXXXXXXXXXXVISPQLPTKESAA 120
           HSFTEDQTNIISDKIINSYQSTSSIPNDPTA                VISPQLPTKESAA
Sbjct: 61  HSFTEDQTNIISDKIINSYQSTSSIPNDPTADNNNKFSSSFNSNDNNVISPQLPTKESAA 120

Query: 121 SNNTSSVLPKESSYRQTTPITSNSEIVRPTLNQNEYIDIFGNDRTKRNDTYWEDNKEQDA 180
           SNNTSSVLPKESSYRQTTPITSNSEIVRPTLNQNEYIDIFGNDRTKRNDTYWEDNKEQDA
Sbjct: 121 SNNTSSVLPKESSYRQTTPITSNSEIVRPTLNQNEYIDIFGNDRTKRNDTYWEDNKEQDA 180

Query: 181 NISRTEPSPQLSNSKDTTPSNQMDTIDSETNMANKTTEDDNESINIAEFPTNKLLEMLTA 240
           NISRTEPSPQLSNSKDTTPSNQMDTIDSETNMANKTTEDDNESINIAEFPTNKLLEMLTA
Sbjct: 181 NISRTEPSPQLSNSKDTTPSNQMDTIDSETNMANKTTEDDNESINIAEFPTNKLLEMLTA 240

Query: 241 LLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFRGKHVPQISLHQYFQRI 300
           LLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFRGKHVPQISLHQYFQRI
Sbjct: 241 LLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFRGKHVPQISLHQYFQRI 300

Query: 301 QKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAGVTV 360
           QKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAGVTV
Sbjct: 301 QKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAGVTV 360

Query: 361 CTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRYADLLSRFWS 420
           CTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRYADLLSRFWS
Sbjct: 361 CTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRYADLLSRFWS 420

Query: 421 TQPLPEEEDTKVLQDSGSNDTTINNNKS 448
           TQPLPEEEDTKVLQDSGSNDTTINNNKS
Sbjct: 421 TQPLPEEEDTKVLQDSGSNDTTINNNKS 448

>CAGL0M12342g complement(1232642..1234015) weakly similar to
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 457

 Score =  302 bits (773), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 149/224 (66%), Positives = 178/224 (79%), Gaps = 14/224 (6%)

Query: 224 INIAEFPTNKLLEMLTALLDKIVKSNDKLN--------VSSSNSESIDD--ILRSEDNSN 273
           +NIAEFPT+KLLEMLTALL+KI+KSND++             + ES+ D  ++  +    
Sbjct: 236 LNIAEFPTDKLLEMLTALLNKIIKSNDQMEPYKDKDKDEDHDDDESLTDSKLMSVKGTDK 295

Query: 274 NAYVGSILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQG 333
             Y+ SIL+F+GKHVPQI+L+QYFQRIQKYCPTTNDVFLSLLVYFDRISK+CN+S +   
Sbjct: 296 EKYLKSILSFKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESA 355

Query: 334 D-SPTNKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQ 392
           D SP +  QLFVMDSYNIHRL+IAGVTVCTKFFSDFFYSNSRYARVGG+SL ELNHLELQ
Sbjct: 356 DTSPAD--QLFVMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQ 413

Query: 393 FLVLCDFELMIPTEELQRYADLLSRFWSTQPLPE-EEDTKVLQD 435
           FLVLCDFEL+I  ++LQRYA+LL RFW+ Q + +   DT V QD
Sbjct: 414 FLVLCDFELLISVDKLQRYANLLLRFWNNQGVDDSRSDTTVSQD 457

>Kwal_23.5807
          Length = 465

 Score =  281 bits (719), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 156/204 (76%), Gaps = 18/204 (8%)

Query: 222 ESINIAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDIL---RSEDNSNNA--- 275
           E I IA FPT++LL MLTALLDKIVKSND+LN      E  D  L   R+ED  N+    
Sbjct: 259 ELIQIATFPTDRLLSMLTALLDKIVKSNDQLNRDRPFDE--DQFLASARTEDADNDTRPN 316

Query: 276 YVGSILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDS 335
               IL+FRGKHVP I+L QYFQRIQKYCPTTNDVFLSLLVYFDRI+K CN+        
Sbjct: 317 IASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNH-------- 368

Query: 336 PTNKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLV 395
              K QLFVMDSYNIHRLII+ VTV TKFFSDFFYSNSRYARVGG+SL+ELNHLELQFLV
Sbjct: 369 --GKEQLFVMDSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLV 426

Query: 396 LCDFELMIPTEELQRYADLLSRFW 419
           LCDFEL+I  EELQ+Y+DLL  FW
Sbjct: 427 LCDFELIISVEELQKYSDLLRDFW 450

>YER059W (PCL6) [1489] chr5 (272622..273884) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           utilization of alternative carbon and nitrogen sources
           [1263 bp, 420 aa]
          Length = 420

 Score =  278 bits (712), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 144/247 (58%), Positives = 169/247 (68%), Gaps = 51/247 (20%)

Query: 223 SINIAEFPTNKLLEMLTALLDKIVKSNDKLNVSS-SNSESIDD--ILRSEDNSNNAYVGS 279
           S+NIAEFPT+KLL+MLTALL KI+KSND+   ++ S ++ I++   L   DN    Y+  
Sbjct: 161 SLNIAEFPTDKLLKMLTALLTKIIKSNDRTAATNPSLTQEIENGRCLALSDNEKK-YLSP 219

Query: 280 ILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVT------SQG 333
           +L FRGKHVPQI L QYFQRIQKYCPTTNDVFLSLLVYFDRISKRCN+  T      ++ 
Sbjct: 220 VLGFRGKHVPQIGLDQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSVTTTPKTNTAKH 279

Query: 334 DSPTNKS-----------------------------------------QLFVMDSYNIHR 352
           +SP+N+S                                         Q+FVMDS+NIHR
Sbjct: 280 ESPSNESSLDKANRGADKMSACNSNENNENDDSDDENTGVQRDSRAHPQMFVMDSHNIHR 339

Query: 353 LIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRYA 412
           LIIAG+TV TKF SDFFYSNSRY+RVGG+SLQELNHLELQFLVLCDFEL+I   ELQRYA
Sbjct: 340 LIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELLISVNELQRYA 399

Query: 413 DLLSRFW 419
           DLL RFW
Sbjct: 400 DLLYRFW 406

>ADL075W [1666] [Homologous to ScYIL050W (PCL7) - SH; ScYER059W
           (PCL6) - SH] complement(550944..551567) [624 bp, 207 aa]
          Length = 207

 Score =  264 bits (675), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 129/203 (63%), Positives = 149/203 (73%), Gaps = 20/203 (9%)

Query: 224 INIAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAF 283
           ++IA+FPT+KLLEMLT LL KI+KSND+L         I          NN YV  +L+F
Sbjct: 16  MDIAQFPTDKLLEMLTGLLYKIIKSNDRLKPFDQEKHDI----------NNKYVAHVLSF 65

Query: 284 RGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLF 343
           RGKH+P I+L  YF RIQKYCP TNDVFLSLLVYFDRI+KRCN              QLF
Sbjct: 66  RGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCN----------ALDPQLF 115

Query: 344 VMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMI 403
           VMDSYNIHRLIIA VTV TKFFSDFFYSNSRYARVGG+SL+ELN LELQF +LCDFEL++
Sbjct: 116 VMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIV 175

Query: 404 PTEELQRYADLLSRFWSTQPLPE 426
             +ELQRYADLL +FW  + L +
Sbjct: 176 SIQELQRYADLLYKFWHREHLAK 198

>KLLA0C08305g complement(728996..730225) some similarities with
           sp|P40038 Saccharomyces cerevisiae YER059w PCL6 cyclin
           like protein interacting with PHO85P, hypothetical start
          Length = 409

 Score =  264 bits (674), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 134/214 (62%), Positives = 155/214 (72%), Gaps = 21/214 (9%)

Query: 219 DDNESINIAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVG 278
           ++N  ++IA FPT KLL+MLT LL KI+KSND L  S+ N E+           N   + 
Sbjct: 184 NNNHHMDIATFPTYKLLDMLTGLLTKIIKSNDSLG-STPNFET-------SQGKNIPLMR 235

Query: 279 SILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNN-------SVTS 331
            IL+FRGK VP I+L QYFQRIQKYCPTTNDV LSLLV+FDRI+K+CN        SV S
Sbjct: 236 EILSFRGKQVPGITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVS 295

Query: 332 QGDSPT------NKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQE 385
             D  T      +  QLFVMDS+NIHRLIIA +TV TKF SDFFYSNSRYARVGG+SLQE
Sbjct: 296 TPDKTTASLAHQSSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQE 355

Query: 386 LNHLELQFLVLCDFELMIPTEELQRYADLLSRFW 419
           LNHLELQFL+LCDF L+I  EELQRYADLL +FW
Sbjct: 356 LNHLELQFLILCDFRLIISVEELQRYADLLYKFW 389

>YIL050W (PCL7) [2617] chr9 (258912..259769) Cyclin, associates with
           the Pho85p cyclin-dependent kinase, involved in
           utilization of alternate carbon sources [858 bp, 285 aa]
          Length = 285

 Score =  249 bits (636), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 169/240 (70%), Gaps = 18/240 (7%)

Query: 183 SRTEPSPQLSNSKDTTPSNQMDTIDSETNMANKTTEDDNESINIAEFPTNKLLEMLTALL 242
           S  + SP  +  K      +  ++D ETN      + D + +NIA+FPT++L+ M++ALL
Sbjct: 64  SLLDCSPVQAVKKSLESEAKTHSLDEETN-----EQTDVKILNIADFPTDELILMISALL 118

Query: 243 DKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFRGKHVPQISLHQYFQRIQK 302
           ++I+ +ND         E+ D   +  D + +  +  ILAF GK+VP+I++ QY +RIQK
Sbjct: 119 NRIITAND---------ETTDVSQQVSDETEDELLTPILAFYGKNVPEIAVVQYLERIQK 169

Query: 303 YCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAGVTVCT 362
           YCPTTND+FLSLLVYFDRISK   +S    G +     QLFVMDS NIHRL+I GVT+CT
Sbjct: 170 YCPTTNDIFLSLLVYFDRISKNYGHSSERNGCA----KQLFVMDSGNIHRLLITGVTICT 225

Query: 363 KFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRYADLLSRFWSTQ 422
           KF SDFFYSNSRYA+VGG+SLQELNHLELQFL+LCDF+L++  EE+Q+YA+LL +FW+ Q
Sbjct: 226 KFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYKFWNDQ 285

>Scas_715.51
          Length = 341

 Score =  217 bits (553), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 107/211 (50%), Positives = 152/211 (72%), Gaps = 14/211 (6%)

Query: 221 NESINIAEFPTNKLLEMLTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSI 280
           N+ I+I +  T KL++M++ +L+K++KSND+L     N  S++D    +++  +  V SI
Sbjct: 124 NDFIDITKLSTKKLIKMISTILEKLIKSNDELR--ERNETSLNDRTDDDNSDESKLVRSI 181

Query: 281 LAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDS--PTN 338
            +FRGKH+P I L QYF RIQKYCPT N V L++L+YFDRISK  N S  ++ D    T+
Sbjct: 182 KSFRGKHIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTH 241

Query: 339 KSQL----------FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNH 388
              L          F++DSYNIHRLII+ +TV TKF+SDFFYSNSRYA+VGG+SL E+N+
Sbjct: 242 HHLLRNYDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNY 301

Query: 389 LELQFLVLCDFELMIPTEELQRYADLLSRFW 419
           LELQFL++ +F+L+I +EE+QRY+ LLS+F+
Sbjct: 302 LELQFLLISNFDLIISSEEIQRYSGLLSKFY 332

>KLLA0D01287g 112866..113903 some similarities with sp|P20052
           Saccharomyces cerevisiae YOL001w PHO80 cyclin,
           hypothetical start
          Length = 345

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 76/157 (48%), Gaps = 16/157 (10%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           F  K  P I+++QY  R+ KY    + V LS + Y D +S     +V  +          
Sbjct: 63  FHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLS-----AVYPE---------- 107

Query: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402
           F ++S  +HR ++   T+ +K   D F +N+ Y++VGGV   ELN LE +FL    + + 
Sbjct: 108 FTLNSLTVHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRI- 166

Query: 403 IPTEELQRYADLLSRFWSTQPLPEEEDTKVLQDSGSN 439
           IP ++      +  +  S   +P +  ++   D+G N
Sbjct: 167 IPRDDNIENCKIEQKLGSNMLIPMKNASQRGPDNGFN 203

>ACR001C [1049] [Homologous to ScYOL001W (PHO80) - SH]
           (357962..359002) [1041 bp, 346 aa]
          Length = 346

 Score = 70.9 bits (172), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 76/154 (49%), Gaps = 17/154 (11%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           F  +  P IS++ Y  R+ KY    + V L+ + Y D +               TN    
Sbjct: 60  FHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLL---------------TNVYPE 104

Query: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402
           F +DS  +HR ++   TV +K   D F +N+ YA+VGGV   ELN LE +FL   ++ ++
Sbjct: 105 FRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRIL 164

Query: 403 IPTEELQRYA-DLLSRFWSTQPLPEEEDTKVLQD 435
              + ++R + +   R +S   +P ++D   LQD
Sbjct: 165 PRDDNIRRCSLERQERIFSYSNIPMDKDC-ALQD 197

>CAGL0E02541g 244577..245605 similar to sp|P20052 Saccharomyces
           cerevisiae YOL001w PHO80 cyclin, start by similarity
          Length = 342

 Score = 67.4 bits (163), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 58/120 (48%), Gaps = 15/120 (12%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           F  K  P IS+  YF R+ KY    + V LS + Y D +S               N    
Sbjct: 62  FHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLS---------------NVYPA 106

Query: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402
           F ++S   HR ++   T+ +K   D F +N+ Y++VGGV   ELN LE +FL   ++ ++
Sbjct: 107 FNLNSLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRII 166

>Sklu_2373.4 YOL001W, Contig c2373 11960-12883
          Length = 307

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 59/120 (49%), Gaps = 15/120 (12%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           F  +  P IS++ Y  R+ KY      V ++ + Y D +S     SV             
Sbjct: 90  FHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLS-----SVYPS---------- 134

Query: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402
           F ++S  +HR ++   TV +K  SD F +N  YA+VGGV   ELN LE +FL   ++ ++
Sbjct: 135 FTLNSLTVHRFLLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRII 194

>Scas_392.1
          Length = 303

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 59/120 (49%), Gaps = 15/120 (12%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           F  +  P IS+  Y  R+ KYC   + V LS++ Y D  +             PT     
Sbjct: 100 FHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFT----------AAYPT----- 144

Query: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402
           F  +S   HR ++  +TV  K   D F + ++YA++GGV  +ELN LE  FL + ++ ++
Sbjct: 145 FTFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRII 204

>Kwal_56.22443
          Length = 280

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 15/120 (12%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           F  +  PQIS++ Y  R+ +Y      V ++ + Y D +S             P+     
Sbjct: 75  FHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLS----------AMYPS----- 119

Query: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402
           F ++S  +HR ++   TV +K   D F +NS YA+VGGV   EL+ LE +FL   ++ ++
Sbjct: 120 FSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRIL 179

>YOL001W (PHO80) [4815] chr15 (325249..326130) Cyclin that interacts
           with Pho85p cyclin-dependent kinase, regulates the
           phosphate pathway through phosphorylation of Pho4p [882
           bp, 293 aa]
          Length = 293

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 75/165 (45%), Gaps = 28/165 (16%)

Query: 238 LTALLDKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVGSILAFRGKHVPQISLHQYF 297
           L  L+ +++ S   +N +S+  +S D I             ++  +  K  P IS+  YF
Sbjct: 35  LVVLISRMLVSLIAINENSATKKSDDQI-------------TLTRYHSKIPPNISIFNYF 81

Query: 298 QRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAG 357
            R+ K+    + V ++ L Y D +          Q   P      F ++S   HR ++  
Sbjct: 82  IRLTKFSSLEHCVLMTSLYYIDLL----------QTVYPD-----FTLNSLTAHRFLLTA 126

Query: 358 VTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402
            TV TK   D F +N+ YA+VGGV   ELN LE  FL   ++ ++
Sbjct: 127 TTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRII 171

>YGL134W (PCL10) [1853] chr7 (255666..256967) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           glycogen accumulation [1302 bp, 433 aa]
          Length = 433

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 68/140 (48%), Gaps = 11/140 (7%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           F  K  P +S   + +RIQ  C     V+L      D +       +T  G+   N  QL
Sbjct: 300 FYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLF------LTRDGN---NILQL 350

Query: 343 FV-MDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLV-LCDFE 400
            + +    +HR+IIA V + TK   DF +S+  +++V G+S + L  LE+  L+ +C+ +
Sbjct: 351 KLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLLICVCNTK 410

Query: 401 LMIPTEELQRYADLLSRFWS 420
           LM+   +L     LL+   S
Sbjct: 411 LMVSNRKLAASKLLLNELRS 430

>YPL219W (PCL8) [5230] chr16 (136749..138227) Cyclin that associates
           with the Pho85p cyclin-dependent kinase, involved in
           control of glycogen accumulation [1479 bp, 492 aa]
          Length = 492

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 69/157 (43%), Gaps = 23/157 (14%)

Query: 270 DNSNNAYVGS-----ILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSL-----LVYFD 319
           DN+N   + S      + F  K+ P +S   +  RIQ  C     V+L       LV+  
Sbjct: 338 DNANTLAISSEDPQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLT 397

Query: 320 RISKRCNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVG 379
           R           + D P         D    HR+II+ + + TK   DF +S +   +V 
Sbjct: 398 R----------DEMDGPIKLKAKLQEDQ--AHRIIISTIRIATKLLEDFVHSQNYICKVF 445

Query: 380 GVSLQELNHLELQFLVLCDFE-LMIPTEELQRYADLL 415
           G+S + L  LE+ F+   +F+ LMI  E+L++   +L
Sbjct: 446 GISKRLLTKLEISFMASVNFDGLMITCEKLEKTLHIL 482

>CAGL0E05918g complement(585723..587168) some similarities with
           tr|Q08966 Saccharomyces cerevisiae YPL219w PCL8,
           hypothetical start
          Length = 481

 Score = 56.2 bits (134), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 20/160 (12%)

Query: 267 RSEDNSNNAYVGSILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFL--SLLVYFDRISKR 324
           ++++N N  Y      F  K  P IS H + QRIQ  C   + ++L  + L+    +++ 
Sbjct: 336 KADNNENYHY------FSMKSAPSISHHDFIQRIQNKCMFGSIIYLGATYLLQILFLTRE 389

Query: 325 CNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQ 384
            N       D P        +    +HR+I+  + + TK   DF +S+    +V G+S +
Sbjct: 390 YN-------DGPLRLKH--KLQQNEVHRVIVGTIRIATKLLEDFVHSHQYICKVCGISKK 440

Query: 385 ELNHLELQFLVLC--DFELMIPTEELQRYADLLSRFWSTQ 422
            +  LEL  L+ C  D  L+I +E+L   A +L    + +
Sbjct: 441 LMTKLELA-LIFCLKDNNLLINSEKLSATACILEELKAQE 479

>Scas_720.47
          Length = 473

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 9/125 (7%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           F+ K  P +S   + QRIQ  C     V+L        I+     ++    +  + K +L
Sbjct: 340 FKMKSPPSLSYADFIQRIQNKCEYDPHVYL--------IATYLLQTLLLIREEHSRKLKL 391

Query: 343 -FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFEL 401
            F  +  ++HRLIIA V + TK   D  +S+  + +V G+S + L+ LE+  L+    E 
Sbjct: 392 RFKFEKSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLLLCLKNEC 451

Query: 402 MIPTE 406
           ++ T+
Sbjct: 452 LLMTK 456

>Scas_706.3
          Length = 451

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 63/141 (44%), Gaps = 18/141 (12%)

Query: 288 VPQISLHQYFQRIQKYCPTTNDVFLSL-----LVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           VP +S   +  RIQ  C     V++S      ++  DR           + D P      
Sbjct: 323 VPSLSYTDFINRIQSKCMFGAIVYMSATYLFQILLLDR----------DERDGPIKLKH- 371

Query: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFE-L 401
             +    +HR+IIA + V TK   DF +S+  + +V GVS + L+ LE+  L+    + +
Sbjct: 372 -KLQENEVHRMIIATIRVGTKLVEDFVHSHQYFCKVCGVSRKLLSKLEVTLLLCLKHDKI 430

Query: 402 MIPTEELQRYADLLSRFWSTQ 422
           +I TEEL     +L    + Q
Sbjct: 431 IITTEELVASVRVLQELRTYQ 451

>CAGL0H08998g 877952..879595 weakly similar to tr|Q08966
           Saccharomyces cerevisiae YPL219w PCL8, hypothetical
           start
          Length = 547

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 68/146 (46%), Gaps = 12/146 (8%)

Query: 279 SILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSP-T 337
           + L F  K  P +S   +  RIQ  C     ++L+   Y  +I       +    D+P +
Sbjct: 410 AALNFTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAA-AYLLQI-------LFLTRDNPDS 461

Query: 338 NKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLC 397
           N      +    IHRLII+ V V  K   DF +S+  +++V GVS + L+ LE+  L++C
Sbjct: 462 NIRVRLKLRENEIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLEVS-LIMC 520

Query: 398 --DFELMIPTEELQRYADLLSRFWST 421
             +  LMI  ++L     +L    S 
Sbjct: 521 IKNERLMITKQKLTASQKILDELQSA 546

>Kwal_56.24151
          Length = 480

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%)

Query: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFE 400
           + +D+  +HRLIIA + + TK   D  +S++ ++R+ G+S + L  LE+ FL   +FE
Sbjct: 399 YHLDNCQVHRLIIASIRLATKLLEDCVHSHTCFSRICGISKKLLTKLEIAFLNCINFE 456

>KLLA0B02024g 176585..178168 some similarities with sp|P53124
           Saccharomyces cerevisiae YGL134w PCL10 cyclin like
           protein interacting with PHO85P, hypothetical start
          Length = 527

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 12/117 (10%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLS---LLVYFDRISKRCNNSVTSQGDSPTNK 339
           F+ K  P +S+ QY  RI+  C     ++L+   LLV +  I K    S     ++P  +
Sbjct: 392 FQMKSAPTLSISQYLDRIESKCSFPPIIYLTASFLLVTYCDI-KFDTGSGKFHLENPITE 450

Query: 340 SQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVL 396
           S          HRL+IA + +  K   D  +S+S +++V G+S + L+ LEL  +++
Sbjct: 451 SM--------THRLLIAFIRLAAKLLEDHVHSHSYFSKVCGISKKLLSKLELNLVLI 499

>AFL115W [3080] [Homologous to ScYPL219W (PCL8) - SH; ScYGL134W
           (PCL10) - SH] complement(221235..222395) [1161 bp, 386
           aa]
          Length = 386

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342
           F  K    ++  QY  RI   C     V+ +      R++ +   S T     P  + + 
Sbjct: 244 FEMKAPASVTYTQYLDRINAKCMFAPIVYQTAGCLLLRLTLKWPPSETG----PV-QIRW 298

Query: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402
            + +SY +HRLI+A + V TK   D  +S+  +++V G+S + L  LEL  +++   E +
Sbjct: 299 PIAESY-VHRLIVALIRVSTKIVEDTVHSHEYFSKVCGISKKLLMRLELALILVLRGEGL 357

Query: 403 IPT 405
           + T
Sbjct: 358 MVT 360

>YNL289W (PCL1) [4322] chr14 (87895..88734) G1/S-specific cyclin
           that interacts with the Cdc28p-like kinase Pho85p [840
           bp, 279 aa]
          Length = 279

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 58/126 (46%), Gaps = 17/126 (13%)

Query: 286 KHVPQI-SLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFV 344
           KH+ ++ SL  +  R+ +Y        L+   Y +++ +      T    +         
Sbjct: 47  KHLTRLPSLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPST--------- 97

Query: 345 MDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARV--GGVSLQELNHLELQFLVLCDFELM 402
                IHR+ +A + +  KF +D    N  +AR   G  +L+++N +E Q L L +++L 
Sbjct: 98  -----IHRIFLACLILSAKFHNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNWDLR 152

Query: 403 IPTEEL 408
           + TE+L
Sbjct: 153 VNTEDL 158

>CAGL0E02233g 215697..216497 similar to sp|P24867 Saccharomyces
           cerevisiae YNL289w PCL1 cyclin, start by similarity
          Length = 266

 Score = 33.9 bits (76), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 28/125 (22%), Positives = 57/125 (45%), Gaps = 18/125 (14%)

Query: 286 KHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQLFVM 345
           +H+P  SL  +  R+ +Y        L+ + Y +++ +      T    +          
Sbjct: 50  EHLP--SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPST---------- 97

Query: 346 DSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARV--GGVSLQELNHLELQFLVLCDFELMI 403
               IHRL +A + + +K  +D    N  +AR   G  SL+++N +E Q L L ++++ +
Sbjct: 98  ----IHRLFLACLILSSKCHNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINV 153

Query: 404 PTEEL 408
             ++L
Sbjct: 154 SEDDL 158

>Scas_240.1
          Length = 269

 Score = 33.1 bits (74), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 126 SVLPKE-SSYRQTTPITSNSEIVRPTLNQNEYIDIFGNDRTKRNDTYWEDNKEQDANISR 184
           S+ P+  +  R++  + S+SEI+ P LN+ +  D   N R K N+    D  + DAN++ 
Sbjct: 86  SIFPQNVAKKRKSNELDSSSEIIVPKLNKQQEKDSKDNKRKKDNNARRNDFNDNDANVTS 145

Query: 185 T 185
           T
Sbjct: 146 T 146

>YHR071W (PCL5) [2359] chr8 (237005..237694) Cyclin that associates
           with the Pho85p cyclin-dependent kinase and regulates
           Gcn4p stability [690 bp, 229 aa]
          Length = 229

 Score = 32.0 bits (71), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 30/57 (52%)

Query: 352 RLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEEL 408
           R+ +  + +  KF +D  YS   +  + G+  ++L+ +E   L   ++EL IP +E 
Sbjct: 129 RIFLCCLILSHKFLNDNTYSMKNWQIISGLHAKDLSLMERWCLGKLNYELAIPYDEF 185

>Kwal_34.15996
          Length = 231

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 35/61 (57%)

Query: 352 RLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRY 411
           R+ +  + +  KF +D  +S + + R+ G+S ++L+ +E   L   D+EL+I  E L  +
Sbjct: 127 RVYLCCLILAHKFLNDQTFSMNSWQRISGLSSKDLSTMERWCLSKLDYELLINDENLNSW 186

Query: 412 A 412
           +
Sbjct: 187 S 187

>Sklu_2426.9 YHR071W, Contig c2426 11461-12162
          Length = 233

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 30/61 (49%)

Query: 352 RLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRY 411
           R+ +  + +  KF  D  +S   + R+ G+  +++  +E   L   D+EL +    LQ +
Sbjct: 125 RIYLVCLILSHKFLKDQTFSMKSWQRISGLPTKDIATMERWCLGKLDYELFLEESALQEW 184

Query: 412 A 412
           A
Sbjct: 185 A 185

>Scas_646.23
          Length = 238

 Score = 29.6 bits (65), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 49/117 (41%), Gaps = 9/117 (7%)

Query: 296 YFQRIQKYCPTTNDVFLSLLVYFDRISKRCNN-SVTSQGDSPTNKSQLFVMDSYNIHRLI 354
           +   I K   +   + L    YF R+     N S  S G  P          +++I R  
Sbjct: 93  FLNEIIKRSKSNKKIVLLATFYFHRLHSNIKNTSADSAGKIPD--------FAHSIKRTF 144

Query: 355 IAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELMIPTEELQRY 411
           +  + +  KF +D  +S   ++ + G+  + ++ +E   L   +F+L +  E+L  +
Sbjct: 145 LNCLILAHKFSNDITFSMKTWSLITGLQPKNISTMERWCLKKLNFQLFVSNEQLLSW 201

>YDR515W (SLF1) [1328] chr4 (1473417..1474760) Ribosome-associated
           protein possibly involved in regulation of
           copper-dependent mineralization of copper complexes on
           the cell surface, member of a subfamily of La motif
           proteins [1344 bp, 447 aa]
          Length = 447

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 4/96 (4%)

Query: 187 PSPQLSNSKDTTPSNQMDTIDSETNMANKTTEDDNESINIAEF--PTNKLLEM--LTALL 242
           PS  +S SKDT   +  ++ +S+TN   K     N  IN  +F   TN   E+  ++ L 
Sbjct: 84  PSVIISGSKDTNSKSGKNSKNSKTNKKMKKRGKYNNDINKKDFNGQTNSTSEISNVSNLE 143

Query: 243 DKIVKSNDKLNVSSSNSESIDDILRSEDNSNNAYVG 278
            K + +N K+N+ SS+  + +  ++   N+NN+  G
Sbjct: 144 SKPLDANAKVNIHSSSGATANGNIKRITNNNNSTNG 179

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.310    0.126    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,225,911
Number of extensions: 710853
Number of successful extensions: 3594
Number of sequences better than 10.0: 273
Number of HSP's gapped: 3507
Number of HSP's successfully gapped: 299
Length of query: 448
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 343
Effective length of database: 12,961,219
Effective search space: 4445698117
Effective search space used: 4445698117
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)