Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_700.4129129115530.0
YPL132W (COX11)30025610411e-143
KLLA0D07007g2612149961e-137
CAGL0M02673g2852099841e-135
Sklu_2406.22652809761e-134
Kwal_26.86602492139431e-129
ACR106C2662189081e-123
AER396W12095660.89
Scas_616.10146152691.1
Scas_653.13*19543661.5
Kwal_55.2004262241644.8
CAGL0H04609g2763119636.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_700.41
         (291 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_700.41                                                           602   0.0  
YPL132W (COX11) [5313] chr16 (301715..302617) Protein required f...   405   e-143
KLLA0D07007g complement(601656..602441) similar to sp|P19516 Sac...   388   e-137
CAGL0M02673g 306446..307303 similar to sp|P19516 Saccharomyces c...   383   e-135
Sklu_2406.2 YPL132W, Contig c2406 657-1454                            380   e-134
Kwal_26.8660                                                          367   e-129
ACR106C [1153] [Homologous to ScYPL132W (COX11) - SH] (543421..5...   354   e-123
AER396W [2896] [Homologous to ScYBL078C (AUT7) - SH] complement(...    30   0.89 
Scas_616.10                                                            31   1.1  
Scas_653.13*                                                           30   1.5  
Kwal_55.20042                                                          29   4.8  
CAGL0H04609g complement(433499..441790) similar to sp|P38110 Sac...    29   6.9  

>Scas_700.41
          Length = 291

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/291 (100%), Positives = 291/291 (100%)

Query: 1   MSSMLSKTNILSRASLRFLVPRSVVRQGITRSLPSQTTYIYRSYTQQQAPPRMNSQEKIP 60
           MSSMLSKTNILSRASLRFLVPRSVVRQGITRSLPSQTTYIYRSYTQQQAPPRMNSQEKIP
Sbjct: 1   MSSMLSKTNILSRASLRFLVPRSVVRQGITRSLPSQTTYIYRSYTQQQAPPRMNSQEKIP 60

Query: 61  KFDISKLSKAEIQRLRDFKHQEDTKMKNRTIALYFSSMAVLFLGLSYAAVPIYRALCART 120
           KFDISKLSKAEIQRLRDFKHQEDTKMKNRTIALYFSSMAVLFLGLSYAAVPIYRALCART
Sbjct: 61  KFDISKLSKAEIQRLRDFKHQEDTKMKNRTIALYFSSMAVLFLGLSYAAVPIYRALCART 120

Query: 121 GFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPWKFVPQQREVYVLPGETALA 180
           GFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPWKFVPQQREVYVLPGETALA
Sbjct: 121 GFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPWKFVPQQREVYVLPGETALA 180

Query: 181 FYKAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDF 240
           FYKAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDF
Sbjct: 181 FYKAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDF 240

Query: 241 ASDPAMRNIDDIILHYTFFKAHYGDGSAVSDAAATVAPGSVLVKNPDDDDE 291
           ASDPAMRNIDDIILHYTFFKAHYGDGSAVSDAAATVAPGSVLVKNPDDDDE
Sbjct: 241 ASDPAMRNIDDIILHYTFFKAHYGDGSAVSDAAATVAPGSVLVKNPDDDDE 291

>YPL132W (COX11) [5313] chr16 (301715..302617) Protein required for
           heme A synthesis [903 bp, 300 aa]
          Length = 300

 Score =  405 bits (1041), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/256 (76%), Positives = 224/256 (87%), Gaps = 14/256 (5%)

Query: 18  FLVPRSV-VRQGITRSLPSQTTYIYRSYTQQQAPPRMNSQEKIPKFDISKLSKAEIQRLR 76
           +L P ++ +R+ I +++        RSY+       +NS++    FDISKL++ EIQ+LR
Sbjct: 24  WLAPHALALRRAICKNVA------LRSYS-------VNSEQPKHTFDISKLTRNEIQQLR 70

Query: 77  DFKHQEDTKMKNRTIALYFSSMAVLFLGLSYAAVPIYRALCARTGFGGIPITDRRKFTDD 136
           + K   + K K+RT+A YFSS+AVLFLGL+YAAVP+YRA+CARTGFGGIPITDRRKFTDD
Sbjct: 71  ELKRARERKFKDRTVAFYFSSVAVLFLGLAYAAVPLYRAICARTGFGGIPITDRRKFTDD 130

Query: 137 KLIPVDTEKRIKISFTSEVSQILPWKFVPQQREVYVLPGETALAFYKAKNHSDKDIIGMA 196
           KLIPVDTEKRI+ISFTSEVSQILPWKFVPQQREVYVLPGETALAFYKAKN+SDKDIIGMA
Sbjct: 131 KLIPVDTEKRIRISFTSEVSQILPWKFVPQQREVYVLPGETALAFYKAKNYSDKDIIGMA 190

Query: 197 TYSISPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDFASDPAMRNIDDIILHY 256
           TYSI+PGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDFASDPAMRNIDDIILHY
Sbjct: 191 TYSIAPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDFASDPAMRNIDDIILHY 250

Query: 257 TFFKAHYGDGSAVSDA 272
           TFF+AHYGDG+AVSD+
Sbjct: 251 TFFRAHYGDGTAVSDS 266

>KLLA0D07007g complement(601656..602441) similar to sp|P19516
           Saccharomyces cerevisiae YPL132w COX11 cytochrome-c
           oxidase assembly protein singleton, start by similarity
          Length = 261

 Score =  388 bits (996), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 178/214 (83%), Positives = 202/214 (94%)

Query: 61  KFDISKLSKAEIQRLRDFKHQEDTKMKNRTIALYFSSMAVLFLGLSYAAVPIYRALCART 120
           KFD+SKL++ EI+ +RD+K     + K+RT+A YF+S+AVLFLGL+YAAVP+YRA+CART
Sbjct: 40  KFDLSKLTREEIKEIRDYKISAARRYKDRTVAFYFTSIAVLFLGLAYAAVPLYRAICART 99

Query: 121 GFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPWKFVPQQREVYVLPGETALA 180
           G+GGIPITD+RKFTDDKLIPVD+ KRI+ISFTSEVSQILPWKFVPQQREVYVLPGETALA
Sbjct: 100 GYGGIPITDKRKFTDDKLIPVDSNKRIRISFTSEVSQILPWKFVPQQREVYVLPGETALA 159

Query: 181 FYKAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDF 240
           FYKAKN+SDKDIIGMATYSI+PGE++ YFNKIQCFCFEEQKLAAGEE+DMPVFFFIDPDF
Sbjct: 160 FYKAKNNSDKDIIGMATYSITPGESSPYFNKIQCFCFEEQKLAAGEEVDMPVFFFIDPDF 219

Query: 241 ASDPAMRNIDDIILHYTFFKAHYGDGSAVSDAAA 274
           ASDP+MRNIDDIILHYTFFKAHY DGSAVSDAAA
Sbjct: 220 ASDPSMRNIDDIILHYTFFKAHYADGSAVSDAAA 253

>CAGL0M02673g 306446..307303 similar to sp|P19516 Saccharomyces
           cerevisiae YPL132w COX11 cytochrome-c oxidase assembly
           protein, hypothetical start
          Length = 285

 Score =  383 bits (984), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 175/209 (83%), Positives = 198/209 (94%)

Query: 63  DISKLSKAEIQRLRDFKHQEDTKMKNRTIALYFSSMAVLFLGLSYAAVPIYRALCARTGF 122
           D SKL++ EI++LRD K  +D K K+RT+A YF S+AV+FLGL+YAAVP+YRA+CARTGF
Sbjct: 52  DFSKLTRDEIKQLRDMKMAKDRKYKDRTVAYYFGSVAVIFLGLAYAAVPLYRAICARTGF 111

Query: 123 GGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPWKFVPQQREVYVLPGETALAFY 182
           GG+PITD+RKFTDDKLIPVDT KRI++SFTSEVSQILPWKF PQQREVYVLPGETALAFY
Sbjct: 112 GGVPITDKRKFTDDKLIPVDTGKRIRVSFTSEVSQILPWKFTPQQREVYVLPGETALAFY 171

Query: 183 KAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDFAS 242
           KAKN+SDKDIIGMATYSI+PG+AAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDFAS
Sbjct: 172 KAKNNSDKDIIGMATYSITPGDAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDFAS 231

Query: 243 DPAMRNIDDIILHYTFFKAHYGDGSAVSD 271
           DP+MRNIDD+ILHYTFF+AHYGDGSAVS+
Sbjct: 232 DPSMRNIDDLILHYTFFRAHYGDGSAVSE 260

>Sklu_2406.2 YPL132W, Contig c2406 657-1454
          Length = 265

 Score =  380 bits (976), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 185/280 (66%), Positives = 225/280 (80%), Gaps = 17/280 (6%)

Query: 1   MSSMLSKTNILSRASLRFLVPRSVVRQGITRSLPSQTTYIYRSYTQQQAPPRMNSQEKIP 60
           M+S+L KT   +R++LR         + + RS  +   +  R +  Q+AP +        
Sbjct: 2   MNSLLFKTA--TRSTLR-------STRLLNRSTKNDLWFNLRHFHTQKAPRQ-------- 44

Query: 61  KFDISKLSKAEIQRLRDFKHQEDTKMKNRTIALYFSSMAVLFLGLSYAAVPIYRALCART 120
           + D SKL++ EI++LR  K + +   K+RT A YFSS+AV+FLGL+YAAVP+YRA+CART
Sbjct: 45  QLDFSKLTQKEIKQLRAIKQERERAFKDRTAAYYFSSVAVVFLGLAYAAVPLYRAICART 104

Query: 121 GFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPWKFVPQQREVYVLPGETALA 180
           G+GGIPITD+RKFT+DKL+PVDT++RI+ISFTSEVS+ILPWKF PQQREVYVLPGETALA
Sbjct: 105 GYGGIPITDKRKFTEDKLVPVDTDRRIRISFTSEVSRILPWKFTPQQREVYVLPGETALA 164

Query: 181 FYKAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDF 240
           FYKA+N SDKDIIGMATYSISPGEAA YFNKIQCFCFEEQ+LAAGEE+DMPVFFFIDPDF
Sbjct: 165 FYKARNTSDKDIIGMATYSISPGEAAPYFNKIQCFCFEEQRLAAGEEVDMPVFFFIDPDF 224

Query: 241 ASDPAMRNIDDIILHYTFFKAHYGDGSAVSDAAATVAPGS 280
           ASDPAMRNIDD+ILHYTFFKAHY DG+AVSD +A V   +
Sbjct: 225 ASDPAMRNIDDVILHYTFFKAHYADGAAVSDPSAAVVEAA 264

>Kwal_26.8660
          Length = 249

 Score =  367 bits (943), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 197/213 (92%)

Query: 61  KFDISKLSKAEIQRLRDFKHQEDTKMKNRTIALYFSSMAVLFLGLSYAAVPIYRALCART 120
           + D+SKL++ EIQ+LR  K Q+D + K+RT A YF+S+AVLFLGL+YAAVP YRA+CART
Sbjct: 26  QIDLSKLTQTEIQQLRALKLQKDRQFKDRTAAYYFTSVAVLFLGLAYAAVPFYRAICART 85

Query: 121 GFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPWKFVPQQREVYVLPGETALA 180
           G+GG+PITDRRKFTDDKLIPV+++KRI+ISFTSEVSQILPWKF P+QREV+VLPGETALA
Sbjct: 86  GWGGVPITDRRKFTDDKLIPVESDKRIRISFTSEVSQILPWKFTPEQREVHVLPGETALA 145

Query: 181 FYKAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDF 240
           FYKAKN SDKDIIGMATYSI+PG+A+ YFNKIQCFCFEEQ+LAAGEEIDMPVFFFIDPDF
Sbjct: 146 FYKAKNTSDKDIIGMATYSITPGDASPYFNKIQCFCFEEQRLAAGEEIDMPVFFFIDPDF 205

Query: 241 ASDPAMRNIDDIILHYTFFKAHYGDGSAVSDAA 273
           A+DP MRNIDDI+LHYTFF+AHY +G AVS++A
Sbjct: 206 AADPRMRNIDDIVLHYTFFRAHYANGGAVSESA 238

>ACR106C [1153] [Homologous to ScYPL132W (COX11) - SH]
           (543421..544221) [801 bp, 266 aa]
          Length = 266

 Score =  354 bits (908), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 188/218 (86%)

Query: 51  PRMNSQEKIPKFDISKLSKAEIQRLRDFKHQEDTKMKNRTIALYFSSMAVLFLGLSYAAV 110
           P  +S     K D SKL++AEI++LRD K Q +   ++RT A YF+S+ V+FLGL+YAAV
Sbjct: 30  PLHSSGRSRAKLDFSKLTQAEIKQLRDMKVQRERAFRDRTAAYYFASVGVVFLGLAYAAV 89

Query: 111 PIYRALCARTGFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPWKFVPQQREV 170
           P+YR LCARTGFGG PITDRRKFT DK++PVD +KRI++SFTSEVSQILPWKFVPQQREV
Sbjct: 90  PLYRLLCARTGFGGTPITDRRKFTSDKMVPVDMDKRIRVSFTSEVSQILPWKFVPQQREV 149

Query: 171 YVLPGETALAFYKAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCFEEQKLAAGEEIDM 230
           YVLPGETALAFYKAKN SDKDIIGMATYSI+PG AAQYFNKIQCFCFEEQKL AGEE+DM
Sbjct: 150 YVLPGETALAFYKAKNTSDKDIIGMATYSITPGGAAQYFNKIQCFCFEEQKLLAGEEVDM 209

Query: 231 PVFFFIDPDFASDPAMRNIDDIILHYTFFKAHYGDGSA 268
           PVFFFIDPDFA+DP MRN+DD++LHYTFF+A Y   +A
Sbjct: 210 PVFFFIDPDFATDPQMRNVDDLVLHYTFFRAQYASEAA 247

>AER396W [2896] [Homologous to ScYBL078C (AUT7) - SH]
           complement(1391780..1392142) [363 bp, 120 aa]
          Length = 120

 Score = 30.0 bits (66), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 18/95 (18%)

Query: 110 VPIYRALCARTGFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILPWKFVPQQRE 169
           VP+   +C R     IP  DRRK+    L+P D      ++    V  I     +P ++ 
Sbjct: 28  VPV---ICERAEKSDIPEVDRRKY----LVPAD------LTVGQFVYVIRRRIKLPAEKA 74

Query: 170 VYV-----LPGETALAFYKAKNHSDKDIIGMATYS 199
           +++     LP   AL F   + H DKD      YS
Sbjct: 75  IFIFVNDTLPPTAALMFAVYQEHKDKDGFLYVKYS 109

>Scas_616.10
          Length = 1461

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/52 (23%), Positives = 32/52 (61%)

Query: 146 RIKISFTSEVSQILPWKFVPQQREVYVLPGETALAFYKAKNHSDKDIIGMAT 197
           R++++   E  Q+   K VP++ ++++    + ++F+ A ++S+ +I  +AT
Sbjct: 114 RVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASNSNSNISTLAT 165

>Scas_653.13*
          Length = 195

 Score = 30.0 bits (66), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 25/43 (58%)

Query: 34 PSQTTYIYRSYTQQQAPPRMNSQEKIPKFDISKLSKAEIQRLR 76
          P +T  +Y+ + Q++  P+MN  E   K   ++L+K +I  ++
Sbjct: 6  PEETLDVYKLFRQEEVNPQMNDDEPTRKKIWARLTKVDINNVK 48

>Kwal_55.20042
          Length = 622

 Score = 29.3 bits (64), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 120 TGFGGIPITDRRKFTDDKLIPVDTEKRIKISFTSEVSQILP 160
           T  G      +RK  DDK++ V T+ R  IS +S    +LP
Sbjct: 340 TTLGDCNFVQKRKTIDDKIVDVLTQYRALISGSSSSQLVLP 380

>CAGL0H04609g complement(433499..441790) similar to sp|P38110
            Saccharomyces cerevisiae YBL088c TEL1, start by
            similarity
          Length = 2763

 Score = 28.9 bits (63), Expect = 6.9,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 43/119 (36%), Gaps = 45/119 (37%)

Query: 147  IKISFTSEVSQILPWKFVP-----------------------QQREVYVLPGETALAFYK 183
            I    TS++SQI  WKF+P                        +R +Y LP ET  A   
Sbjct: 2231 INTDLTSKLSQIPTWKFLPWVNQFTSKLSLLKSKFQKQLWYIMKRLLYKLPFETGYAVIN 2290

Query: 184  AK---NHSDK----------------DIIGMATYSISPGEAAQYFNKIQCFCFEEQKLA 223
             +    +SDK                D +  +  S+  GE   Y   IQ FC+   ++A
Sbjct: 2291 LQLYEKYSDKLDEKISEKIKAANLIFDQLQNSQISVKEGE---YLRTIQEFCYATLEIA 2346

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.321    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 9,331,590
Number of extensions: 392723
Number of successful extensions: 1056
Number of sequences better than 10.0: 14
Number of HSP's gapped: 1055
Number of HSP's successfully gapped: 14
Length of query: 291
Length of database: 16,596,109
Length adjustment: 101
Effective length of query: 190
Effective length of database: 13,099,691
Effective search space: 2488941290
Effective search space used: 2488941290
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 61 (28.1 bits)