Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_700.4229729714540.0
Kwal_26.865336429413270.0
KLLA0D06941g29729413020.0
CAGL0M02695g29729712930.0
ACR104C29728612920.0
YPL131W (RPL5)29729712890.0
Sklu_2406.429729712841e-180
Scas_594.41722120672.1
YLR454W262845672.2
Scas_702.3493546662.4
Sklu_2383.1172089629.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_700.42
         (297 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_700.42                                                           564   0.0  
Kwal_26.8653                                                          515   0.0  
KLLA0D06941g complement(598560..599453) highly similar to sp|P26...   506   0.0  
CAGL0M02695g 308170..309063 highly similar to sp|P26321 Saccharo...   502   0.0  
ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH] (541333..54...   502   0.0  
YPL131W (RPL5) [5314] chr16 (303120..304013) Ribosomal protein L...   501   0.0  
Sklu_2406.4 YPL131W, Contig c2406 3367-4260                           499   e-180
Scas_594.4                                                             30   2.1  
YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unk...    30   2.2  
Scas_702.34                                                            30   2.4  
Sklu_2383.1 YMR229C, Contig c2383 993-6155                             28   9.1  

>Scas_700.42
          Length = 297

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/297 (93%), Positives = 277/297 (93%)

Query: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDXXXX 120
           ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLD    
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180
                           DGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180

Query: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY
Sbjct: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIAALAGAQ 297
           TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIAALAGAQ
Sbjct: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIAALAGAQ 297

>Kwal_26.8653
          Length = 364

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/294 (85%), Positives = 260/294 (88%)

Query: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M F    K+SAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 70  MVFLKEVKSSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 129

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDXXXX 120
           ICQIVSSTITGD+VLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLD    
Sbjct: 130 ICQIVSSTITGDVVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDETYQ 189

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180
                           DGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLY+PHSE+RF
Sbjct: 190 GVEEVEGEYQLTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSESRF 249

Query: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFEAEELD D LRTYIFGGHVSQYMEELADDDEERF ELFKGYLADDIDAD++EDIY
Sbjct: 250 PGWDFEAEELDADTLRTYIFGGHVSQYMEELADDDEERFKELFKGYLADDIDADAVEDIY 309

Query: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIAALA 294
            EAH  IRADP+FK TEKKFTKEQYAAESKK+RQ KL+REERKARV AKIAALA
Sbjct: 310 MEAHEKIRADPSFKPTEKKFTKEQYAAESKKYRQTKLSREERKARVAAKIAALA 363

>KLLA0D06941g complement(598560..599453) highly similar to sp|P26321
           Saccharomyces cerevisiae YPL131w RPL1 60S large subunit
           ribosomal protein L5.e singleton, start by similarity
          Length = 297

 Score =  506 bits (1302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/294 (83%), Positives = 260/294 (88%)

Query: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M F  + K SAYHSR+QTPFRRRREGKTDYY RKRLVAQHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MAFIKDIKTSAYHSRYQTPFRRRREGKTDYYARKRLVAQHKAKYNTPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDXXXX 120
           I QIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLL+ARR LQKLGLD    
Sbjct: 61  ITQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLLARRTLQKLGLDETYP 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180
                           DGPRPFKV+LD+GLQRTTTGAR+FGALKGASDGGLY+PHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVYLDVGLQRTTTGARIFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFEAEELD DLLRTYIFGGHVSQYMEELADDDEER+ ELFKGYLADDIDAD++EDIY
Sbjct: 181 PGWDFEAEELDADLLRTYIFGGHVSQYMEELADDDEERYRELFKGYLADDIDADAVEDIY 240

Query: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIAALA 294
            +AHAAIR DPAFK TEKKFTKEQYAAESKK+RQ+KLTREERKARV AKI+ALA
Sbjct: 241 ADAHAAIREDPAFKPTEKKFTKEQYAAESKKYRQVKLTREERKARVAAKISALA 294

>CAGL0M02695g 308170..309063 highly similar to sp|P26321
           Saccharomyces cerevisiae YPL131w RPL1, start by
           similarity
          Length = 297

 Score =  502 bits (1293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/297 (84%), Positives = 262/297 (88%)

Query: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M F  N K SAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 1   MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDXXXX 120
           ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNW+AAYATGLLIARRALQKLGLD    
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRALQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180
                           DGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLY+PHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFEAEELD +LLR+YIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADS+EDIY
Sbjct: 181 PGWDFEAEELDAELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSIEDIY 240

Query: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIAALAGAQ 297
             AH AIRADP+FK TEKKFTKEQYAAESKK++  KLT+EER ARV AKIAALAG Q
Sbjct: 241 ASAHEAIRADPSFKPTEKKFTKEQYAAESKKYKAKKLTKEERDARVAAKIAALAGQQ 297

>ACR104C [1151] [Homologous to ScYPL131W (RPL5) - SH]
           (541333..542226) [894 bp, 297 aa]
          Length = 297

 Score =  502 bits (1292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 255/286 (89%)

Query: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M F  + KNSAYHSRFQTPFRRRREGKTDYY RKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MAFIKSIKNSAYHSRFQTPFRRRREGKTDYYARKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDXXXX 120
           ICQ+VSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARR LQKLGLD    
Sbjct: 61  ICQVVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRTLQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180
                           DGPRPFKV+LDIGLQRTTTGARVFGALKGASDGGLY+PHSENRF
Sbjct: 121 GVEEPEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFE+EELD DLLRTYIFGGHVS YMEELADDDEER+SELFKGY+AD I+AD++EDIY
Sbjct: 181 PGWDFESEELDADLLRTYIFGGHVSAYMEELADDDEERYSELFKGYIADGIEADAIEDIY 240

Query: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARV 286
           TEAHAAIRADP+FK TEKKFTKEQYAAESKKFRQ+KLT+EERKARV
Sbjct: 241 TEAHAAIRADPSFKPTEKKFTKEQYAAESKKFRQVKLTKEERKARV 286

>YPL131W (RPL5) [5314] chr16 (303120..304013) Ribosomal protein L5
           (yeast L1; YL3; rat L5), the sole 5S rRNA-associated
           ribosomal protein, involved in the binding of
           peptidyl-tRNA to the ribosome [894 bp, 297 aa]
          Length = 297

 Score =  501 bits (1289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/297 (83%), Positives = 262/297 (88%)

Query: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M F  + K+SAY SRFQTPFRRRREGKTDYYQRKRLV QHKAKYN+PKYRLVVRFTNKDI
Sbjct: 1   MAFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDXXXX 120
           ICQI+SSTITGD+VLAAAYSHELPRYGITHGLTNW+AAYATGLLIARR LQKLGLD    
Sbjct: 61  ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180
                           DGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLY+PHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFE EE+DP+LLR+YIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY
Sbjct: 181 PGWDFETEEIDPELLRSYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240

Query: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIAALAGAQ 297
           T AH AIRADPAFK TEKKFTKEQYAAESKK+RQ KL++EER ARV AKIAALAG Q
Sbjct: 241 TSAHEAIRADPAFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ 297

>Sklu_2406.4 YPL131W, Contig c2406 3367-4260
          Length = 297

 Score =  499 bits (1284), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 254/297 (85%), Positives = 263/297 (88%)

Query: 1   MTFNINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60
           M F +N K SAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI
Sbjct: 1   MGFQLNVKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDI 60

Query: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWSAAYATGLLIARRALQKLGLDXXXX 120
           ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNW+AAYATGLLIARR LQKLGLD    
Sbjct: 61  ICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTLQKLGLDETYK 120

Query: 121 XXXXXXXXXXXXXXXXDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRF 180
                           DGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLY+PHSENRF
Sbjct: 121 GVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVFGALKGASDGGLYVPHSENRF 180

Query: 181 PGWDFEAEELDPDLLRTYIFGGHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIY 240
           PGWDFEAEELDPD+LRTYIF GHVSQYMEELADDDEERF ELFKGYLADDIDAD++EDIY
Sbjct: 181 PGWDFEAEELDPDMLRTYIFAGHVSQYMEELADDDEERFRELFKGYLADDIDADAIEDIY 240

Query: 241 TEAHAAIRADPAFKATEKKFTKEQYAAESKKFRQIKLTREERKARVEAKIAALAGAQ 297
            EAH AIR DPAFKATEKKFTKEQYAAESKK++Q KLT+EERKARV AKI ALAG Q
Sbjct: 241 LEAHEAIREDPAFKATEKKFTKEQYAAESKKYKQYKLTKEERKARVAAKITALAGEQ 297

>Scas_594.4
          Length = 1722

 Score = 30.4 bits (67), Expect = 2.1,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 54/120 (45%), Gaps = 13/120 (10%)

Query: 145 FLDIGLQRTTTGARVFGALKGASDGGLYIPHSENRFPGW---DFEAEELDPDLLRTYIFG 201
           + DI  +  TT   + G +K  S+ GL++  +  +F G     +  E  D D+ +T+   
Sbjct: 784 YADIKSKSKTT--PLHGYIKSISNKGLFVAFN-GKFVGLVLPSYAVESRDVDISKTFYIN 840

Query: 202 GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTEAHAAIRADPAFKATEKKFT 261
             V+ Y+   +DDD ERF    +     D   DS +   TE    I  DPA K   K FT
Sbjct: 841 QSVTAYLLR-SDDDNERFLLTLRTPSTKD---DSSKVTGTETLKPI--DPAMKDL-KDFT 893

>YLR454W (YLR454W) [3828] chr12 (1043995..1051881) Protein of unknown
            function, has low similarity to uncharacterized C.
            albicans Orf6.6103p [7887 bp, 2628 aa]
          Length = 2628

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 29   DYYQRKRLVAQHKAKYNSPKYRLVVRFTNKDIICQIVS-STITGD 72
            D +QRK ++ +++A  N  +  + ++F   D++CQ V   T++G+
Sbjct: 1728 DLHQRKEVLTEYQAGLNVRRRVMKLKFLAGDVVCQDVDIRTVSGE 1772

>Scas_702.34
          Length = 935

 Score = 30.0 bits (66), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 4   NINQKNSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYNSPKY 49
           N+   N A  +   +PFR+   G T  +QR +   + +A  NSP Y
Sbjct: 733 NVKATNDANINDPHSPFRKASTGTT-IFQRPKYYTEPRANINSPSY 777

>Sklu_2383.1 YMR229C, Contig c2383 993-6155
          Length = 1720

 Score = 28.5 bits (62), Expect = 9.1,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 7/89 (7%)

Query: 210  ELADDDEERFSELFKGYLADDIDADSLEDIY----TEAHAAIRADPAF-KATEKKFTKEQ 264
            E +  D E+   LF+G LAD      L ++Y    T+A    + +  F +   KK T++Q
Sbjct: 1619 EFSKGDAEQGRSLFEGLLADAPKRIDLWNVYIDQETKAGEKKKVEDLFERIISKKITRKQ 1678

Query: 265  YAAESKKFRQIKLTREERKAR--VEAKIA 291
                  K+ Q + ++ ++KA   V+AK A
Sbjct: 1679 AKFFFNKWLQFEESKNDQKAAEYVKAKAA 1707

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.319    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 8,963,737
Number of extensions: 378517
Number of successful extensions: 1302
Number of sequences better than 10.0: 27
Number of HSP's gapped: 1294
Number of HSP's successfully gapped: 27
Length of query: 297
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 196
Effective length of database: 13,099,691
Effective search space: 2567539436
Effective search space used: 2567539436
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)