Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_704.3056356324560.0
YIL055C6272464062e-42
CAGL0M12474g4442173894e-41
Kwal_23.58403681463407e-35
ADL068W3992333152e-31
KLLA0C08173g497822013e-16
Scas_594.165157740.71
Scas_554.327980664.6
YGR026W27864655.8
YBR060C (ORC2)62061666.3
AER304C3258113666.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_704.30
         (563 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_704.30                                                           950   0.0  
YIL055C (YIL055C) [2613] chr9 complement(252040..253923) Protein...   160   2e-42
CAGL0M12474g 1240726..1242060 similar to sp|P40523 Saccharomyces...   154   4e-41
Kwal_23.5840                                                          135   7e-35
ADL068W [1673] [Homologous to ScYIL055C - SH] complement(559296....   125   2e-31
KLLA0C08173g complement(717235..718728) some similarities with s...    82   3e-16
Scas_594.1                                                             33   0.71 
Scas_554.3                                                             30   4.6  
YGR026W (YGR026W) [1993] chr7 (532987..533823) Protein of unknow...    30   5.8  
YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin reco...    30   6.3  
AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH] (1194908..1...    30   6.9  

>Scas_704.30
          Length = 563

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/563 (84%), Positives = 478/563 (84%)

Query: 1   MTGSTELNSVTTVDSIPLETLSLNGNQKSPNGISNGQDLNGKEHNEEQSNSEVSSDTETI 60
           MTGSTELNSVTTVDSIPLETLSLNGNQKSPNGISNGQDLNGKEHNEEQSNSEVSSDTETI
Sbjct: 1   MTGSTELNSVTTVDSIPLETLSLNGNQKSPNGISNGQDLNGKEHNEEQSNSEVSSDTETI 60

Query: 61  NSENDQNQNQNRVIYLRIDNLPPGKTWKQIKYLIGGIIHHSNVLQVKLLPPVTSIIPPFV 120
           NSENDQNQNQNRVIYLRIDNLPPGKTWKQIKYLIGGIIHHSNVLQVKLLPPVTSIIPPFV
Sbjct: 61  NSENDQNQNQNRVIYLRIDNLPPGKTWKQIKYLIGGIIHHSNVLQVKLLPPVTSIIPPFV 120

Query: 121 TFQSCLVILRGSLNPNALNKLIRTLNTYQWDYFDLYVYELPILNPMFPNKNSDNGIPPSN 180
           TFQSCLVILRGSLNPNALNKLIRTLNTYQWDYFDLYVYELPILNPMFPNKNSDNGIPPSN
Sbjct: 121 TFQSCLVILRGSLNPNALNKLIRTLNTYQWDYFDLYVYELPILNPMFPNKNSDNGIPPSN 180

Query: 181 STLPISPLLQRPQTLFSPQMQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           STLPISPLLQRPQTLFSPQMQGT                                     
Sbjct: 181 STLPISPLLQRPQTLFSPQMQGTPISKNVPGPPPPPPPGPPQPNQMSQSPHSQPHPPISV 240

Query: 241 ANMQXXXXXXXXXXXXXXXSNNFSGKIVQXXXXXXXXXXXXTSSSVSRFVNAYNNSASQR 300
           ANMQ               SNNFSGKIVQ            TSSSVSRFVNAYNNSASQR
Sbjct: 241 ANMQPPPSPFPPAYPFLMPSNNFSGKIVQPLPPPPPPAPPATSSSVSRFVNAYNNSASQR 300

Query: 301 QYNPRAFDGHNIIQRKSISNQYLTSQNKTNKSRFKMFKNIFNENAFRKQMTNRGMFQIRL 360
           QYNPRAFDGHNIIQRKSISNQYLTSQNKTNKSRFKMFKNIFNENAFRKQMTNRGMFQIRL
Sbjct: 301 QYNPRAFDGHNIIQRKSISNQYLTSQNKTNKSRFKMFKNIFNENAFRKQMTNRGMFQIRL 360

Query: 361 ENFPPYFQIESLRLLENNQNIKINDYKDTVILPNRDAMGKYCRLKWTILKDFIKLKCPKL 420
           ENFPPYFQIESLRLLENNQNIKINDYKDTVILPNRDAMGKYCRLKWTILKDFIKLKCPKL
Sbjct: 361 ENFPPYFQIESLRLLENNQNIKINDYKDTVILPNRDAMGKYCRLKWTILKDFIKLKCPKL 420

Query: 421 LELDKKRSMNAPTLTAGYSGMSQNEHRDVKNNTREFYVGVYEYETTKFLLRFQSEPAEKT 480
           LELDKKRSMNAPTLTAGYSGMSQNEHRDVKNNTREFYVGVYEYETTKFLLRFQSEPAEKT
Sbjct: 421 LELDKKRSMNAPTLTAGYSGMSQNEHRDVKNNTREFYVGVYEYETTKFLLRFQSEPAEKT 480

Query: 481 YSITGILYKAVIGFHDKEYCDLCLKLLQDQEYSQGYKLRVXXXXXXXXXXXXXXXXXXXX 540
           YSITGILYKAVIGFHDKEYCDLCLKLLQDQEYSQGYKLRV                    
Sbjct: 481 YSITGILYKAVIGFHDKEYCDLCLKLLQDQEYSQGYKLRVLELPPFEEEEDSGEDEFTEQ 540

Query: 541 XQAQEALVIDANNHSTVDESKIK 563
            QAQEALVIDANNHSTVDESKIK
Sbjct: 541 EQAQEALVIDANNHSTVDESKIK 563

>YIL055C (YIL055C) [2613] chr9 complement(252040..253923) Protein of
           unknown function [1884 bp, 627 aa]
          Length = 627

 Score =  160 bits (406), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 134/246 (54%), Gaps = 53/246 (21%)

Query: 325 SQNKTNKSRFKMFKNIFNENAFRKQMTNRGMFQIRLENFPPYFQIESL-RLLENNQNIKI 383
           SQ + N  R K   +IFNE +FRKQMTNRGM+Q+++ NFPPY  IE L +L E++ N  +
Sbjct: 367 SQTQINHKRLK---HIFNEKSFRKQMTNRGMWQLKIINFPPYIPIEFLEKLSESDFNELM 423

Query: 384 NDYKDTVI-LPNRDAMGKYCRLKWTILKDFIKLKCPKLLELDKKR-------------SM 429
           N  K TVI +  +  + K+ RL+WT+LKDFIKLKCPKLL L +++             SM
Sbjct: 424 NQEKFTVIEIKEKGQLEKFGRLRWTVLKDFIKLKCPKLLRLQERQFLQQQNEASLLNESM 483

Query: 430 NAPTL--------TAGYSGMSQNEHRDVKNNTREFYVGVYEYETTKFLLRF--------- 472
           +A  +        +A  S  +    R   NNTREFYVGVYE      LLRF         
Sbjct: 484 DALKISENENTNGSANNSTYTNGGPRTSINNTREFYVGVYEDHEEATLLRFELPEDELEE 543

Query: 473 ------------------QSEPAEKTYSITGILYKAVIGFHDKEYCDLCLKLLQDQEYSQ 514
                             + +   K + ++ I+Y A++GFHDKE  DL  + LQDQEYS 
Sbjct: 544 FNRNLPTTFAQSGNVSDSEGDSKAKYFKVSTIVYNAIVGFHDKELSDLTFESLQDQEYSL 603

Query: 515 GYKLRV 520
           GYK+ V
Sbjct: 604 GYKIHV 609

 Score =  136 bits (342), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 101/153 (66%), Gaps = 7/153 (4%)

Query: 54  SSDTETINSENDQNQNQNRVIYLRIDNLPPGKTWKQIKYLIGGIIHHSNVLQVKLLPPVT 113
           SS   T  +   +  +Q+  I +RIDNLPPGKTW Q+KYLIGGII+H+N+LQVK+LPP+T
Sbjct: 26  SSTASTKAAPRKKTYSQSNGIPIRIDNLPPGKTWAQVKYLIGGIIYHTNILQVKMLPPMT 85

Query: 114 SIIPPFVTFQSCLVILRGSLNPNALNKLIRTLNTYQWDYFDLYVYELPILN-------PM 166
           S++PPF+TFQSC+VIL+ S++  +L  L+ TLNTYQWDY DL+VY LP  N       P 
Sbjct: 86  SMVPPFITFQSCIVILKNSIDNESLENLLLTLNTYQWDYHDLFVYLLPYTNDSPSLRYPE 145

Query: 167 FPNKNSDNGIPPSNSTLPISPLLQRPQTLFSPQ 199
             + N+D    P  +   ISP      +  +PQ
Sbjct: 146 ISDSNNDVRSAPDETKRSISPRYASHVSSVTPQ 178

>CAGL0M12474g 1240726..1242060 similar to sp|P40523 Saccharomyces
           cerevisiae YIL055c, hypothetical start
          Length = 444

 Score =  154 bits (389), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 125/217 (57%), Gaps = 34/217 (15%)

Query: 318 ISNQYLTSQN-KTNKSRFKMFKNIFNENAFRKQMTNRGMFQIRLENFPPYFQIESLRLLE 376
           IS   L ++N   N +R K    IFNE +FRKQMTNRGM+Q++LENFPP+ Q++SL  L 
Sbjct: 235 ISKDMLRTKNPDANSTRLK---QIFNEISFRKQMTNRGMWQLKLENFPPFIQLDSLEPL- 290

Query: 377 NNQNIKINDYKDTVILPNRDAMGKYCRLKWTILKDFIKLKCPKLLELDKKRSMNAPTLTA 436
           + Q  K+    D  I+   + + K+ RL+W+ILKD+IKLKCPKLL L       + T+  
Sbjct: 291 SPQEPKV----DVDIVLESNKIEKFGRLRWSILKDYIKLKCPKLLSL-----CESSTVDT 341

Query: 437 GYSGMSQNEHRDVKNNTREFYVGVYE------------YETTK-FLLRFQSEPAEKTYSI 483
           G   +  N      NNTREFYVGVYE             ET K ++     EP    Y  
Sbjct: 342 GNGVLVSN-----VNNTREFYVGVYEDHEEQKVIDVINPETDKNYVGNISIEPGR--YRA 394

Query: 484 TGILYKAVIGFHDKEYCDLCLKLLQDQEYSQGYKLRV 520
             + Y AV+GFHDKE CDLCL  LQ QEY  GYKL+ 
Sbjct: 395 KVVRYSAVVGFHDKEICDLCLTALQGQEYLLGYKLQA 431

 Score =  113 bits (282), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 77/109 (70%), Gaps = 2/109 (1%)

Query: 73  VIYLRIDNLPPGKTWKQIKYLIGGIIHHSNVLQVKLLPPVTSIIPPFVTFQSCLVILRGS 132
           V+++RIDNLPP K+W Q++ L+G I+  S VLQVK+LPP++S++PPF   +SC+V L+G+
Sbjct: 2   VLHVRIDNLPPDKSWSQVRQLVGSIVPPSLVLQVKMLPPMSSMVPPFQLIKSCVVTLKGN 61

Query: 133 LNPNALNKLIRTLNTYQWDYFDLYVYELPILNPMFPNKNSDNGIPPSNS 181
           ++   L  L+  +N+YQWDYFDLY Y +P   PM  N +  N  P S S
Sbjct: 62  IDQMTLQNLLMGINSYQWDYFDLYGYVIPY--PMDMNVDYSNSNPLSTS 108

>Kwal_23.5840
          Length = 368

 Score =  135 bits (340), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 94/146 (64%), Gaps = 14/146 (9%)

Query: 67  NQNQNRVIYLRIDNLPPGKTWKQIKYLIGGIIHHSNVLQVKLLPPVTSIIPPFVTFQSCL 126
            Q + +V Y+RIDNLPPGKTW+Q+KYL+GG+IHHS++LQVK+LPPV SI+PPF+ FQS +
Sbjct: 2   EQAETQVAYIRIDNLPPGKTWRQVKYLVGGMIHHSSILQVKMLPPVQSIVPPFIPFQSSI 61

Query: 127 VILRGSLNPNALNKLIRTLNTYQWDYFDLYVYELPILNPMFPNKNSDNGI----PPSNST 182
           V L+ +  P  LN+L+  LN Y W+Y+ L  Y +P L+    ++   NG     P S ++
Sbjct: 62  VSLKRADEP--LNRLLLELNGYMWEYYRLVAYAVPPLHTPSGSQGFSNGAQAFSPHSQAS 119

Query: 183 LPISPLLQRP--------QTLFSPQM 200
           +P  P    P        Q +F PQ+
Sbjct: 120 MPSPPHSAPPMLMPFNPMQAMFFPQL 145

 Score =  122 bits (306), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 109/228 (47%), Gaps = 70/228 (30%)

Query: 335 KMFKNIFNENAFRKQMTNRGMFQIRLENFPP--YFQIESLRLLENNQNIKINDYKDTVIL 392
           K  + +F++ +FR+QM+ RGM Q+ LE FPP  ++ +  +      Q+ +    K     
Sbjct: 161 KKMRQVFSKESFRRQMSARGMCQLLLEGFPPCLHWDVNGVYRASTQQSSESAALKIATAH 220

Query: 393 PNRDAMGKYCRLKWTILKDFIKLKCPKLLELDKKRSMNAPTLTAGYSGMSQNEHRDVKNN 452
           P       + +LKWT+LKDFIKLKC  LLE+D          +AG            K N
Sbjct: 221 PEH-----FGKLKWTVLKDFIKLKCHNLLEMD----------SAG-----------AKPN 254

Query: 453 TREFYVGVYE------------------------------YET----------TKFLLRF 472
           TREFYVGVYE                              +ET          T  L + 
Sbjct: 255 TREFYVGVYEDSEMKVDVEVLPESKSDGVASPDSESVSEGHETENQKKDLEQITDGLKQV 314

Query: 473 QSEPAEKTYSITGILYKAVIGFHDKEYCDLCLKLLQDQEYSQGYKLRV 520
             EP  +  S T  +YKA++GFH +E C++C++ LQDQEYS GYKL+V
Sbjct: 315 SLEPDHRVVSAT--IYKAIVGFHSRELCEMCIESLQDQEYSLGYKLKV 360

>ADL068W [1673] [Homologous to ScYIL055C - SH]
           complement(559296..560495) [1200 bp, 399 aa]
          Length = 399

 Score =  125 bits (315), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/233 (34%), Positives = 111/233 (47%), Gaps = 65/233 (27%)

Query: 335 KMFKNIFNENAFRKQMTNRGMFQIRLENFPPYFQIESLRL-----LENNQNIKINDYKDT 389
           K    IFNE AFR+QM+ R M Q+++ NFPP    + +       L++  +I+  D    
Sbjct: 176 KRLTQIFNEGAFRRQMSQRNMHQLQISNFPPCLHWDEVVKTTQIKLDSGGDIQRGDGGAA 235

Query: 390 V-----------------ILPNRDAMG----KYCRLKWTILKDFIKLKCPKLLELDKKRS 428
           +                 I+P+   M     KY +LKWTILKDFIKLKCPKLLE+D K  
Sbjct: 236 IPSHHVIQPHVLQDEKNEIVPDLTIMTAHPEKYGKLKWTILKDFIKLKCPKLLEIDHKSQ 295

Query: 429 MNAPTLTAGYSGMSQNEHRDVKNNTREFYVGVYE-YETTKFLLRFQSE------------ 475
             A                   +NTREFYVGVYE  E+   ++   S+            
Sbjct: 296 GAA------------------LSNTREFYVGVYENSESHVEIILLPSDKPDRIIEGPVSE 337

Query: 476 --------PAEKTYSITGILYKAVIGFHDKEYCDLCLKLLQDQEYSQGYKLRV 520
                   P  + + +   L++AV+GFH KE CDLCL  +  +EY  GYKL+V
Sbjct: 338 EEAQAAGGPDLQRFKVRATLFQAVLGFHSKELCDLCLDAINGEEYMLGYKLQV 390

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 3/88 (3%)

Query: 74  IYLRIDNLPPGKTWKQIKYLIGGIIHHSNVLQVKLLPPVTSIIPPFVTFQSCLVILRGSL 133
           I +RIDNLPP K W+QIK  +   + +  VL VK+LP + S+ PPF+  QSC+V+LR   
Sbjct: 25  IRIRIDNLPPTKGWRQIKGFLSQFVPYEQVLNVKVLPLIPSMTPPFIPLQSCIVLLRQDT 84

Query: 134 NPNALNKLIRTLNTYQWDYFDLYVYELP 161
           +      L+  LN  QWDY+ +  + LP
Sbjct: 85  D---WPGLLMHLNGIQWDYYTMMAWVLP 109

>KLLA0C08173g complement(717235..718728) some similarities with
           sp|P40523 Saccharomyces cerevisiae YIL055c hypothetical
           protein singleton, hypothetical start
          Length = 497

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 54/82 (65%), Gaps = 3/82 (3%)

Query: 74  IYLRIDNLPPGKTWKQIKYLIGGIIHHSNVLQVKLLPPVTSIIPPFVTFQSCLVILRGSL 133
           +Y+RIDN+P GK WKQI+Y +   I  + +L +K+LP + ++ PPF+   SC+ +L+ SL
Sbjct: 20  VYIRIDNIPQGKDWKQIRYFLSKFILRNQILNIKVLPSMPTMTPPFIPITSCICVLQPSL 79

Query: 134 NPNALNKLIRTLNTYQWDYFDL 155
           +    N L+  LN +QW+Y  L
Sbjct: 80  D---WNNLLLQLNGFQWEYHTL 98

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 32/132 (24%)

Query: 335 KMFKNIFNENAFRKQMTNRGMFQIRLENFPPYFQIESLRLLEN----NQNIKINDYKDTV 390
           +  K +FNE +FRKQM++R M+QI+  NFPP    + +   +      Q++       ++
Sbjct: 198 RKLKQLFNEMSFRKQMSSRSMYQIKFTNFPPCLHWDEIVKFKTTGIAGQHVTRASSVPSL 257

Query: 391 ILPNRDAMGKYCRLKWTILKDFIKLKCPKLLELDKKRSMNAPTLTAGYSGMSQNEHRDVK 450
           I+   +    Y +LKWT+LKDFIK  CP+L E                            
Sbjct: 258 IVKTTEP-ETYGKLKWTMLKDFIKSNCPELFE---------------------------N 289

Query: 451 NNTREFYVGVYE 462
            ++ EFYVGVYE
Sbjct: 290 TSSFEFYVGVYE 301

>Scas_594.1
          Length = 651

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 372 LRLLENNQNIKINDYKDTVILPNRDAMGKYCRLKWTILKDFIKLKCPKLLELDKKRS 428
           L+L E    +K+ D + TV+LP    MGKYC +    LKD   LK   ++ L ++++
Sbjct: 248 LKLKEQETILKLTDLETTVLLP-LARMGKYCEVVKLRLKDLKSLKKDYMIYLQERKT 303

>Scas_554.3
          Length = 279

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 20/80 (25%)

Query: 354 GMFQIRLENFPPYFQIESLRLLENNQNIKINDYKDTVILPNRDAMGKYCRLKWTILKDFI 413
           G++ +RL NF PY QI  LR L        N + + +   +++        KW I+K FI
Sbjct: 219 GIYWLRL-NFSPYAQITFLRTL--------NKFDEQIPAKHKN--------KWEIIKRFI 261

Query: 414 KLKCPKLLELDKKRSMNAPT 433
            LK     E +K+  M A T
Sbjct: 262 YLKMK---EHEKRSRMYAST 278

>YGR026W (YGR026W) [1993] chr7 (532987..533823) Protein of unknown
           function, has low similarity to uncharacterized C.
           albicans Orf6.5843p [837 bp, 278 aa]
          Length = 278

 Score = 29.6 bits (65), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 17/64 (26%)

Query: 354 GMFQIRLENFPPYFQIESLRLLENNQNIKINDYKDTVILPNRDAMGKYCRLKWTILKDFI 413
           G++ +RL NF PY Q+  L LL   +      Y+D                KW ++K+FI
Sbjct: 218 GIYWLRL-NFSPYAQVAVLELLVKFEKYVPKKYRD----------------KWQVIKNFI 260

Query: 414 KLKC 417
            +K 
Sbjct: 261 YMKM 264

>YBR060C (ORC2) [251] chr2 complement(360612..362474) Origin
           recognition complex, 72 kDa subunit, functions in
           pre-replication complex formation, which is essential
           for proper DNA replication initiation [1863 bp, 620 aa]
          Length = 620

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 307 FDGHNIIQRKSISNQYLTSQNKTNKSRFKMFKNIFNENAFRKQMTNRGMFQIRLENFPPY 366
           FD   I++  + S   ++      +  F +  N FNEN F+K+   + +F+I+ + FP Y
Sbjct: 247 FDQRKIVRTNAKSRHTMSMAPDVTREEFSLVSNFFNEN-FQKR-PRQKLFEIQKKMFPQY 304

Query: 367 F 367
           +
Sbjct: 305 W 305

>AER304C [2806] [Homologous to ScYDR457W (TOM1) - SH]
            (1194908..1204684) [9777 bp, 3258 aa]
          Length = 3258

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 7/113 (6%)

Query: 343  ENAFRKQMTN--RGMFQIRLENFPPYFQIESLRLLENNQ-NIKINDYKDTVILPNRDAMG 399
            + + + QM N  +G + I  ++    F  + L LL +   +I ++D+K+  I  N     
Sbjct: 3100 QTSVKDQMENFLQGFYAIIPKDLISIFDEQELELLVSGLPDIDVDDWKNNTIYVNYTPTC 3159

Query: 400  KYCRLKWTILKDFIKLKCPKLLEL---DKKRSMNAPTLTAGYSGMSQ-NEHRD 448
            K     W  ++ F K +  KLL+      K  +N     +G +G+S+ + HRD
Sbjct: 3160 KQINYFWRAVRSFDKEERAKLLQFVTGTSKVPLNGFKELSGVNGISKFSIHRD 3212

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.315    0.132    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 17,320,358
Number of extensions: 788559
Number of successful extensions: 4309
Number of sequences better than 10.0: 76
Number of HSP's gapped: 4379
Number of HSP's successfully gapped: 96
Length of query: 563
Length of database: 16,596,109
Length adjustment: 107
Effective length of query: 456
Effective length of database: 12,891,983
Effective search space: 5878744248
Effective search space used: 5878744248
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)