Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_701.825023712441e-176
YIL053W (RHR2)27123710921e-152
CAGL0M11660g24823510531e-146
YER062C (HOR2)25023710511e-146
CAGL0M12430g24923310391e-144
Kwal_23.583124923310261e-142
KLLA0C08217g2562329931e-137
Scas_704.322472339711e-134
ADL071C2532329441e-130
CAGL0I05874g2472329261e-127
Sklu_2394.32432263493e-40
CAGL0D04092g2512383433e-39
CAGL0M12925g2462233433e-39
Scas_690.302592263304e-37
YHR043C (DOG2)2462233215e-36
YHR044C (DOG1)2462223102e-34
Scas_690.312442243051e-33
KLLA0C11143g2682263061e-33
AAL123W2892383011e-32
CAGL0L01969g237228820.015
Kwal_26.8080223111800.021
Scas_625.3223113730.21
KLLA0F25696g222112720.25
Scas_694.4059731643.0
YDL107W (MSS2)35175616.4
YDR239C78790617.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_701.8
         (250 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_701.8                                                            483   e-176
YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphat...   425   e-152
CAGL0M11660g complement(1158566..1159312) highly similar to sp|P...   410   e-146
YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycero...   409   e-146
CAGL0M12430g complement(1238150..1238899) highly similar to sp|P...   404   e-144
Kwal_23.5831                                                          399   e-142
KLLA0C08217g 721753..722523 highly similar to sp|P41277 Saccharo...   387   e-137
Scas_704.32                                                           378   e-134
ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C (...   368   e-130
CAGL0I05874g complement(558102..558845) highly similar to sp|P41...   361   e-127
Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement        139   3e-40
CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces c...   136   3e-39
CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces...   136   3e-39
Scas_690.30                                                           131   4e-37
YHR043C (DOG2) [2331] chr8 complement(192797..193537) 2-Deoxyglu...   128   5e-36
YHR044C (DOG1) [2332] chr8 complement(194060..194800) 2-Deoxyglu...   124   2e-34
Scas_690.31                                                           122   1e-33
KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces c...   122   1e-33
AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DO...   120   1e-32
CAGL0L01969g 228760..229473 similar to tr|Q86ZR7 Saccharomyces c...    36   0.015
Kwal_26.8080                                                           35   0.021
Scas_625.3                                                             33   0.21 
KLLA0F25696g 2386886..2387554 similar to sp|O59760 Schizosacchar...    32   0.25 
Scas_694.40                                                            29   3.0  
YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in t...    28   6.4  
YDR239C (YDR239C) [1074] chr4 complement(941049..943412) Protein...    28   7.4  

>Scas_701.8
          Length = 250

 Score =  483 bits (1244), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 237/237 (100%), Positives = 237/237 (100%)

Query: 1   MGLTTKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 60
           MGLTTKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD
Sbjct: 1   MGLTTKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 60

Query: 61  AIAKFAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTRE 120
           AIAKFAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTRE
Sbjct: 61  AIAKFAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTRE 120

Query: 121 MATKWFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDA 180
           MATKWFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDA
Sbjct: 121 MATKWFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDA 180

Query: 181 PAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
           PAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF
Sbjct: 181 PAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237

>YIL053W (RHR2) [2614] chr9 (255050..255865) DL-glycerol phosphate
           phosphatase (sn-glycerol-3-phosphatase) [816 bp, 271 aa]
          Length = 271

 Score =  425 bits (1092), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 218/237 (91%), Positives = 225/237 (94%)

Query: 1   MGLTTKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 60
           M LTTKPLSLK+NAALFDVDGTIIISQ AIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD
Sbjct: 22  MPLTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 81

Query: 61  AIAKFAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTRE 120
           AIAKFAPDFADEE V+KLEGEIPEKYGEHSIEVPGAVKLCN LN LPKEKWAVATSGTR+
Sbjct: 82  AIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRD 141

Query: 121 MATKWFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDA 180
           MA KWFD+LKIKRP+YFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSK +VFEDA
Sbjct: 142 MAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDA 201

Query: 181 PAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
           PAGI AGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVG Y+  TDEVE IF
Sbjct: 202 PAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIF 258

>CAGL0M11660g complement(1158566..1159312) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 248

 Score =  410 bits (1053), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 208/235 (88%), Positives = 223/235 (94%)

Query: 3   LTTKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAI 62
           ++T P+SLKVNAALFDVDGTIIISQ AIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAI
Sbjct: 1   MSTSPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAI 60

Query: 63  AKFAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMA 122
           AKFAPD+ADEE V+KLEGEIPEKYGEHSIEVPGAVKLC DLNKLPKEKWAVATSGTR+MA
Sbjct: 61  AKFAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMA 120

Query: 123 TKWFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPA 182
            KWF +L I+RP+YFITANDVKQGKP PEPYLKGR GLGFPIN++DPSKSK +VFEDAPA
Sbjct: 121 QKWFKILNIERPEYFITANDVKQGKPFPEPYLKGREGLGFPINKEDPSKSKVVVFEDAPA 180

Query: 183 GIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
           GI AGKAAGCKI+GIATTFD+DFLKEKGCDIIVKNHESIRVGGY+P TDEVEFIF
Sbjct: 181 GIAAGKAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIF 235

>YER062C (HOR2) [1493] chr5 complement(279928..280680) DL-glycerol
           phosphate phosphatase (sn-glycerol-3-phosphatase) [753
           bp, 250 aa]
          Length = 250

 Score =  409 bits (1051), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 210/237 (88%), Positives = 222/237 (93%)

Query: 1   MGLTTKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD 60
           MGLTTKPLSLKVNAALFDVDGTIIISQ AIAAFWRDFGKDKPYFDAEHVI +SHGWRT+D
Sbjct: 1   MGLTTKPLSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIQVSHGWRTFD 60

Query: 61  AIAKFAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTRE 120
           AIAKFAPDFA+EE V+KLE EIP KYGE SIEVPGAVKLCN LN LPKEKWAVATSGTR+
Sbjct: 61  AIAKFAPDFANEEYVNKLEAEIPVKYGEKSIEVPGAVKLCNALNALPKEKWAVATSGTRD 120

Query: 121 MATKWFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDA 180
           MA KWF+ L I+RP+YFITANDVKQGKPHPEPYLKGRNGLG+PINEQDPSKSK +VFEDA
Sbjct: 121 MAQKWFEHLGIRRPKYFITANDVKQGKPHPEPYLKGRNGLGYPINEQDPSKSKVVVFEDA 180

Query: 181 PAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
           PAGI AGKAAGCKI+GIATTFDLDFLKEKGCDIIVKNHESIRVGGY+  TDEVEFIF
Sbjct: 181 PAGIAAGKAAGCKIIGIATTFDLDFLKEKGCDIIVKNHESIRVGGYNAETDEVEFIF 237

>CAGL0M12430g complement(1238150..1238899) highly similar to
           sp|P41277 Saccharomyces cerevisiae YIL053w RHR2 or
           sp|P40106 Saccharomyces cerevisiae YER062c GPP2,
           hypothetical start
          Length = 249

 Score =  404 bits (1039), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 205/233 (87%), Positives = 219/233 (93%)

Query: 5   TKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 64
            KP+SLKVNAALFDVDGTIIISQ AIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK
Sbjct: 4   AKPVSLKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 63

Query: 65  FAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATK 124
           FAPD+ADEE V+KLEGEIPEKYGEHSIEVPGAVKLC DLNKLPKEKWAVATSGTR+MA K
Sbjct: 64  FAPDYADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCTDLNKLPKEKWAVATSGTRDMAQK 123

Query: 125 WFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGI 184
           WF  L I RP+YFITANDVKQGKP PEPY+KGR GLG+PIN++DPSKSK +VFEDAPAGI
Sbjct: 124 WFKFLNIDRPEYFITANDVKQGKPFPEPYIKGREGLGYPINKEDPSKSKVVVFEDAPAGI 183

Query: 185 VAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
            AG+AAGCKI+GIATTFD+DFLKEKGCDIIVKNHESIRVGGY+P TDEVEFIF
Sbjct: 184 AAGQAAGCKIIGIATTFDVDFLKEKGCDIIVKNHESIRVGGYNPETDEVEFIF 236

>Kwal_23.5831
          Length = 249

 Score =  399 bits (1026), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 207/233 (88%), Positives = 217/233 (93%)

Query: 5   TKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 64
           +KPLS KVNAALFDVDGTIIISQ AIAAFWRDFGKDKPYFDAEHVIH SHGWRTYDAIAK
Sbjct: 4   SKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHESHGWRTYDAIAK 63

Query: 65  FAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATK 124
           FAPDFADE+  ++LE EIPEKYGEHSIEVPGAVKLC DLN LPKEKWAVATSGTR MA+K
Sbjct: 64  FAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCKDLNALPKEKWAVATSGTRPMASK 123

Query: 125 WFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGI 184
           WF+ L I++P+YFITANDVKQGKP PEPYLKGRNGLGFPINEQDPSKSK IVFEDAPAGI
Sbjct: 124 WFEHLGIEKPEYFITANDVKQGKPFPEPYLKGRNGLGFPINEQDPSKSKVIVFEDAPAGI 183

Query: 185 VAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
            AGKAAGCKIVGIATTFDLDFLKEKGCDIIVK+HESIRVGGYD  TDEVEFIF
Sbjct: 184 AAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKDHESIRVGGYDAETDEVEFIF 236

>KLLA0C08217g 721753..722523 highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 DL-glycerol
           phosphatase, start by similarity
          Length = 256

 Score =  387 bits (993), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 207/232 (89%)

Query: 6   KPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 65
           +P+SL+VNAALFDVDGT+IISQ AIA FWRDFGKDKPYFD++HVI ISHGWRTYD I +F
Sbjct: 12  QPISLRVNAALFDVDGTLIISQPAIAEFWRDFGKDKPYFDSQHVIDISHGWRTYDVIKQF 71

Query: 66  APDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATKW 125
           APD+A+EE V+KLEGEIPEK+G+H+IEVPGA KLC +LNKLPKEKWAVATSGT EMA KW
Sbjct: 72  APDYANEEYVTKLEGEIPEKFGQHAIEVPGASKLCGELNKLPKEKWAVATSGTYEMAHKW 131

Query: 126 FDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGIV 185
           FD+L IKRP  FITANDVK GKPHPEPYLKGRNGL +PIN+++P+ SK IVFEDAPAGI+
Sbjct: 132 FDILGIKRPSNFITANDVKNGKPHPEPYLKGRNGLSYPINKENPAASKVIVFEDAPAGIL 191

Query: 186 AGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
           AGKAAGCKIVGIATTFD +FL EKGCDI++K+H  +RV  Y P TDEVEFIF
Sbjct: 192 AGKAAGCKIVGIATTFDKEFLIEKGCDIVIKDHTKLRVAAYHPETDEVEFIF 243

>Scas_704.32
          Length = 247

 Score =  378 bits (971), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 175/233 (75%), Positives = 208/233 (89%)

Query: 5   TKPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK 64
             P++L+VNAALFDVDGTIIISQ A+AAFW+ FG+DKPYFDA+ V H +HGWRTYDAI K
Sbjct: 2   NNPIALRVNAALFDVDGTIIISQPALAAFWKHFGEDKPYFDADLVTHATHGWRTYDAIEK 61

Query: 65  FAPDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATK 124
           FAPD+AD E V++LEGEIP K+G+H++EVPGAVKLCN+ NKLPKE+WAVATSGT EMA+K
Sbjct: 62  FAPDWADREYVTQLEGEIPTKFGQHALEVPGAVKLCNEFNKLPKERWAVATSGTFEMASK 121

Query: 125 WFDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGI 184
           WF+LLKI+RP  FITANDV++GKPHP+PYLKGRNGLGFPIN  +PSKSK +VFEDAPAGI
Sbjct: 122 WFELLKIERPTNFITANDVERGKPHPDPYLKGRNGLGFPINATNPSKSKVVVFEDAPAGI 181

Query: 185 VAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
            +GKAAGCKIVG+ATTFD +FLKEKGCD+IV NHESI++ GY P TDE+E +F
Sbjct: 182 ESGKAAGCKIVGVATTFDEEFLKEKGCDLIVSNHESIKLNGYYPETDEIELVF 234

>ADL071C [1670] [Homologous to ScYIL053W (RHR2) - SH; ScYER062C
           (HOR2) - SH] (556136..556897) [762 bp, 253 aa]
          Length = 253

 Score =  368 bits (944), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 185/232 (79%), Positives = 208/232 (89%)

Query: 6   KPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 65
           +P+SLKVN ALFDVDGTIIISQ A+AAFWR+FGKDKPYFDAEHVI  +HGWRTYDAIA F
Sbjct: 9   QPISLKVNGALFDVDGTIIISQPALAAFWREFGKDKPYFDAEHVISATHGWRTYDAIATF 68

Query: 66  APDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATKW 125
           APD+  EE V++LEGEIP+KYG+ S+EVPGAV LCN LN+LPKEKWAV TSGT EMA KW
Sbjct: 69  APDYLSEEYVTRLEGEIPDKYGKFSVEVPGAVTLCNALNELPKEKWAVGTSGTFEMAHKW 128

Query: 126 FDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGIV 185
           FD+L IKRP  FITANDVKQGKPHPEPY+KGRN LGFPINEQ+P  SK IVFEDAPAGI 
Sbjct: 129 FDVLGIKRPSTFITANDVKQGKPHPEPYIKGRNALGFPINEQNPKGSKVIVFEDAPAGIA 188

Query: 186 AGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
           AGKAAGCKIVG+ATTFD+++LKE+GCDIIVK+H SIRVGGY+P TDEVEF+F
Sbjct: 189 AGKAAGCKIVGVATTFDVEYLKERGCDIIVKDHRSIRVGGYNPETDEVEFVF 240

>CAGL0I05874g complement(558102..558845) highly similar to sp|P41277
           Saccharomyces cerevisiae YIL053w RHR2 or sp|P40106
           Saccharomyces cerevisiae YER062c GPP2, hypothetical
           start
          Length = 247

 Score =  361 bits (926), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 181/232 (78%), Positives = 206/232 (88%)

Query: 6   KPLSLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKF 65
           +P++L+VNAALFDVDGTIIISQ A+AAFWRDFGKDKPYFDAEHVIH+SHGWRTYDAIAKF
Sbjct: 3   EPITLRVNAALFDVDGTIIISQPALAAFWRDFGKDKPYFDAEHVIHVSHGWRTYDAIAKF 62

Query: 66  APDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATKW 125
           APDFADEE V+KLEGEIP+KYG+ +IEV GAVKLCN  N+LPKEKWAVATSGTREMA+KW
Sbjct: 63  APDFADEETVTKLEGEIPDKYGKEAIEVAGAVKLCNSFNELPKEKWAVATSGTREMASKW 122

Query: 126 FDLLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGIV 185
           F +L IK+P YFITANDVK+GKP+PEPYLKGR GLG+PIN   P KSK +VFEDAPAGI 
Sbjct: 123 FAVLGIKKPTYFITANDVKKGKPNPEPYLKGREGLGYPINTHYPEKSKVVVFEDAPAGIA 182

Query: 186 AGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGYDPVTDEVEFIF 237
           AGKAAGCKI+GIATTF    L+EKGCDI++K+H S+RV GYD  TDEV  +F
Sbjct: 183 AGKAAGCKIIGIATTFSASSLREKGCDIVIKDHRSVRVAGYDKETDEVILVF 234

>Sklu_2394.3 YHR043C, Contig c2394 2120-2851 reverse complement
          Length = 243

 Score =  139 bits (349), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 123/226 (54%), Gaps = 16/226 (7%)

Query: 10  LKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP-- 67
            KVN  LFD+DGTI+ +  A  + W++  K K   D E +   SHG RT +  +KF P  
Sbjct: 4   FKVNLCLFDLDGTIVSTTIAAESAWKELCK-KHGVDPEELFKCSHGARTSEIFSKFFPSI 62

Query: 68  DFADEELVSKLEGEIPEKYGEHSIEVPGAVKL------CND--LNKLPKEKWAVATSGTR 119
           D  D + V KLE  I   Y +    +PGA +L      C+D   +   K KWA+ TSG+ 
Sbjct: 63  DNTDNQAVKKLELAIAHDYLDSVGLIPGASELLLSLDKCSDPPFDNFSKRKWAIVTSGSS 122

Query: 120 EMATKWFD--LLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVF 177
           ++A  WFD  L  I +P  FITA DV +GKP PE Y K R+ L    + + P   + +VF
Sbjct: 123 DLAFSWFDTILQHIGKPDVFITAFDVVKGKPDPEGYSKARDQLSKIWSLEFP---EIVVF 179

Query: 178 EDAPAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRV 223
           EDAP GI AGK  G   VGI +T+  D L E G D +V +  ++ V
Sbjct: 180 EDAPVGIKAGKEIGAITVGITSTYSKDVLFEAGADYVVSDLTNVIV 225

>CAGL0D04092g 405613..406368 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 251

 Score =  136 bits (343), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 89/238 (37%), Positives = 128/238 (53%), Gaps = 17/238 (7%)

Query: 12  VNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP--DF 69
           V+  LFD+DGTI+ +  A  + WR     K   D E +   SHG RT + +AKF P  D 
Sbjct: 11  VDVCLFDLDGTIVSTTVAAESAWRMLCA-KEGVDPEELFKFSHGVRTSEVLAKFFPNIDN 69

Query: 70  ADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNK--------LPKEKWAVATSGTREM 121
            D ++  +LE  +   + +    +PGA  L   L+K          + KWA+ TSG+ ++
Sbjct: 70  TDNKMTRELELSMANNFLDTVSLIPGAKDLLLTLDKDTARQGAKFNERKWAIVTSGSPDL 129

Query: 122 ATKWFD--LLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFED 179
           A  WF   L ++ +P  FITA DV +GKP PE Y K +  L   +  +  S + ++VFED
Sbjct: 130 AFSWFKTILKEVGKPDVFITAFDVTKGKPDPEGYAKAKKLLCERLQYESASAT-SVVFED 188

Query: 180 APAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGGY---DPVTDEVE 234
           APAGI AGKA G   VGI +T+DL  L + G D +VK+   + V      D +T E+E
Sbjct: 189 APAGIKAGKAMGAITVGITSTYDLQTLIDAGADYVVKDLTQVEVLKNTEGDQITLEIE 246

>CAGL0M12925g 1274919..1275659 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, hypothetical start
          Length = 246

 Score =  136 bits (343), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 119/223 (53%), Gaps = 14/223 (6%)

Query: 12  VNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDFAD 71
           V+  LFD+DGTI+ +  A+   W+    +    D E +   SHG RT +  AKF PD  +
Sbjct: 7   VDLCLFDLDGTIVSTTRAVEMTWKKLCAEHD-VDPEELFRFSHGTRTGEVFAKFFPDIDN 65

Query: 72  --EELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNK-------LPKEKWAVATSGTREMA 122
                    E  I +     S+ +PGA +L   L+K       + + KWA+ TSG+ E+ 
Sbjct: 66  TGNRAAVAFELSIADDLSLISL-IPGAQELLLKLDKNTTDGSAVGERKWAIVTSGSPELT 124

Query: 123 TKWFD--LLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDA 180
             WFD  L ++ RP  FI+  DV +GKP PE Y  GRN L   +   D S ++ +VFEDA
Sbjct: 125 LSWFDNVLKEVGRPPVFISGADVAKGKPDPEGYYTGRNLLCQKLG-LDASHARTVVFEDA 183

Query: 181 PAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRV 223
           P GI+AGKA G   VGIA T+D D L   G D +V +   ++V
Sbjct: 184 PVGIMAGKAIGAITVGIAGTYDKDLLYSAGADYVVSDLNQVKV 226

>Scas_690.30
          Length = 259

 Score =  131 bits (330), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 122/226 (53%), Gaps = 13/226 (5%)

Query: 9   SLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP- 67
           S  V+  LFD+DGT++ +  A  A W D   +      E   H SHG +T + +A++ P 
Sbjct: 5   SFNVDVCLFDLDGTLVNTIKASEAVWTDLCNEHGVNPQELFKH-SHGVKTSEVLAEWFPM 63

Query: 68  -DFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLN-------KLPKEKWAVATSGTR 119
            D  D++ V  LE  +   +      VPGA+ L   L+       K   +KWA+ TSG+ 
Sbjct: 64  LDNTDDKAVKYLEESMGRDHLSSVFAVPGAIDLLKQLDIDTDTGKKFKDKKWAIVTSGST 123

Query: 120 EMATKWFD--LLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVF 177
            +A  WF   L ++++P+ F+TA DVK GKP PE Y K R+ L    N  D   +K++VF
Sbjct: 124 YIAFGWFKSILSELEKPEVFVTAFDVKNGKPDPEGYSKARDELCKTWN-FDVKTAKSVVF 182

Query: 178 EDAPAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRV 223
           EDAP GI AGKA G   VGI +T+D   L + G D +V++   I +
Sbjct: 183 EDAPVGIQAGKAMGAITVGITSTYDKKVLFDAGADYVVRDLSQITI 228

>YHR043C (DOG2) [2331] chr8 complement(192797..193537)
           2-Deoxyglucose-6-phosphate phosphatase, converts
           2-deoxy-D-glucose 6-phosphate to 2-deoxy-D-glucose and
           orthophosphate [741 bp, 246 aa]
          Length = 246

 Score =  128 bits (321), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 117/223 (52%), Gaps = 12/223 (5%)

Query: 12  VNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP--DF 69
           V+  LFD+DGTI+ +  A  + W+   +       E   H SHG R+ + + KF P  D 
Sbjct: 6   VDLCLFDLDGTIVSTTTAAESAWKKLCRQHGVDPVELFKH-SHGARSQEMMKKFFPKLDN 64

Query: 70  ADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLN-------KLPKEKWAVATSGTREMA 122
            D + V  LE ++ + Y +    +PGA  L   L+       KLP+ KWA+ TSG+  +A
Sbjct: 65  TDNKGVLALEKDMADNYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLA 124

Query: 123 TKWFD--LLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDA 180
             WF+  L  + +P+ FIT  DVK GKP PE Y + R+ L   +        K +VFEDA
Sbjct: 125 FSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDA 184

Query: 181 PAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRV 223
           P GI AGKA G   VGI +++D   L + G D +V +   + V
Sbjct: 185 PVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSV 227

>YHR044C (DOG1) [2332] chr8 complement(194060..194800)
           2-Deoxyglucose-6-phosphate phosphatase [741 bp, 246 aa]
          Length = 246

 Score =  124 bits (310), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 114/222 (51%), Gaps = 12/222 (5%)

Query: 13  NAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP--DFA 70
           +  LFD+DGTI+ +  A    W     +     +E   H SHG RT + + +F P  D  
Sbjct: 7   DLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKH-SHGARTQEVLRRFFPKLDDT 65

Query: 71  DEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLN-------KLPKEKWAVATSGTREMAT 123
           D + V  LE +I   Y +    +PGA  L   L+       KLP+ KWA+ TSG+  +A 
Sbjct: 66  DNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAF 125

Query: 124 KWFD--LLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAP 181
            WF+  L  + +P+ FIT  DVK GKP PE Y + R+ L   +        K +VFEDAP
Sbjct: 126 SWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAP 185

Query: 182 AGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRV 223
            GI AGKA G   VGI +++D   L + G D +V +   + V
Sbjct: 186 VGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSV 227

>Scas_690.31
          Length = 244

 Score =  122 bits (305), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 118/224 (52%), Gaps = 11/224 (4%)

Query: 9   SLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP- 67
           +  V+  LFD+DGTI+ +  A+   W  F K K   +AE +   SHG R+ + +A+F P 
Sbjct: 3   TFTVDLCLFDLDGTIVSTTIAVERAWIKFCK-KHNVNAEELFEHSHGARSGEIMARFFPH 61

Query: 68  -DFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNKLP-----KEKWAVATSGTREM 121
            D  D +   +LE  +     +    +PG+ KL   L+K       K KWA+ TSG+  +
Sbjct: 62  VDNTDNKATKELELSMAYDNIDTVSLIPGSEKLLLALDKATTKDATKRKWAIVTSGSPYL 121

Query: 122 ATKWFD--LLKIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFED 179
           A  WFD  L  + +P  FIT  DV++GKP PE Y K R+ L       D    + +VFED
Sbjct: 122 AFSWFDTILKDVGKPDVFITGFDVEKGKPDPEGYGKARDQLCKNWG-PDNKHVRTVVFED 180

Query: 180 APAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRV 223
           AP GI AGKA G   VGI  T+D + L + G D +V +   + V
Sbjct: 181 APVGIKAGKAIGAITVGITFTYDKNLLFDAGADYVVADLTHVSV 224

>KLLA0C11143g 956474..957280 similar to sp|P38773 Saccharomyces
           cerevisiae YHR043c DOG2 2-deoxyglucose-6-phosphate
           phosphatase, start by similarity
          Length = 268

 Score =  122 bits (306), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/226 (35%), Positives = 119/226 (52%), Gaps = 15/226 (6%)

Query: 9   SLKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAP- 67
           S+ V+  LFD+DGT++ S  A    W     DK   D   +  +SHG RT + +AKF P 
Sbjct: 3   SIAVDYVLFDLDGTLVSSTDAAEEAWNKLC-DKYGVDYSTLSKVSHGSRTAEILAKFFPN 61

Query: 68  -DFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNK---------LPKEKWAVATSG 117
            D  + + V + E  I   Y +    +PG++ L   L++             KWAV TSG
Sbjct: 62  VDNTNNQAVKEFELSIANDYMDIVCLIPGSIDLLISLDRPTGAHPGEVFHHRKWAVVTSG 121

Query: 118 TREMATKWFD-LLK-IKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAI 175
           +  +A  WFD LLK IK+P+ FITA DV +GKP P  +      L   I + D  + + +
Sbjct: 122 SPWVAHAWFDNLLKSIKKPEVFITAFDVSKGKPDPAGFALATKRLK-EIWQDDRKEVRTV 180

Query: 176 VFEDAPAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESI 221
           VFEDAP G+ AGKA G  +V + +T+D + L   G D +V++   +
Sbjct: 181 VFEDAPVGVQAGKANGSIVVALTSTYDKELLFAAGADYVVEDLSQV 226

>AAL123W [64] [Homologous to ScYHR043C (DOG2) - SH; ScYHR044C (DOG1)
           - SH] complement(131449..132318) [870 bp, 289 aa]
          Length = 289

 Score =  120 bits (301), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 122/238 (51%), Gaps = 18/238 (7%)

Query: 10  LKVNAALFDVDGTIIISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAKFAPDF 69
           + V+  LFD+DGTI+ +  A+ A W+  G+     DA  +   SHG R  +   ++ PD 
Sbjct: 4   ITVDVCLFDLDGTIVDTTDAVEAAWQKVGR-AHQVDAAKIRRNSHGRRASETFKQYFPDA 62

Query: 70  ADEELVSKLEGEIPEKYGEHSIE-VPGAVKL---------CNDLNKLPKEKWAVATSGTR 119
            ++  V + E  +  +   H +  +PGA  L         CN        +WA+ TS T 
Sbjct: 63  DNDAAVKEFEHALVSQ--SHYVGLIPGANDLLLTLDRPSGCNPGEVFRDNRWAIVTSATP 120

Query: 120 EMATKWFDLL--KIKRPQYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVF 177
            +A  WF+ L  K+K P+ FIT+ DV +GKP PE Y K ++ L   I   +  K +A+VF
Sbjct: 121 SLARSWFNTLLKKVKPPKVFITSADVAKGKPDPEGYQKAKDQLA-DILGLNKDKVRAVVF 179

Query: 178 EDAPAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRV--GGYDPVTDEV 233
           ED+  GI A KA G   VGI +T+  D L   G D +V++   + V   G D +T E+
Sbjct: 180 EDSALGIRAAKAMGAIAVGITSTYSKDVLYRSGADYVVEDLAQVCVMQNGPDGITLEI 237

>CAGL0L01969g 228760..229473 similar to tr|Q86ZR7 Saccharomyces
           cerevisiae YKL033wa, hypothetical start
          Length = 237

 Score = 36.2 bits (82), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 91/228 (39%), Gaps = 23/228 (10%)

Query: 11  KVNAALFDVDGTII----ISQGAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYDAIAK-F 65
           +V A LFD+DG +I    I    +    +++G     +D +  +    G      I + +
Sbjct: 7   RVKACLFDMDGLLINTEDIYTLTLNRILKEYGLGPLTWDVKIQLQGLPGPEAGKKIIETY 66

Query: 66  APDFADEELVSKLEGEIPEKYGEHSIEVPGAVKLCNDLNK------LPKEKWAVATSGTR 119
                 +EL +K   EI   Y   +  +PGA++L   L        L      +   G  
Sbjct: 67  KLPLTPKELETK-NIEIQNDYWPTAAFLPGALELLKYLKSKNIPIALCTSSNKIKFKGKT 125

Query: 120 EMATKWFDLLKIKRPQYFITANDVK----QGKPHPEPYLKGRNGLGFPINEQDPSKSKAI 175
               + F+L         +T +D +    +GKP P+ +  G   L    N    S S+ +
Sbjct: 126 SHLGEGFNLF-----DAIVTGDDERIPSGRGKPFPDVWQVGLKSLNDKFN-TSISPSECL 179

Query: 176 VFEDAPAGIVAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRV 223
           VFED   G+ +G+A G  ++ +     L F+ +   D++    E +  
Sbjct: 180 VFEDGIIGVQSGRAFGAHVIWVPHQESLPFI-DNAADVLQGQGEQLNT 226

>Kwal_26.8080
          Length = 223

 Score = 35.4 bits (80), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 53/111 (47%), Gaps = 19/111 (17%)

Query: 89  HSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATKWFDLLKIKRPQYFITANDVK---- 144
           HS +VP  + LC    K   +K+   TS  +    + FD++        IT +D +    
Sbjct: 90  HSKKVP--IALCTSSGK---QKYIGKTSHLQH-GFELFDVI--------ITGDDPRIPPG 135

Query: 145 QGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGIVAGKAAGCKIV 195
           +GKP+P+ +  G  GL    N  D    + ++FED   G+ + KAAG  ++
Sbjct: 136 RGKPYPDIWQLGLKGLNEKFN-TDIKPEECLIFEDGLPGVTSAKAAGAYVI 185

>Scas_625.3
          Length = 223

 Score = 32.7 bits (73), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 48/113 (42%), Gaps = 16/113 (14%)

Query: 93  VPGAVKLCNDLN------KLPKEKWAVATSGTREMATKWFDLLKIKRPQYFITANDVK-- 144
           +PGA++L N L+       L          G     T  FDL         +T +D +  
Sbjct: 79  LPGALELLNYLHGKGIPIALCTSSNKTKFKGKTSHLTHGFDLF-----DAIVTISDPRIP 133

Query: 145 --QGKPHPEPYLKGRNGLGFPINEQDPSKSKAIVFEDAPAGIVAGKAAGCKIV 195
             +GKPHP+ +  G   L    +    +K   +VFED   G+ +G+A G  ++
Sbjct: 134 KGRGKPHPDIWQLGLKLLNEKFHSNIEAKD-CLVFEDGIPGVQSGRAFGAHVI 185

>KLLA0F25696g 2386886..2387554 similar to sp|O59760
           Schizosaccharomyces pombe Haloacid dehalogenase-like
           hydrolase, start by similarity
          Length = 222

 Score = 32.3 bits (72), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 20/112 (17%)

Query: 109 EKWAVATSGTREMATKWFDLLKIKRPQYFITANDVK----QGKPHPEPYLKGRNGLGFPI 164
           EK+   TS   E A K FD++        IT +D +    +GKP P+ +  G   L    
Sbjct: 105 EKFHHKTSHLTE-AFKAFDVI--------ITGDDPRIPKGRGKPFPDIWQLGLKELNAKF 155

Query: 165 NEQDPSKSKAIVFEDAPAGIVAGKAAGCKIV------GIATTFDLDFLKEKG 210
           N  D   ++ +VFED   G+ AGK+ G  ++       IA   D   L ++G
Sbjct: 156 N-TDIESNECLVFEDGIPGVNAGKSFGAYVIWVPHKDAIALVKDHKILGDRG 206

>Scas_694.40
          Length = 597

 Score = 29.3 bits (64), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 86  YGEHSIEVPGAVKLCNDLNKLPKEKWAVATS 116
           +GEH I V  A+ +CN +N    E + + TS
Sbjct: 271 FGEHDILVKNAMSICNTINTSDLEHYCLFTS 301

>YDL107W (MSS2) [762] chr4 (268921..269976) Protein involved in
           translocation of the Cox2p C-terminal end across the
           mitochondrial inner membrane [1056 bp, 351 aa]
          Length = 351

 Score = 28.1 bits (61), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 35/75 (46%), Gaps = 10/75 (13%)

Query: 57  RTYDAIAKFAPDFADEELVSKLEGEIPEKYGEHSI-EVPGAVKLCNDLNKLPKEKWAVAT 115
           +TYD   K+  +F   E  +KL GE+  K GE  I +V G +K         ++ W    
Sbjct: 169 KTYDKAEKYYQEFLKLENSTKLAGEVHGKLGEIQIKQVNGFLK--------AEKSWLSCI 220

Query: 116 SGTR-EMATKWFDLL 129
                E +++W+ LL
Sbjct: 221 ELLEIERSSRWYFLL 235

>YDR239C (YDR239C) [1074] chr4 complement(941049..943412) Protein of
           unknown function [2364 bp, 787 aa]
          Length = 787

 Score = 28.1 bits (61), Expect = 7.4,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 14/90 (15%)

Query: 86  YGEHSIEVPGAVKLCNDLNKLPKEKWAVATSGTREMATK----------WFDLLKIKRPQ 135
           + EH++ +P  V L N ++  P E+    +  T  ++ K          + + L++K   
Sbjct: 507 FNEHTVTIPATVDLPNPVHDAPSERSVKCSPLTSVVSNKSEKSVPLVSSYVEELRLK--- 563

Query: 136 YFITANDVKQGKPHPEPYLKGRNGLGFPIN 165
           Y+ T+N + Q  P+    LK +N L  P N
Sbjct: 564 YYKTSNFL-QAPPNLPVALKQKNNLIQPKN 592

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.139    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,415,890
Number of extensions: 374393
Number of successful extensions: 864
Number of sequences better than 10.0: 30
Number of HSP's gapped: 829
Number of HSP's successfully gapped: 30
Length of query: 250
Length of database: 16,596,109
Length adjustment: 99
Effective length of query: 151
Effective length of database: 13,168,927
Effective search space: 1988507977
Effective search space used: 1988507977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)