Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.341481487681e-106
YIL051C (MMF1)1451446111e-82
Sklu_2193.31281275448e-73
KLLA0C08349g1401305458e-73
Kwal_23.58041411445381e-71
Scas_715.531281265162e-68
ADL077C1421314998e-66
CAGL0M12386g1421374791e-62
YER057C (HMF1)1291274346e-56
Kwal_23.28071291071582e-14
Kwal_47.165901261001513e-13
Kwal_55.21247134991453e-12
KLLA0B14817g1311141261e-09
Scas_506.36891411268e-09
KLLA0E03894g1371151156e-08
YLR143W6851171092e-06
CAGL0M04521g688891082e-06
AGL164W686971047e-06
KLLA0D16984g696961047e-06
Kwal_27.1131068864914e-04
YNL163C (RIA1)111033700.26
Scas_712.458659660.69
YEL062W (NPR2)61587631.6
Kwal_47.1797249851603.6
YMR323W43743603.9
Scas_684.1684163604.2
Scas_715.33101865596.5
Kwal_56.2241168983587.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.34
         (148 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.34                                                           300   e-106
YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein im...   239   1e-82
Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement        214   8e-73
KLLA0C08349g 731629..732051 highly similar to sp|P40185 Saccharo...   214   8e-73
Kwal_23.5804                                                          211   1e-71
Scas_715.53                                                           203   2e-68
ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C (...   196   8e-66
CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces...   189   1e-62
YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein th...   171   6e-56
Kwal_23.2807                                                           65   2e-14
Kwal_47.16590                                                          63   3e-13
Kwal_55.21247                                                          60   3e-12
KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia c...    53   1e-09
Scas_506.3                                                             53   8e-09
KLLA0E03894g complement(364475..364888) some similarities with s...    49   6e-08
YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containi...    47   2e-06
CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces c...    46   2e-06
AGL164W [4148] [Homologous to ScYLR143W - SH] complement(388842....    45   7e-06
KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomy...    45   7e-06
Kwal_27.11310                                                          40   4e-04
YNL163C (RIA1) [4433] chr14 complement(326741..330073) GTPase re...    32   0.26 
Scas_712.4                                                             30   0.69 
YEL062W (NPR2) [1366] chr5 (34407..36254) Nitrogen permease regu...    29   1.6  
Kwal_47.17972                                                          28   3.6  
YMR323W (YMR323W) [4276] chr13 (920086..921399) Protein with hig...    28   3.9  
Scas_684.16                                                            28   4.2  
Scas_715.33                                                            27   6.5  
Kwal_56.22411                                                          27   7.0  

>Scas_704.34
          Length = 148

 Score =  300 bits (768), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 148/148 (100%), Positives = 148/148 (100%)

Query: 1   MFLRNTILRSRQPIVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKP 60
           MFLRNTILRSRQPIVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKP
Sbjct: 1   MFLRNTILRSRQPIVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKP 60

Query: 61  VEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPA 120
           VEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPA
Sbjct: 61  VEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPA 120

Query: 121 RSCVAVKDLPLNVDLEVEVIAVEKVNNE 148
           RSCVAVKDLPLNVDLEVEVIAVEKVNNE
Sbjct: 121 RSCVAVKDLPLNVDLEVEVIAVEKVNNE 148

>YIL051C (MMF1) [2616] chr9 complement(257842..258279) Protein
           important for maintenance of mitochondrial DNA, may be
           involved in isoleucine-dependent transaminase activity,
           member of the p14.5 family [438 bp, 145 aa]
          Length = 145

 Score =  239 bits (611), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 129/144 (89%)

Query: 1   MFLRNTILRSRQPIVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKP 60
           MFLRN++LR+   + R +TTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTP+NKP
Sbjct: 1   MFLRNSVLRTAPVLRRGITTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPDNKP 60

Query: 61  VEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPA 120
           V+G+IS+KAEQVFQN+KNIL ES SS+D IVKVNVFLAD+ NF EFN VYAK+F+ HKPA
Sbjct: 61  VQGSISEKAEQVFQNVKNILAESNSSLDNIVKVNVFLADMKNFAEFNSVYAKHFHTHKPA 120

Query: 121 RSCVAVKDLPLNVDLEVEVIAVEK 144
           RSCV V  LPLNVDLE+EVIAVEK
Sbjct: 121 RSCVGVASLPLNVDLEMEVIAVEK 144

>Sklu_2193.3 YIL051C, Contig c2193 5846-6232 reverse complement
          Length = 128

 Score =  214 bits (544), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 117/127 (92%)

Query: 18  LTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIK 77
           ++TLTPV T+LAPP AASYSQA+K NN V+VSGQIPYT ENKPVEG+I+DKAEQV QN+K
Sbjct: 1   MSTLTPVRTQLAPPPAASYSQAIKVNNMVFVSGQIPYTHENKPVEGSIADKAEQVIQNVK 60

Query: 78  NILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEV 137
           NIL+E+ SS++KIVKVNVFLADIN+F EFNGVYAKYFN HKPARSCVAVK LPLNVDLE+
Sbjct: 61  NILEEANSSLNKIVKVNVFLADINDFAEFNGVYAKYFNEHKPARSCVAVKSLPLNVDLEM 120

Query: 138 EVIAVEK 144
           EVIAVEK
Sbjct: 121 EVIAVEK 127

>KLLA0C08349g 731629..732051 highly similar to sp|P40185
           Saccharomyces cerevisiae YIL051c MMD1 required for
           maintenance of mitochondrial DNA, start by similarity
          Length = 140

 Score =  214 bits (545), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 115/130 (88%)

Query: 15  VRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQ 74
           VR + TLTPV T+LAPP AASYSQA+K NN ++VSGQIPYT ENKPVEG+I+DKAEQV Q
Sbjct: 10  VRRMNTLTPVKTQLAPPPAASYSQAIKVNNLIFVSGQIPYTAENKPVEGSIADKAEQVIQ 69

Query: 75  NIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVD 134
           N+KNIL E+ S +DKIVKVN+FLADIN+F EFN VYAKYFNVHKPARSCVA K LPLNVD
Sbjct: 70  NVKNILVEANSDLDKIVKVNIFLADINSFAEFNSVYAKYFNVHKPARSCVAAKALPLNVD 129

Query: 135 LEVEVIAVEK 144
           LE+EVIAVEK
Sbjct: 130 LEMEVIAVEK 139

>Kwal_23.5804
          Length = 141

 Score =  211 bits (538), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 102/144 (70%), Positives = 121/144 (84%), Gaps = 4/144 (2%)

Query: 1   MFLRNTILRSRQPIVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKP 60
           MFLRN    + +   RS++TLTPV T+L+PP AASYSQAM+ N  V+VSGQIPYT ENK 
Sbjct: 1   MFLRN----AARNTFRSMSTLTPVRTQLSPPPAASYSQAMRVNKMVFVSGQIPYTAENKR 56

Query: 61  VEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPA 120
           VEGTI+DKAEQV QN++NIL+E+ S +DKIVKVN+FLADI +F EFNGVY KYFN HKPA
Sbjct: 57  VEGTIADKAEQVIQNVRNILEEANSGLDKIVKVNIFLADIKDFAEFNGVYGKYFNEHKPA 116

Query: 121 RSCVAVKDLPLNVDLEVEVIAVEK 144
           RSCVAVK LPL+VDLE+EV+AVEK
Sbjct: 117 RSCVAVKALPLDVDLEMEVVAVEK 140

>Scas_715.53
          Length = 128

 Score =  203 bits (516), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 97/126 (76%), Positives = 111/126 (88%)

Query: 18  LTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIK 77
           +TTLTPV+ K AP AAASYS AMKANN +++SGQIP T ENKPVEG+I+DKAEQV QNIK
Sbjct: 1   MTTLTPVTCKNAPSAAASYSHAMKANNLIFLSGQIPMTAENKPVEGSIADKAEQVIQNIK 60

Query: 78  NILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEV 137
           N+L+ S SS++KIVKVN+FLADIN+F EFN VYAKYFNVHKPARSCVAV  LPLN DLE+
Sbjct: 61  NVLEASNSSLEKIVKVNIFLADINSFAEFNTVYAKYFNVHKPARSCVAVAALPLNADLEM 120

Query: 138 EVIAVE 143
           EVIAVE
Sbjct: 121 EVIAVE 126

>ADL077C [1664] [Homologous to ScYIL051C (MMF1) - SH; ScYER057C
           (HMF1) - SH] (549526..549954) [429 bp, 142 aa]
          Length = 142

 Score =  196 bits (499), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 110/131 (83%)

Query: 14  IVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVF 73
           + RS+++LTPV T  APP AASYSQAM+AN  V+VSGQIPYTP+NKPVEG+++DK EQV 
Sbjct: 11  LARSMSSLTPVRTTAAPPPAASYSQAMRANGMVFVSGQIPYTPDNKPVEGSVADKTEQVI 70

Query: 74  QNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNV 133
            N++N+L+ S S +D++ KVNVFLAD+  F EFN VYAKYF  HKPARSCVAV+ LPLNV
Sbjct: 71  ANVRNVLEASNSGLDRVAKVNVFLADMAYFAEFNSVYAKYFGEHKPARSCVAVRALPLNV 130

Query: 134 DLEVEVIAVEK 144
           DLE+EVIA+E+
Sbjct: 131 DLEMEVIALER 141

>CAGL0M12386g 1234993..1235421 similar to sp|P40037 Saccharomyces
           cerevisiae YER057c HIG1 Heat-shock induceable Inhibiter
           of cell Growth, hypothetical start
          Length = 142

 Score =  189 bits (479), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 116/137 (84%), Gaps = 1/137 (0%)

Query: 8   LRSRQPIV-RSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTIS 66
           L++R  I+ R L+ LTPV +  APPAAASYS AMK NN +YVSGQIPYT +NKPVEG+IS
Sbjct: 4   LKARSLIMTRQLSKLTPVISANAPPAAASYSHAMKVNNLIYVSGQIPYTKDNKPVEGSIS 63

Query: 67  DKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAV 126
           DKAEQV QN++NILK+S S +++IVKVN+FLAD+NNF EFN VYAKYFNVHKPARSCVAV
Sbjct: 64  DKAEQVIQNVQNILKDSNSDLNRIVKVNIFLADMNNFAEFNKVYAKYFNVHKPARSCVAV 123

Query: 127 KDLPLNVDLEVEVIAVE 143
             LPL VDLE+EVIA E
Sbjct: 124 AALPLGVDLEMEVIATE 140

>YER057C (HMF1) [1487] chr5 complement(270735..271124) Protein that
           inhibits cell growth and contributes to cell death at
           high temperature, member of the p14.5 family [390 bp,
           129 aa]
          Length = 129

 Score =  171 bits (434), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%)

Query: 18  LTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIK 77
           +TTLTPV  + AP AAASYS AMK NN +++SGQIP TP+NK VEG+I+DKAEQV QNIK
Sbjct: 2   VTTLTPVICESAPAAAASYSHAMKVNNLIFLSGQIPVTPDNKLVEGSIADKAEQVIQNIK 61

Query: 78  NILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEV 137
           N+L+ S SS+D++VKVN+FLADIN+F EFN VYAKYFN HKPARSCVAV  LPL VD+E+
Sbjct: 62  NVLEASNSSLDRVVKVNIFLADINHFAEFNSVYAKYFNTHKPARSCVAVAALPLGVDMEM 121

Query: 138 EVIAVEK 144
           E IA E+
Sbjct: 122 EAIAAER 128

>Kwal_23.2807
          Length = 129

 Score = 65.5 bits (158), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 63/107 (58%), Gaps = 9/107 (8%)

Query: 39  AMKANNFVYVSGQIPYTPENKPVEGTISDKAEQ----VFQNIKNILKESGSSMDKIVKVN 94
           A K+N+ V+ SG +       PV G + +  EQ      +N+KN+L  SGSS+++++KV 
Sbjct: 25  ASKSNDLVFTSGCV----GTDPVTGNLPEDLEQQIINALENLKNVLHASGSSLERVLKVL 80

Query: 95  VFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEVEVIA 141
           +F++D +     N VY++YF  + PARSC+ V      + +E+E IA
Sbjct: 81  LFVSDASYASTVNEVYSRYFP-NAPARSCIVVAFPAPALKVELECIA 126

>Kwal_47.16590
          Length = 126

 Score = 62.8 bits (151), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 1/100 (1%)

Query: 42  ANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADIN 101
           +N  V+ SG I        V   I D+     +N++ +L   GSS+ K+ KV +F++  +
Sbjct: 25  SNGHVFTSGIIGANYGTGEVPHEIEDQVHLAIKNLETVLVAGGSSLSKVFKVTMFISHAD 84

Query: 102 NFKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEVEVIA 141
             K  N +Y  YF  HKPARSCV V  +   +  E+E IA
Sbjct: 85  YSKVVNEIYGHYFP-HKPARSCVVVAFMDAAIKYELEAIA 123

>Kwal_55.21247
          Length = 134

 Score = 60.5 bits (145), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 58/99 (58%), Gaps = 1/99 (1%)

Query: 43  NNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINN 102
           ++ V+ SG +   P    +   +  +     +N+KN+L+ SGSS+++++KV +F++D + 
Sbjct: 28  SDLVFTSGCVGTDPVTGELPTDLEQQVRNALENLKNVLRASGSSLEQVIKVLLFVSDGSY 87

Query: 103 FKEFNGVYAKYFNVHKPARSCVAVKDLPLNVDLEVEVIA 141
               N VY++YF    PARSC+ V     ++ +E+E IA
Sbjct: 88  APAVNKVYSEYFP-GAPARSCIVVSFPNASLKVELECIA 125

>KLLA0B14817g 1301705..1302100 similar to sp|Q8XCD0 Escherichia coli
           O157:H7 Orf, hypothetical protein, start by similarity
          Length = 131

 Score = 53.1 bits (126), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 26  TKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGS 85
           T LAP    S     K    VY SG +        +   +  +      N+  +LK S S
Sbjct: 17  TFLAPAYVTS-----KDTELVYTSGCVGSDLLTGEIPEDLEKQVRNALDNLGRVLKASNS 71

Query: 86  SMDKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVK--DLPLNVDLEV 137
           S D ++K+ +F+AD +     N VY +YF   +PARSC+ V   D  L V+LE 
Sbjct: 72  SFDDVLKILLFVADGSYASTVNAVYKEYFP-ERPARSCIVVSFPDPTLKVELEC 124

>Scas_506.3
          Length = 689

 Score = 53.1 bits (126), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 71/141 (50%), Gaps = 16/141 (11%)

Query: 6   TILRSRQP--IVRSLTTLTPVSTKLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEG 63
           +IL S Q     +S+T  T +ST    P     +   K  N +Y+S   P     K  E 
Sbjct: 285 SILSSFQEETFAKSVTKTTQLST---IPECKYRNSVNKVGNLLYISNLCP-----KDSEL 336

Query: 64  TISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHK----- 118
            +  +A+QVFQ +  I+KE+     +I+  ++ LA+++NF   N VY  +F ++K     
Sbjct: 337 NVEQQAKQVFQQLDKIMKENSLFPSQILFSSLILANMSNFATVNQVYNDFFRINKWGPLP 396

Query: 119 PARSCVAVKDLPLNVDLEVEV 139
           P+R+CV    L  NV L++ V
Sbjct: 397 PSRACVG-SVLSNNVQLQLSV 416

>KLLA0E03894g complement(364475..364888) some similarities with
           sp|Q87LF6 Vibrio parahaemolyticus Conserved hypothetical
           protein, hypothetical start
          Length = 137

 Score = 48.9 bits (115), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 7/115 (6%)

Query: 28  LAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSM 87
           L  P  A+ S     N  ++ SG +   P    +   +  +A     N+K +L+ SGSS+
Sbjct: 18  LISPGFATES----GNQLLFSSGCVGTDPVTNELPEDLEQQARNSMINLKKVLEVSGSSV 73

Query: 88  DKIVKVNVFLADINNFKEFNGVYAKYFNVHKPARSCVAVKDLPLN-VDLEVEVIA 141
           D ++K+ +F++D +     N V+ ++F  ++PARSC+ V   P N + +E+E IA
Sbjct: 74  DSVLKILLFVSDGSYAGIVNKVFKEFFP-NQPARSCIVVA-FPNNKLKVELECIA 126

>YLR143W (YLR143W) [3552] chr12 (427330..429387) Protein containing
           an endoribonuclease L-PSP domain and a DUF71 domain of
           unknown function, has moderate similarity to
           uncharacterized C. albicans Orf6.3850p [2058 bp, 685 aa]
          Length = 685

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 17/117 (14%)

Query: 41  KANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADI 100
           K N+ +Y+S       E      T+  ++E +F  + +IL  +    + I+  ++ + D+
Sbjct: 317 KTNDKLYISNLQSRKSE------TVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDM 370

Query: 101 NNFKEFNGVYAKYFNVHK-----PARSCVAVKDLP------LNVDLEVEVIAVEKVN 146
           +NF + N +Y ++ ++ K     P+R+CV  K LP      L+V ++V+    EK+N
Sbjct: 371 SNFGKINKIYNEFLDLSKYGPLPPSRACVGSKCLPEDCHVQLSVVVDVKNTGKEKIN 427

>CAGL0M04521g 496157..498223 similar to tr|Q12429 Saccharomyces
           cerevisiae YLR143w, hypothetical start
          Length = 688

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 50/89 (56%), Gaps = 10/89 (11%)

Query: 41  KANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADI 100
           +  N +Y+S      P+ K  +GT+ ++ + V Q + NILK++  +   ++  ++ L D+
Sbjct: 318 RIGNLLYISN---IQPQYK--DGTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDM 372

Query: 101 NNFKEFNGVYAKYFNVHK-----PARSCV 124
           + F   N  Y+K+F++ K     PAR+C+
Sbjct: 373 SLFASVNQEYSKFFDIWKNGPLPPARACI 401

>AGL164W [4148] [Homologous to ScYLR143W - SH]
           complement(388842..390902) [2061 bp, 686 aa]
          Length = 686

 Score = 44.7 bits (104), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query: 50  GQIPYTPENKP-VEGTISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNG 108
           G + Y    +P   G +  +A  VF  +   L   G    +++   + LAD+  F E N 
Sbjct: 313 GGLLYVSNIQPRCRGPLEKQARDVFDQLNESLTRHGVVKAQVLSSVLLLADMGTFAEINT 372

Query: 109 VYAKYFNVHK-----PARSCVAVKDLPLNVDLEVEVI 140
            Y  YF++ +     P+R+C+  K L   + L++ V+
Sbjct: 373 AYNGYFSIQEIGPLPPSRACIESKSLAPGIGLQLSVV 409

>KLLA0D16984g 1439669..1441759 similar to sgd|S0004133 Saccharomyces
           cerevisiae YLR143w, start by similarity
          Length = 696

 Score = 44.7 bits (104), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 6/96 (6%)

Query: 50  GQIPYTPENKPVEG-TISDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNG 108
           G++ Y     P +G ++ +K   VF  + +IL        +I+  ++ L+D+NNF+E N 
Sbjct: 322 GKLLYISNIAPSKGESLKEKCLDVFSQLTSILSSRSIFACQILSSSLLLSDMNNFQEVNS 381

Query: 109 VYAKYFNVHK-----PARSCVAVKDLPLNVDLEVEV 139
            Y +YFNV K     PAR+CV    L   V L V V
Sbjct: 382 YYNEYFNVTKIGPLPPARACVESSFLKHPVQLSVVV 417

>Kwal_27.11310
          Length = 688

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 5/64 (7%)

Query: 67  DKAEQVFQNIKNILKESGSSMDKIVKVNVFLADINNFKEFNGVYAKYFNVHK-----PAR 121
           +K + VF+ + +IL++   S  +I+   V LAD+ +F + N  Y ++F+V +     P+R
Sbjct: 334 EKVQDVFRQLSDILRDYELSPAQILSSLVLLADMGDFSKVNEHYNEFFHVARNGPLPPSR 393

Query: 122 SCVA 125
           +CV 
Sbjct: 394 ACVG 397

 Score = 28.5 bits (62), Expect = 2.3,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 4/45 (8%)

Query: 29  APPAAASYSQAM----KANNFVYVSGQIPYTPENKPVEGTISDKA 69
           AP     YSQA      AN   Y+SGQI   P +  + GT+   A
Sbjct: 443 APCNIGPYSQATWNKTDANQVSYISGQIALIPSSMEMVGTLHPDA 487

>YNL163C (RIA1) [4433] chr14 complement(326741..330073) GTPase
           required for maturation of 60S ribosomal subunits in the
           cytoplasm, has similarity to eukaryotic and
           archaebacterial EF-2 proteins [3333 bp, 1110 aa]
          Length = 1110

 Score = 31.6 bits (70), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%)

Query: 60  PVEGTISDKAEQVFQNIKNILKESGSSMDKIVK 92
           P+ G ++D   Q   +IKNILK S SSMD +++
Sbjct: 791 PLSGKVTDFLSQHQNSIKNILKTSTSSMDPVIE 823

>Scas_712.4
          Length = 586

 Score = 30.0 bits (66), Expect = 0.69,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 29/59 (49%), Gaps = 12/59 (20%)

Query: 33  AASYSQAMKANNFVYVSGQIPYTPENK------------PVEGTISDKAEQVFQNIKNI 79
           + SY + +  ++F+++ G+IP +PE K            P  G + + A + F  IK I
Sbjct: 269 SCSYDEFVAVSDFLFLKGRIPGSPEKKIFKVTEAKAKQLPTVGFLMNAAFESFPKIKTI 327

>YEL062W (NPR2) [1366] chr5 (34407..36254) Nitrogen permease
           regulator [1848 bp, 615 aa]
          Length = 615

 Score = 28.9 bits (63), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 11/87 (12%)

Query: 55  TPENKPVEGTISDKAEQVFQN-IKNI-LKESGSSMDKIVKVNVFLADINNFKEF------ 106
           TP +   E    D     + + IK++ L +S  S+  ++ + +F  D+NN+ E       
Sbjct: 163 TPTHPTSEKDTKDMRSSRYSDLIKDLGLPQSAFSIQDLL-MRIF-QDLNNYSECLIPIDE 220

Query: 107 -NGVYAKYFNVHKPARSCVAVKDLPLN 132
            N V  K F + +P  +CV+++D+PL+
Sbjct: 221 GNAVDIKIFPLLRPPTTCVSLEDVPLS 247

>Kwal_47.17972
          Length = 498

 Score = 27.7 bits (60), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 23/51 (45%), Gaps = 4/51 (7%)

Query: 41  KANNFVYVSGQIPYTPEN----KPVEGTISDKAEQVFQNIKNILKESGSSM 87
           K N   Y  GQ  +  EN     PVEG      E++    KNI+  +GS +
Sbjct: 129 KKNGVTYYKGQGAFEDENNIKVSPVEGIEGSVTEEITLEAKNIIVATGSEV 179

>YMR323W (YMR323W) [4276] chr13 (920086..921399) Protein with high
           similarity to enolase 1 (2-phosphoglycerate dehydratase,
           S. cerevisiae Eno1p), which converts
           2-phospho-D-glycerate to phosphoenolpyruvate in
           glycolysis, member of the enol-ase family, contains an
           enlace N-terminal domain [1314 bp, 437 aa]
          Length = 437

 Score = 27.7 bits (60), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 23/43 (53%)

Query: 27  KLAPPAAASYSQAMKANNFVYVSGQIPYTPENKPVEGTISDKA 69
           K+AP  A S+++AM+  + VY   +I    +  P  G + D+ 
Sbjct: 171 KIAPVGAQSFAEAMRMGSEVYHHLKILAKEQYGPSAGNVGDEG 213

>Scas_684.16
          Length = 841

 Score = 27.7 bits (60), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 66  SDKAEQVFQNIKNILKESGSSMDKIVKVNVFLADIN-NFKEFNGVYAKYFNVHKPARSCV 124
           SD+   VF   KN+  +  S  + ++   + ++DI+  +KEFN V     NV   +R  V
Sbjct: 485 SDRISNVFDKTKNVYNDLLSRGNNLLLYRIMVSDISFAWKEFNNVDWTNSNVEDYSRYMV 544

Query: 125 AVK 127
            ++
Sbjct: 545 TLE 547

>Scas_715.33
          Length = 1018

 Score = 27.3 bits (59), Expect = 6.5,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 17  SLTTLTPVSTKLAPPAAASYSQAM--KANNFVYVSGQIPYTPENKPVEGTISDKAEQVFQ 74
           SL  +    T    P   SYS+A+    N+ +  + ++P   E +  +G     AE V  
Sbjct: 327 SLICMRQSGTVYRMPIKQSYSKAIFNYTNSLLIATAELPEIDEIRVSQGGTESNAENVVT 386

Query: 75  NIKNI 79
            +KN+
Sbjct: 387 TLKNL 391

>Kwal_56.22411
          Length = 689

 Score = 26.9 bits (58), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 16/83 (19%)

Query: 62  EGTISDKAEQVFQNIKNILKESG------SSMDKIVKVNVFLADINNFKEF-------NG 108
           E + S+     F+    ILK+        S  D I K+     D+NN+ E        N 
Sbjct: 164 EASQSESHGYAFEKYHEILKDLNGPNKRISVEDLITKI---YRDLNNYSECLIPIDSGNA 220

Query: 109 VYAKYFNVHKPARSCVAVKDLPL 131
           V  K F +  P  SC++ +D+P+
Sbjct: 221 VDIKLFPLLSPPSSCLSFEDVPM 243

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.130    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,707,890
Number of extensions: 193116
Number of successful extensions: 805
Number of sequences better than 10.0: 50
Number of HSP's gapped: 798
Number of HSP's successfully gapped: 51
Length of query: 148
Length of database: 16,596,109
Length adjustment: 92
Effective length of query: 56
Effective length of database: 13,411,253
Effective search space: 751030168
Effective search space used: 751030168
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)