Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_700.4040739418440.0
Kwal_26.866235539211931e-164
ACR107W38439511891e-162
YPL133C (RDS2)44621510491e-140
KLLA0D07029g53421510541e-140
CAGL0M02651g46221510311e-137
Kwal_14.16364561812902e-28
YBR239C5292082736e-26
AFL031W5171822711e-25
KLLA0F10417g5071752631e-24
Scas_597.25401822577e-24
AFR081C4824732391e-21
CAGL0K06985g5962212383e-21
KLLA0F13904g5792282349e-21
Sklu_2207.45322082284e-20
YJL103C6182362002e-16
Scas_711.185092341823e-14
CAGL0L03674g6292301743e-13
KLLA0A02585g370371144e-06
Scas_542.8902331066e-05
KLLA0F09559g658621059e-05
KLLA0E18194g865371022e-04
Sklu_2191.2718341004e-04
Kwal_23.642573535995e-04
KLLA0D00484g100437986e-04
KLLA0F10835g75639986e-04
CAGL0K05841g137231978e-04
AGL233C87233978e-04
KLLA0F22990g125341978e-04
Scas_669.863745960.001
Sklu_2384.683134950.001
ACL195C10937870.002
AFR117C115240940.002
KLLA0F04609g91628930.002
Sklu_1993.282360930.002
CAGL0B03421g135539930.003
YOR172W (YRM1)78635930.003
YLR256W (HAP1)150240930.003
Scas_573.4147840920.003
CAGL0L03377g120946920.003
KLLA0C04620g126968920.003
YLR278C134133920.004
KLLA0F19602g60333910.004
YOR162C (YRR1)81098910.004
Scas_662.890628900.005
Kwal_23.351457950900.005
YIL130W96428900.006
Kwal_23.475481228900.006
CAGL0G08844g84728900.006
YBR297W (MAL33)46826880.008
YNR063W60730880.009
CAGL0L04400g98752880.010
KLLA0D10153g65532870.012
Scas_659.1075795870.014
CAGL0M05907g89163860.015
Kwal_47.1756562840860.016
KLLA0D10593g92535850.025
Scas_657.385681850.025
YGR288W (MAL13)47327840.026
ACR028C60137840.028
Scas_702.7111354840.029
Scas_709.5175927840.029
KLLA0F22880g116436840.033
Scas_526.3110933840.034
CAGL0G09757g142333840.035
CAGL0J07150g102234830.036
YLR266C (PDR8)70134830.036
YKL015W (PUT3)97929830.036
KLLA0B04840g77133830.037
AGR280C110633830.038
ACL096W83527820.046
CAGL0F09229g83542820.054
AER370W80128820.055
Scas_717.33904102810.059
CAGL0L04576g86529810.068
CAGL0L09691g82426810.071
CAGL0D03850g83433810.075
CAGL0F07755g61140790.10
KLLA0A06039g65733790.11
CAGL0H01507g794135790.13
Sklu_2411.1168727780.15
KLLA0C19228g59133770.17
AFL200W59654770.20
Sklu_2434.1098334760.24
Scas_663.1294447760.24
KLLA0E14036g67841760.26
AGL361C69639760.27
Scas_275.133538750.27
YOR380W (RDR1)54632750.29
Kwal_26.680594426760.30
Sklu_2335.694025760.30
Sklu_2064.292235750.32
Scas_590.2117233750.32
Scas_691.3290637750.32
Kwal_14.91582227750.35
Kwal_23.652959833750.36
CAGL0I07755g105337750.36
CAGL0F07909g104948750.38
Sklu_1973.177733740.40
AAL057C80936740.41
YPR196W47027740.41
Scas_234.133757730.50
KLLA0F02299g87233740.50
Scas_702.7d97874740.51
CAGL0A00583g64637730.51
YBL005W (PDR3)97628740.52
YBL066C (SEF1)105735730.61
CAGL0A04455g109835730.63
AFR108W54831720.66
Scas_638.14104325730.67
Scas_674.12*90939730.69
YGL013C (PDR1)106827730.70
KLLA0D12650g65183720.72
ADR405C80733720.74
ADR404C87534720.75
YKL222C70532720.82
Kwal_55.2188488238720.90
Sklu_2376.692238720.92
Kwal_47.1808974527710.94
CAGL0A00451g110732710.97
KLLA0D11286g67833710.98
KLLA0C03201g65050711.0
KLLA0D09977g63435711.1
YMR168C (CEP3)60834711.1
YMR019W (STB4)94925711.1
YER184C79438711.1
Kwal_47.1750692428711.1
Sklu_2397.884875711.1
AER183C87929711.2
KLLA0F02750g114848711.2
KLLA0A09119g108231711.2
KLLA0A03421g88029701.3
Scas_688.17769111701.4
YLL054C76970701.4
CAGL0H00396g94030701.6
KLLA0D00396g36139691.6
ABL121C128529701.6
KLLA0D01452g144528691.7
YDR303C (RSC3)88533691.7
KLLA0C14212g104029691.8
ADR403C97034691.8
YMR280C (CAT8)143328691.8
Scas_449.163632691.8
Scas_626.683934692.0
Scas_556.6102235692.1
Kwal_27.10232120928692.1
ADR365W70127682.2
KLLA0D10197g85635682.3
AFR096W85231682.5
Scas_637.799833682.5
Scas_715.3111535682.5
Kwal_47.1693966933682.6
Sklu_2382.2126156682.8
KLLA0F02387g72729672.9
Sklu_2267.683073672.9
Scas_696.44116427673.0
Scas_721.9486931673.1
KLLA0F14322g71733673.1
Scas_711.3193231673.2
CAGL0M12298g99431673.3
YKR064W86338673.4
KLLA0D05038g67330673.4
YLR451W (LEU3)88635673.6
Kwal_14.2619116724663.9
KLLA0A04169g77595664.5
Scas_630.1470134664.5
KLLA0C01023g63653664.5
KLLA0C17050g95533664.7
Scas_610.980934655.1
Kwal_47.1723394832655.2
KLLA0C18953g70329655.3
YJL206C75827655.4
Sklu_2268.287539655.4
CAGL0E05434g81630656.1
Sklu_2296.691934646.6
AGL091W86632647.0
ACR241C79538648.2
YOR363C (PIP2)99634648.4
KLLA0F18084g86027638.4
Kwal_23.653755232638.7
YJL089W (SIP4)82928638.8
YLR098C (CHA4)64828639.0
YOL089C (HAL9)103085639.1
Scas_719.1399548639.2
Kwal_33.1393479741639.3
CAGL0F07865g84428639.5
CAGL0F02519g83262639.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_700.40
         (407 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_700.40                                                           714   0.0  
Kwal_26.8662                                                          464   e-164
ACR107W [1154] [Homologous to ScYPL133C - SH] complement(544402....   462   e-162
YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein w...   408   e-140
KLLA0D07029g 602763..604367 some similarities with sp|P19541 Sac...   410   e-140
CAGL0M02651g complement(304583..305971) similar to sp|P19541 Sac...   401   e-137
Kwal_14.1636                                                          116   2e-28
YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein ...   109   6e-26
AFL031W [3162] [Homologous to ScYBR239C - SH] complement(376161....   108   1e-25
KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces c...   105   1e-24
Scas_597.2                                                            103   7e-24
AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814) [...    97   1e-21
CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces c...    96   3e-21
KLLA0F13904g complement(1287758..1289497) some similarities with...    95   9e-21
Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement         92   4e-20
YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protei...    82   2e-16
Scas_711.18                                                            75   3e-14
CAGL0L03674g 420574..422463 some similarities with sp|P42950 Sac...    72   3e-13
KLLA0A02585g complement(226562..227674) some similarities with c...    49   4e-06
Scas_542.8                                                             45   6e-05
KLLA0F09559g complement(876719..878695) some similarities with s...    45   9e-05
KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces...    44   2e-04
Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement         43   4e-04
Kwal_23.6425                                                           43   5e-04
KLLA0D00484g 44879..47893 no similarity, hypothetical start            42   6e-04
KLLA0F10835g 997512..999782 no similarity, hypothetical start          42   6e-04
CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces c...    42   8e-04
AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH] ...    42   8e-04
KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces...    42   8e-04
Scas_669.8                                                             42   0.001
Sklu_2384.6 YKL015W, Contig c2384 10929-13424                          41   0.001
ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109 aa]    38   0.002
AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH] (646832..65...    41   0.002
KLLA0F04609g complement(451579..454329) similar to sp|P40467 Sac...    40   0.002
Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement         40   0.002
CAGL0B03421g complement(336071..340138) similar to sp|P12351 Sac...    40   0.003
YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with simila...    40   0.003
YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription facto...    40   0.003
Scas_573.4                                                             40   0.003
CAGL0L03377g complement(382932..386561) some similarities with s...    40   0.003
KLLA0C04620g complement(422705..426514) weakly similar to sp|Q05...    40   0.003
YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protei...    40   0.004
KLLA0F19602g complement(1814949..1816760) similar to sp|P43634 S...    40   0.004
YOR162C (YRR1) [4961] chr15 complement(639560..641992) Transcrip...    40   0.004
Scas_662.8                                                             39   0.005
Kwal_23.3514                                                           39   0.005
YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that cont...    39   0.006
Kwal_23.4754                                                           39   0.006
CAGL0G08844g complement(846590..849133) similar to sp|P40467 Sac...    39   0.006
YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation...    39   0.008
YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with sim...    39   0.009
CAGL0L04400g complement(511762..514725) similar to tr|Q12340 Sac...    39   0.010
KLLA0D10153g 858016..859983 weakly similar to sp|P35995 Saccharo...    38   0.012
Scas_659.10                                                            38   0.014
CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces c...    38   0.015
Kwal_47.17565                                                          38   0.016
KLLA0D10593g complement(900326..903103) similar to sp|P08638 Sac...    37   0.025
Scas_657.3                                                             37   0.025
YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway r...    37   0.026
ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp, ...    37   0.028
Scas_702.7                                                             37   0.029
Scas_709.51                                                            37   0.029
KLLA0F22880g 2123577..2127071 some similarities with ca|CA3639|I...    37   0.033
Scas_526.3                                                             37   0.034
CAGL0G09757g 930351..934622 some similarities with sp|Q05854 Sac...    37   0.035
CAGL0J07150g complement(686734..689802) similar to sp|P39720 Sac...    37   0.036
YLR266C (PDR8) [3660] chr12 complement(675621..677726) Zn[2]-Cys...    37   0.036
YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription facto...    37   0.036
KLLA0B04840g 439864..442179 weakly similar to ca|CA4996|IPF2029 ...    37   0.037
AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)...    37   0.038
ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH] complement(1...    36   0.046
CAGL0F09229g complement(908186..910693) weakly similar to sp|P39...    36   0.054
AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH] complement(...    36   0.055
Scas_717.33                                                            36   0.059
CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces c...    36   0.068
CAGL0L09691g complement(1039799..1042273) some similarities with...    36   0.071
CAGL0D03850g 384689..387193 weakly similar to sp|Q06639 Saccharo...    36   0.075
CAGL0F07755g complement(755947..757782) similar to sp|P40969 Sac...    35   0.10 
KLLA0A06039g 557368..559341 weakly similar to sp|P36023 Saccharo...    35   0.11 
CAGL0H01507g complement(147689..150073) similar to sp|Q06639 Sac...    35   0.13 
Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement      35   0.15 
KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces...    34   0.17 
AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH] complement(...    34   0.20 
Sklu_2434.10 YAL051W, Contig c2434 22765-25716                         34   0.24 
Scas_663.12                                                            34   0.24 
KLLA0E14036g complement(1239566..1241602) some similarities with...    34   0.26 
AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 69...    34   0.27 
Scas_275.1                                                             33   0.27 
YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with simi...    33   0.29 
Kwal_26.6805                                                           34   0.30 
Sklu_2335.6 YBL005W, Contig c2335 10191-13013                          34   0.30 
Sklu_2064.2 , Contig c2064 873-3641                                    33   0.32 
Scas_590.2                                                             33   0.32 
Scas_691.32                                                            33   0.32 
Kwal_14.915                                                            33   0.35 
Kwal_23.6529                                                           33   0.36 
CAGL0I07755g complement(745315..748476) similar to tr|Q12180 Sac...    33   0.36 
CAGL0F07909g 776659..779808 some similarities with tr|Q12180 Sac...    33   0.38 
Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement          33   0.40 
AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C (R...    33   0.41 
YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive regulat...    33   0.41 
Scas_234.1                                                             33   0.50 
KLLA0F02299g 205549..208167 no similarity, hypothetical start          33   0.50 
Scas_702.7d                                                            33   0.51 
CAGL0A00583g 65286..67226 weakly similar to sp|Q06149 Saccharomy...    33   0.51 
YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger transcrip...    33   0.52 
YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with...    33   0.61 
CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces c...    33   0.63 
AFR108W [3300] [Homologous to ScYGL045W - SH; ScYGL046W - SH] co...    32   0.66 
Scas_638.14                                                            33   0.67 
Scas_674.12*                                                           33   0.69 
YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finge...    33   0.70 
KLLA0D12650g complement(1073580..1075535) weakly similar to ca|C...    32   0.72 
ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    32   0.74 
ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    32   0.75 
YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein wi...    32   0.82 
Kwal_55.21884                                                          32   0.90 
Sklu_2376.6 , Contig c2376 12573-15341 reverse complement              32   0.92 
Kwal_47.18089                                                          32   0.94 
CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces cer...    32   0.97 
KLLA0D11286g complement(964642..966678) no similarity, hypotheti...    32   0.98 
KLLA0C03201g complement(286973..288925) similar to sp|P39529 Sac...    32   1.0  
KLLA0D09977g complement(841852..843756) weakly similar to sp|P40...    32   1.1  
YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component...    32   1.1  
YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding prote...    32   1.1  
YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein...    32   1.1  
Kwal_47.17506                                                          32   1.1  
Sklu_2397.8 YML099C, Contig c2397 9784-12330                           32   1.1  
AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH] (975879..9...    32   1.2  
KLLA0F02750g complement(250368..253814) some similarities with s...    32   1.2  
KLLA0A09119g complement(797533..800781) weakly similar to sp|P12...    32   1.2  
KLLA0A03421g 308414..311056 weakly similar to sp|P39720 Saccharo...    32   1.3  
Scas_688.17                                                            32   1.4  
YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein ...    32   1.4  
CAGL0H00396g complement(37005..39827) similar to sp|P08638 Sacch...    32   1.6  
KLLA0D00396g complement(36277..37362) some similarities with ca|...    31   1.6  
ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH] (170784..174...    32   1.6  
KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyc...    31   1.7  
YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Componen...    31   1.7  
KLLA0C14212g complement(1229219..1232341) some similarities with...    31   1.8  
ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C (...    31   1.8  
YMR280C (CAT8) [4234] chr13 complement(827027..831328) Transcrip...    31   1.8  
Scas_449.1                                                             31   1.8  
Scas_626.6                                                             31   2.0  
Scas_556.6                                                             31   2.1  
Kwal_27.10232                                                          31   2.1  
ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH] complement(...    31   2.2  
KLLA0D10197g complement(861726..864296) similar to sp|P05085 Sac...    31   2.3  
AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH] complement(...    31   2.5  
Scas_637.7                                                             31   2.5  
Scas_715.3                                                             31   2.5  
Kwal_47.16939                                                          31   2.6  
Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement         31   2.8  
KLLA0F02387g complement(213669..215852) similar to sp|P47988 Sac...    30   2.9  
Sklu_2267.6 YNL201C, Contig c2267 7034-9526 reverse complement         30   2.9  
Scas_696.44                                                            30   3.0  
Scas_721.94                                                            30   3.1  
KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1 Kluyver...    30   3.1  
Scas_711.31                                                            30   3.2  
CAGL0M12298g complement(1225753..1228737) similar to sp|P39720 S...    30   3.3  
YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with sim...    30   3.4  
KLLA0D05038g 433653..435674 weakly similar to sp|P40971 Saccharo...    30   3.4  
YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription fac...    30   3.6  
Kwal_14.2619                                                           30   3.9  
KLLA0A04169g complement(376273..378600) similar to sgd|S0004218 ...    30   4.5  
Scas_630.14                                                            30   4.5  
KLLA0C01023g 76863..78773 similar to sgd|S0002928 Saccharomyces ...    30   4.5  
KLLA0C17050g 1490472..1493339 some similarities with ca|CA3454|I...    30   4.7  
Scas_610.9                                                             30   5.1  
Kwal_47.17233                                                          30   5.2  
KLLA0C18953g 1682246..1684357 weakly similar to sp|P36598|Q9UTJ9...    30   5.3  
YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein ...    30   5.4  
Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement         30   5.4  
CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces c...    30   6.1  
Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement       29   6.6  
AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W ...    29   7.0  
ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745) [...    29   8.2  
YOR363C (PIP2) [5140] chr15 complement(1020218..1023208) Transcr...    29   8.4  
KLLA0F18084g complement(1652031..1654613) no similarity, hypothe...    29   8.4  
Kwal_23.6537                                                           29   8.7  
YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional act...    29   8.8  
YLR098C (CHA4) [3513] chr12 complement(337528..339474) Zinc-fing...    29   9.0  
YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein i...    29   9.1  
Scas_719.13                                                            29   9.2  
Kwal_33.13934                                                          29   9.3  
CAGL0F07865g complement(768270..770804) similar to tr|Q12151 Sac...    29   9.5  
CAGL0F02519g 245120..247618 weakly similar to sp|P39529 Saccharo...    29   9.9  

>Scas_700.40
          Length = 407

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/394 (89%), Positives = 352/394 (89%)

Query: 14  KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTGA 73
           KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTGA
Sbjct: 14  KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTGA 73

Query: 74  PGSSMYETPPIPNSINTYNKMVSSATGTTPATNPNLYLPQQPSFISENAGSEFNSLNEFL 133
           PGSSMYETPPIPNSINTYNKMVSSATGTTPATNPNLYLPQQPSFISENAGSEFNSLNEFL
Sbjct: 74  PGSSMYETPPIPNSINTYNKMVSSATGTTPATNPNLYLPQQPSFISENAGSEFNSLNEFL 133

Query: 134 NMLEDPSLLENTPGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTL 193
           NMLEDPSLLENTPGIT                                          TL
Sbjct: 134 NMLEDPSLLENTPGITQFPQVQQQQQQQQQQPTPQSNLPPAPLPPLSTRSSTSSEPQPTL 193

Query: 194 KEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSSKQ 253
           KEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSSKQ
Sbjct: 194 KEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSSKQ 253

Query: 254 RILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGEIY 313
           RILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGEIY
Sbjct: 254 RILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGEIY 313

Query: 314 RANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCNLQT 373
           RANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCNLQT
Sbjct: 314 RANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCNLQT 373

Query: 374 RDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPIV 407
           RDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPIV
Sbjct: 374 RDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPIV 407

>Kwal_26.8662
          Length = 355

 Score =  464 bits (1193), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 239/392 (60%), Positives = 283/392 (72%), Gaps = 49/392 (12%)

Query: 14  KKRKK-TKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTG 72
           KKRKK +K+C++CRRSH+ C+ +RPCSRC+KR I +LC       + L++ P  + ++T 
Sbjct: 7   KKRKKVSKACIYCRRSHMICNEQRPCSRCVKRDIGHLCRD-EELRLALDVEPDAEQLQTD 65

Query: 73  APGSSMYETPPIPNSINTYNKMVSSATGTTPATNPNLYLPQQPSFISENAGSEFNSLNEF 132
                +Y++  +P        + S A G          L QQP+F+SE+ GSEF+SLNEF
Sbjct: 66  L--GQVYKSGSVPQ-----QPLKSGAYGGL--------LSQQPTFVSEHVGSEFSSLNEF 110

Query: 133 LNMLEDPSLLENTPGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 192
           LNMLEDP +LE  P I                                           T
Sbjct: 111 LNMLEDPLILE-PPAIPKLPPRNPQDQP-------------------------------T 138

Query: 193 LKEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSSK 252
           LKE FFLTAADPS EMTPEDRLK VINAKLEAGLL+PYNYA+GYARLQ YMD++M+ +SK
Sbjct: 139 LKENFFLTAADPSAEMTPEDRLKSVINAKLEAGLLQPYNYARGYARLQTYMDDHMDLASK 198

Query: 253 QRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGEI 312
           QRIL+PLS IRP FR IAR+L+DVDLILVEE+FER+LLSYDRVFTSMSMPACLWRRTGEI
Sbjct: 199 QRILRPLSIIRPEFRAIARTLRDVDLILVEESFERMLLSYDRVFTSMSMPACLWRRTGEI 258

Query: 313 YRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCNLQ 372
           YR NKEFA+LVDC VD+LRDGKLAIYELM+EES VNFWEKYGSIAFDK QK VLTSC+L+
Sbjct: 259 YRGNKEFASLVDCKVDDLRDGKLAIYELMTEESVVNFWEKYGSIAFDKDQKAVLTSCHLR 318

Query: 373 TRDGSRKKNCCFSFTIRRDRYNIPICIVGNFI 404
           +RDGS+K+ CCFSFTIRRDRYNIPICIVGNFI
Sbjct: 319 SRDGSKKRPCCFSFTIRRDRYNIPICIVGNFI 350

>ACR107W [1154] [Homologous to ScYPL133C - SH]
           complement(544402..545556) [1155 bp, 384 aa]
          Length = 384

 Score =  462 bits (1189), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 236/395 (59%), Positives = 278/395 (70%), Gaps = 27/395 (6%)

Query: 14  KKRKKT-KSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTG 72
           KKRKK  K+C+ CRRSH+ CD +RPCSRC+KR I + C           + P  + +++ 
Sbjct: 14  KKRKKVVKACVLCRRSHMICDDRRPCSRCIKRDIGHFCCDE-------KLQPGAERLQSQ 66

Query: 73  AP-GSSMYETPPIPNSINTYNKMVSSATGTTPATNPNLYLPQQPSFISENAGSEFNSLNE 131
           +P  +  ++  P+P        +V+         N    +   P F+SE+ GSEF+SLNE
Sbjct: 67  SPLRTETFDVQPVPE------HLVAGLGVGAAGGNRYANVINHPKFVSEHIGSEFSSLNE 120

Query: 132 FLNMLEDPSLLENTPGITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 191
           FL +LEDP L+E TP                                             
Sbjct: 121 FLTLLEDPLLMEATPS------------PGCNGQAADPGARGPGELVGGVLAGAAPQEQP 168

Query: 192 TLKEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSS 251
           T KE FFLTAADPSTE+ PEDRLKLVINAKLEAGLL+PYNY++GYARLQ YMD+ M QSS
Sbjct: 169 TAKENFFLTAADPSTEVEPEDRLKLVINAKLEAGLLQPYNYSQGYARLQNYMDKYMNQSS 228

Query: 252 KQRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGE 311
           +QRILKPLSTIRPAFR IARSLKDVDL+LVEE FER+LLSYDRVFTSMSMPACLWRRTGE
Sbjct: 229 RQRILKPLSTIRPAFRAIARSLKDVDLVLVEEGFERMLLSYDRVFTSMSMPACLWRRTGE 288

Query: 312 IYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCNL 371
           IYR NKEFA+LVDCTVD+LRDG LAIYELM+EESAVNFWEKYGSIAFDKGQK VLTSCNL
Sbjct: 289 IYRGNKEFASLVDCTVDDLRDGNLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCNL 348

Query: 372 QTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406
           +++DG +++ CCFSFTIRRDRYNIPICI+GNFIPI
Sbjct: 349 RSKDGRKRRPCCFSFTIRRDRYNIPICIIGNFIPI 383

>YPL133C (RDS2) [5312] chr16 complement(299887..301227) Protein with
           similarity to transcription factors, has Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region, involved in resistance to the antifungal drug
           ketoconazole [1341 bp, 446 aa]
          Length = 446

 Score =  408 bits (1049), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 194/215 (90%), Positives = 206/215 (95%)

Query: 192 TLKEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSS 251
           T KEQFFLTAADPSTEMTPE RLKLVINAKLEAGLLKPYNYAKGYARLQ YMD+ M QSS
Sbjct: 231 TPKEQFFLTAADPSTEMTPEHRLKLVINAKLEAGLLKPYNYAKGYARLQDYMDKYMNQSS 290

Query: 252 KQRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGE 311
           KQRILKPLSTIRPAFRTIARSLKDVDL+LVEE+FER+LLSYDRVFTSMSMPACL RRTGE
Sbjct: 291 KQRILKPLSTIRPAFRTIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLCRRTGE 350

Query: 312 IYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCNL 371
           IYRANKEFA+LVDCTVD+LRDGKLAIYELM+EESAVNFWEKYGSIAFDKGQK VLTSC+L
Sbjct: 351 IYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCSL 410

Query: 372 QTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406
           +T+DG RK+ CCFSFTIRRDRYNIPICIVGNFIP+
Sbjct: 411 RTKDGIRKRPCCFSFTIRRDRYNIPICIVGNFIPL 445

 Score =  108 bits (269), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 86/141 (60%), Gaps = 16/141 (11%)

Query: 17  KKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATA---EM-GLNMSPPQDS---- 68
           K  K+CLFC+RSHV CD +RPCSRC+KR I++LC     A   EM   + S P D+    
Sbjct: 12  KAFKTCLFCKRSHVVCDKQRPCSRCVKRDIAHLCREDDIAVPNEMPSQHESSPNDNNIQG 71

Query: 69  -----IRTGAPGSSMYETPPIPNSINTYNKMVSSATGTTPATN-PNLYLPQQPSFISENA 122
                  TG P  S Y+  P+  S +TY + +S    ++   +  +L LPQQP F+SEN 
Sbjct: 72  KYANKAHTGIP--SDYQNEPVNKSGSTYGEELSPKLDSSLVNDTTSLLLPQQPVFVSENV 129

Query: 123 GSEFNSLNEFLNMLEDPSLLE 143
           GSEF+SLNEFL+MLE+P L +
Sbjct: 130 GSEFSSLNEFLSMLENPLLTQ 150

>KLLA0D07029g 602763..604367 some similarities with sp|P19541
           Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 534

 Score =  410 bits (1054), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 190/215 (88%), Positives = 203/215 (94%)

Query: 192 TLKEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSS 251
           T KE FFLTAADPSTE+ PEDRLKLVINAKLEAGLL+PYNYAKGY+RLQK+MD+ M QSS
Sbjct: 319 TPKENFFLTAADPSTEINPEDRLKLVINAKLEAGLLQPYNYAKGYSRLQKFMDKYMNQSS 378

Query: 252 KQRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGE 311
           KQRILKPLS IRPAFR IARSLKDVDL+LVEE+FER+LLSYDRVFTSMSMPACLWRRTGE
Sbjct: 379 KQRILKPLSIIRPAFRAIARSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGE 438

Query: 312 IYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCNL 371
           IYR NKEFA+LVDC VDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQK VLTSCNL
Sbjct: 439 IYRGNKEFASLVDCKVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKAVLTSCNL 498

Query: 372 QTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406
           +TRDG +++ CCFSFTIRRDRYNIPICIVGNFIPI
Sbjct: 499 RTRDGRQRRPCCFSFTIRRDRYNIPICIVGNFIPI 533

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 20/30 (66%), Positives = 26/30 (86%)

Query: 21 SCLFCRRSHVNCDGKRPCSRCLKRGISNLC 50
          +C+FCRRSH+ CD +RPCSRC+KR I +LC
Sbjct: 16 ACVFCRRSHMVCDEQRPCSRCVKRSIGHLC 45

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 6/62 (9%)

Query: 86  NSINTYNKMVSSATGTTPATNPNLYLPQQPSFISENAGSEFNSLNEFLNMLEDPSLLENT 145
           NS++  N M  + +GT+     +L    QP F+SE+ GSEF+SLNEFL MLEDP L+E  
Sbjct: 183 NSVHGSN-MHHALSGTSLGRISSL---NQPLFLSEHIGSEFSSLNEFLTMLEDPMLIE-- 236

Query: 146 PG 147
           PG
Sbjct: 237 PG 238

>CAGL0M02651g complement(304583..305971) similar to sp|P19541
           Saccharomyces cerevisiae YPL133c, hypothetical start
          Length = 462

 Score =  401 bits (1031), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 186/215 (86%), Positives = 205/215 (95%)

Query: 192 TLKEQFFLTAADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSS 251
           T KEQFFLTAADPSTEM P DRLKLVINAKLEAGLLKPY+YAKGYARLQ+YMD+ M  ++
Sbjct: 240 TSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYAKGYARLQEYMDKYMNDTN 299

Query: 252 KQRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGE 311
           KQRILKPL +IRPAFRTIA+SLKDVDL+LVEE+FER+LLSYDRVFTSMSMPACLWRRTGE
Sbjct: 300 KQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSYDRVFTSMSMPACLWRRTGE 359

Query: 312 IYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFDKGQKTVLTSCNL 371
           IYRANKEFA+LVDCTVD+LRDGKLAIYELM+EESAVNFWEKYGSIAFDKGQK VLTSC+L
Sbjct: 360 IYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCSL 419

Query: 372 QTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406
           +T+DG +K+ CCFSFTIRRDRYNIPICIVGNFIP+
Sbjct: 420 RTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPL 454

 Score =  107 bits (267), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 86/136 (63%), Gaps = 17/136 (12%)

Query: 14  KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTGA 73
           K++K  KSC+FCRRSHVNCD +RPCSRC+KR I +LC +        N+S  Q   +   
Sbjct: 8   KQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCVADE------NVSNIQSQYQYKN 61

Query: 74  PGSSMYETPPIPNS-INTYNKMV------SSATGT-TP--ATNPNLYLPQQPSFISENAG 123
             S +  T  IPN+ IN  ++        SS  GT TP  ++N NL LP QP+F+SEN G
Sbjct: 62  SMSPIGST-EIPNAEINIGDETRAIQGSNSSVYGTETPISSSNNNLLLPPQPNFVSENVG 120

Query: 124 SEFNSLNEFLNMLEDP 139
           SEF+SLNEFL MLE+P
Sbjct: 121 SEFSSLNEFLMMLENP 136

>Kwal_14.1636
          Length = 456

 Score =  116 bits (290), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 100/181 (55%), Gaps = 1/181 (0%)

Query: 228 KPYNYAKGYARLQKYMDENMEQSSKQRILKPLSTIRPAFRTIARSLKDVDLILVEENFER 287
           +P+++  G+  L +Y+     +     + + L+  RP F  IA +L + D+I +E+ ++R
Sbjct: 273 RPFSHTSGFHSLLQYLRARFNREDVVEMCRSLAEFRPTFIAIAVTLTEEDMIFMEQCYQR 332

Query: 288 LLLSYDRVFTSMSMPACLWRRTGEIYRANKEFATLVDCTVDELRDGKLAIYELMSEESAV 347
            LL YD+  + +  P C+WRR G+I   + EF+ L   T  +L      I ELM +ES  
Sbjct: 333 TLLEYDQFISQLGTPTCVWRRNGQISYVSDEFSLLTGWTRADLLFKMTFIVELMDDESVR 392

Query: 348 NFWEKYGSIAF-DKGQKTVLTSCNLQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406
            +++ +  +A+ D      + +C L T    R+  CC  +T++RD + +P+ I+GNF+PI
Sbjct: 393 EYFKTFNRVAYRDFKGSERMKTCRLLTPVKGRQIECCCIWTLKRDVFGLPLMIIGNFMPI 452

Query: 407 V 407
           +
Sbjct: 453 L 453

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 27/40 (67%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSG 53
          +++K + +C+ C +SHV C  +RPC+RC+K+G+   C   
Sbjct: 4  RRQKTSVACINCSKSHVTCQAERPCTRCVKKGLEASCVDA 43

>YBR239C (YBR239C) [418] chr2 complement(698311..699900) Protein
           with similarity to transcription factors, has
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1590 bp, 529 aa]
          Length = 529

 Score =  109 bits (273), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 107/208 (51%), Gaps = 1/208 (0%)

Query: 201 AADPSTEMTPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSSKQRILKPLS 260
           AA+  + +  E  L+     ++   +  P+++  G+  L  Y+     Q    ++ + ++
Sbjct: 321 AANIKSNVEWEHSLRYSTPMEIYTSINAPFSHTPGFHHLLVYLKHRFNQQDLVKMCRSIA 380

Query: 261 TIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRRTGEIYRANKEFA 320
             RP F   + +L + D+I +E+ ++R LL Y +    +  P C+WRR G+I   N+EF 
Sbjct: 381 EFRPIFIACSVTLTEEDMIFMEQCYQRTLLEYVKFIAQIGTPTCIWRRNGQISYVNEEFE 440

Query: 321 TLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAF-DKGQKTVLTSCNLQTRDGSRK 379
            L   T +EL +    I E+M +ES  ++++    +A+ D      +  C L +    + 
Sbjct: 441 ILCGWTREELLNKMTFIVEIMDDESVRDYFKTLSKVAYRDFRGSEKMKVCRLLSPIKGKI 500

Query: 380 KNCCFSFTIRRDRYNIPICIVGNFIPIV 407
            +CC  +T++RD   +P+ I+GNF+PI+
Sbjct: 501 IHCCCMWTLKRDVSGLPLMILGNFMPIL 528

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 21 SCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSG 53
          +C+ C R HV+C+ KRPC RC+ +G++  C   
Sbjct: 39 ACVNCSRLHVSCEAKRPCLRCISKGLTATCVDA 71

>AFL031W [3162] [Homologous to ScYBR239C - SH]
           complement(376161..377714) [1554 bp, 517 aa]
          Length = 517

 Score =  108 bits (271), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 96/182 (52%), Gaps = 3/182 (1%)

Query: 228 KPYNYAKGYARLQKYMDENMEQSSKQRILKPLSTIRPAFRTIARSLKDVDLILVEENFER 287
           +P+ +  G+  L KY+     +     + + ++  RP F   A  L + D+I +E++++R
Sbjct: 311 EPFCHTSGFHSLLKYLHSRFHRHDLVEMCRSIAEFRPIFIASAVDLTEEDMIFMEQSYQR 370

Query: 288 LLLSYDRVFTSMSMPACLWRRTGEIYRANKEFATLVDCTVDELRDGKLAIYELMSEESAV 347
            LL YDR  T +  P C+WRR G+I   N EF  L   T +EL      I EL+ + S  
Sbjct: 371 TLLEYDRFITQIGTPTCVWRRNGQISYLNDEFCLLTGWTREELLSKMTFIVELLDDNSVR 430

Query: 348 NFWEKYGSIAFD--KGQKTVLTSCNLQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIP 405
            +++ +  +A+   KG + + T   L   +G R   C   +T +RD + +P+ IVG+F+P
Sbjct: 431 EYFKTFSKVAYKDFKGFEQMETCVLLSPIEG-RTIECSCMWTWKRDVFGMPMMIVGHFLP 489

Query: 406 IV 407
           ++
Sbjct: 490 VI 491

 Score = 51.2 bits (121), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 4/121 (3%)

Query: 15  KRKKTK-SCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTGA 73
           KRKKT  +C+ C RSHV C+ +RPC+RC+K+G+   C +            P+D +    
Sbjct: 11  KRKKTNVACVNCSRSHVTCESQRPCTRCVKKGLEMSCVNAPRKRRKYLADVPEDQLPIPL 70

Query: 74  PGSSMYETPPIPNSINTYNKMVSSATGTTPATNPNLYLPQQPSFISENAGSEFNSLNEFL 133
             +     P +           S + G          +  +P F+S  A  E+++L++ +
Sbjct: 71  KPADADAGPGMSERDGAAE---SGSKGPEHQFQDQGKIVHKPKFLSNAANLEYSTLSDII 127

Query: 134 N 134
           +
Sbjct: 128 H 128

>KLLA0F10417g 961004..962527 similar to sp|P38140 Saccharomyces
           cerevisiae YBR239c, start by similarity
          Length = 507

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 96/175 (54%), Gaps = 3/175 (1%)

Query: 235 GYARLQKYMDENMEQSSKQRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDR 294
           G+  L +Y+    +++    + + L+ +RP F      L D D+I +E++ +R LL Y++
Sbjct: 326 GFHALLRYLKRRFDKNQLVEMCRCLAELRPIFIASTIDLTDEDMIFMEKSHQRTLLEYEK 385

Query: 295 VFTSMSMPACLWRRTGEIYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYG 354
             + +  P C+WRR G+I   N EF+ L      EL +    I ELM  ++ + +++ + 
Sbjct: 386 FISQVGTPTCVWRRNGQISYVNDEFSLLTGWNRLELLNKMTFIVELMDGDTVMEYFQTFT 445

Query: 355 SIAFD--KGQKTVLTSCNLQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPIV 407
            +A+   +G +T +  CNL T        CC  +T++RD + +P+ I+GNF+PI+
Sbjct: 446 RVAYQGFRGAET-MRICNLLTPIKGSVIKCCCLWTLKRDAFGLPMMIIGNFMPIL 499

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 63/142 (44%), Gaps = 23/142 (16%)

Query: 14  KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTGA 73
           + +K + +C+ C +SHV CD  RPC+RC+++G+   C      ++      P+D + +  
Sbjct: 5   RNKKVSVACVHCAKSHVTCDDNRPCTRCIRKGLEESCIDAPRKKVKYLRDVPEDQLPSVL 64

Query: 74  PGSSMYETPPI------------PNSINTYN--KMVSSATGTTPATNP-------NLYLP 112
              S  + PP+            PN    Y+   +  SA       NP       N  + 
Sbjct: 65  --RSTKQVPPVNAVKLKMEPGILPNIPLDYDGGTIRQSAPANNGKNNPETQQTLSNGQIT 122

Query: 113 QQPSFISENAGSEFNSLNEFLN 134
            +P F+S  A  E++ L++ ++
Sbjct: 123 HRPKFLSSAADLEYSILSDIIH 144

>Scas_597.2
          Length = 540

 Score =  103 bits (257), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 99/182 (54%), Gaps = 3/182 (1%)

Query: 228 KPYNYAKGYARLQKYMDENMEQSSKQRILKPLSTIRPAFRTIARSLKDVDLILVEENFER 287
           +P+ +  G+  L  Y+     Q     + + ++  RP F   + +L + D+I +E+ ++R
Sbjct: 359 EPFCHTMGFRHLLLYLRNRFNQKDIVSMCRSMTEFRPIFIACSMTLTEEDMIFMEQCYQR 418

Query: 288 LLLSYDRVFTSMSMPACLWRRTGEIYRANKEFATLVDCTVDELRDGKLAIYELMSEESAV 347
            LL Y +    +  P C+WRR G+I   N+EF  L   T +EL +    I E++ ++S  
Sbjct: 419 TLLEYSKFIGQIGTPTCVWRRNGQISYINEEFEILTGWTREELLNKMTFIVEILDDDSVR 478

Query: 348 NFWEKYGSIAFD--KGQKTVLTSCNLQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIP 405
           ++++ + S+A+   KG + + T C L T    +  NC   +T++RD   +P+ I+GNF+P
Sbjct: 479 DYFKTFSSVAYKDFKGCEQMKT-CRLLTPLEGQVVNCGCMWTLKRDISGLPLMILGNFMP 537

Query: 406 IV 407
           I+
Sbjct: 538 IL 539

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCT 51
          K+RK   +C  C +SH +CD  RPCSRC+K+ + + C 
Sbjct: 35 KRRKINVACSNCAKSHSSCDSCRPCSRCIKKELQDSCV 72

>AFR081C [3273] [Homologous to ScYJL103C - SH] (574366..575814)
           [1449 bp, 482 aa]
          Length = 482

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 108/473 (22%), Positives = 173/473 (36%), Gaps = 98/473 (20%)

Query: 19  TKSCLFCRRSHVNCDGKRPCSRCLKRGISNLC---------TSGATAEMGL--------- 60
           +++C+FC   H+ CD  RPC  C KR I   C         T G T   G+         
Sbjct: 17  SRACVFCHEKHLQCDVGRPCQNCEKRNIGESCRDNVRKVRKTRGRTPRSGVMNLRRARRE 76

Query: 61  ---NMSPPQDSIRTGAPGSSMYETPPIPNSINTYNKMVS--------SATGTTPATNPNL 109
               ++    S   G PGS+    P +P+    ++  V          AT   P    ++
Sbjct: 77  HEDELAIATKSRGAGEPGST--GLPQVPSLSTLFDANVDPVIDEELLPATYVDPLGPSDV 134

Query: 110 YLPQQ--PSFISENAGSEFNSLNEFLNMLEDPSLLENTPGITXXXXXXXXXXXXXXXXXX 167
            LP     SF S  A SE+  LNE L           +PGI                   
Sbjct: 135 ELPTSGAESFGSVWASSEYTKLNEIL----------GSPGIERPRKHVPSKYEPFAVPAT 184

Query: 168 XXXXXXXXXXXXXXXXXXXXXXXXTLKEQFFLTAADPSTEMTPEDRLKLVINAKL----- 222
                                   TL+    L  A  S + + +D     + + +     
Sbjct: 185 AEHSPSPSTPIELLQDHAGLLFRNTLRRHISLDTAQSSYQASTQDTQASTVASSVSCEGA 244

Query: 223 -----EAGLLKPY----------------------NYAKGY--------ARLQKYMDENM 247
                EA    PY                      NY + Y        AR     DE  
Sbjct: 245 QFPASEAEYTSPYSFRQLVRSPEDLYRHQNSIFPHNYRQAYLELLNILRARFLSAQDEIA 304

Query: 248 EQSSKQRILKPLSTIR----PAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMS-MP 302
            +   +++     +I+    P F T+  +L + DL + E   +R LL Y+ +   ++ +P
Sbjct: 305 REEGPKQLHSIAQSIKTYYAPIFVTLTSNLIESDLKMHELILQRTLLEYENMSKMVNCIP 364

Query: 303 ACLWRRTGEIYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGS-IAFDKG 361
            C+WRR+GEI   + EF +L   +  EL   +  I E       V++++ +   +AF   
Sbjct: 365 MCIWRRSGEICYVSNEFISLTGFSRRELLMRRRFIMEFFDNHGIVDYFKLFNEYLAFSSK 424

Query: 362 Q--------KTVLTSCNLQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406
           +        + V + CNL   + S  K  C  +T++RD +NIP+ ++G F+PI
Sbjct: 425 EGFSSTSDGQAVFSECNLLMANNSFLKCACI-WTVKRDSFNIPMLVMGQFLPI 476

>CAGL0K06985g 681115..682905 similar to sp|P38140 Saccharomyces
           cerevisiae YBR239c, hypothetical start
          Length = 596

 Score = 96.3 bits (238), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/221 (26%), Positives = 108/221 (48%), Gaps = 15/221 (6%)

Query: 201 AADPSTEMTPEDRLKLVINAKLEAGLL------------KPYNYAKGYARLQKYMDENME 248
           A   S E  P D  +L  N + +  L             +P+++  G+  L +Y+ +   
Sbjct: 377 AVSVSVECPPPDGSRLYNNVEWDHSLKYGTPVEIYKLINEPFSHTPGFRHLLQYLRKRFS 436

Query: 249 QSSKQRILKPLSTIRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMSMPACLWRR 308
           Q     + + ++  RP F   + +L + D+I +E+ ++R LL Y +    +  P  +WRR
Sbjct: 437 QKDLVSMCQNMAYFRPIFIACSITLTEEDMIFMEQCYQRTLLQYVKFIQEIGTPTVVWRR 496

Query: 309 TGEIYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSIAFD--KGQKTVL 366
            G+I   N EF  L     +EL D    I E++ +ES   +++ +  IA++  KG +  +
Sbjct: 497 NGQISYVNDEFEILSGWKREELLDKMSFIVEIIDDESVREYFKTFARIAYNNIKGSEQ-M 555

Query: 367 TSCNLQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPIV 407
             C L T   ++   C   +T++RD   +P+ I+GNF+P++
Sbjct: 556 DVCRLLTPIRNQVIECKCIWTLKRDMSGLPLMILGNFLPVL 596

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (46%), Gaps = 28/143 (19%)

Query: 14  KKRKKTK-SCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEM----GLNMSPPQDS 68
           KKRK T  +C+ C R+H +C+ KRPCSRC+K+GI+N C      +     G++  P    
Sbjct: 59  KKRKNTNVACVNCSRNHSSCEQKRPCSRCIKKGIANTCVDAPRKKKKYLEGIDTLP---- 114

Query: 69  IRTGAPGSSMYETP-----------------PIP-NSINTYNKMVSSATGTTPATNPNLY 110
           IR G+  +  Y TP                   P +SI  +N +  ++  + P    N+ 
Sbjct: 115 IRVGS-NTPHYGTPLQIGYHSASFIDNQQYGQTPRHSIGDFNDIYPTSYKSYPENRYNVR 173

Query: 111 LPQQPSFISENAGSEFNSLNEFL 133
             Q   F S  A SE++ L+  +
Sbjct: 174 NDQAHRFQSYAANSEYSVLSTIV 196

>KLLA0F13904g complement(1287758..1289497) some similarities with
           sp|P42950 Saccharomyces cerevisiae YJL103c, hypothetical
           start
          Length = 579

 Score = 94.7 bits (234), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 106/228 (46%), Gaps = 38/228 (16%)

Query: 209 TPEDRLKLVINAKLEAGLLKPYNYAKGYARLQKYMDENMEQSSK--------------QR 254
           TPED  K          L++P+NY   Y  L +++      S K              Q 
Sbjct: 356 TPEDLYK-------HQALIQPHNYKSAYLELLRFLRWRFINSDKPSSGKSQRDGPEQLQN 408

Query: 255 ILKPLST-IRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMS-MPACLWRRTGEI 312
           I   + T   P F T+  SL   DL L E   +R LL Y+ +   ++  P C+WRR+GEI
Sbjct: 409 IAHSIKTHYAPIFVTLTNSLIAQDLKLQEIILQRALLEYESMAKLVNCTPMCIWRRSGEI 468

Query: 313 YRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGS-IAFDKGQ--------- 362
             A+ EF +L      E+ + +  I E M  ES V++++ +   +AF   Q         
Sbjct: 469 CFASNEFISLTGFNKKEILNKRKFIMEFMDNESIVDYYDIFHEYLAFGSTQSGPFNSSTG 528

Query: 363 ----KTVLTSCNLQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406
               + + + CNL  ++G   +  C  +T++RD +NIP+ I+G F+PI
Sbjct: 529 TSDGQAIFSECNLLLKNGCYLRCACI-WTVKRDAFNIPMLIMGQFLPI 575

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 21 SCLFCRRSHVNCDGKRPCSRCLKRGISNLC 50
          +C+FC   H+ CD  RPC  C KRGI + C
Sbjct: 19 ACVFCHEKHLQCDLGRPCQNCSKRGIGDTC 48

>Sklu_2207.4 YJL103C, Contig c2207 6715-8313 reverse complement
          Length = 532

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 105/208 (50%), Gaps = 29/208 (13%)

Query: 226 LLKPYNYAKGYARLQKYMDE-------NMEQSSK--------QRILKPLST-IRPAFRTI 269
           L+KP+NY   Y  L  Y+ +       + + +SK        Q I   ++T   P F T+
Sbjct: 321 LIKPHNYRAAYRDLLMYLRDRFLDSRGSQKNTSKNRDGPQHLQHIAHSIATHYAPIFVTL 380

Query: 270 ARSLKDVDLILVEENFERLLLSYDRVFTSMS-MPACLWRRTGEIYRANKEFATLVDCTVD 328
             +L + DL L E   +R LL Y+ +   ++  P C+WRR+GEI   + EF +L      
Sbjct: 381 TTNLIENDLKLQELILQRTLLEYENMAKLVNCTPMCIWRRSGEICYVSNEFVSLTGFPRK 440

Query: 329 ELRDGKLAIYELMSEESAVNFWE----------KYGSIAFDKGQKTVLTSCNLQTRDGSR 378
           ++   +  I E + +ES V++++          K G+     GQ  V + CNL  ++G+ 
Sbjct: 441 DMLSKRRFILEFLDDESVVDYFDIFHEYLAFGSKEGAGGTSDGQ-AVFSECNLLLKNGTY 499

Query: 379 KKNCCFSFTIRRDRYNIPICIVGNFIPI 406
            K  C  +T++RD YNIP+ ++G F+PI
Sbjct: 500 LKCACI-WTVKRDGYNIPLLVMGQFLPI 526

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 20 KSCLFCRRSHVNCDGKRPCSRCLKRGISNLC 50
          K+C+FC   H+ CD  RPC  CL+R I + C
Sbjct: 18 KACVFCHEKHLQCDVGRPCQNCLRRNIGHEC 48

>YJL103C (YJL103C) [2812] chr10 complement(228942..230798) Protein
           with similarity to transcription factors, contains a
           Zn[2]-Cys[6] fungal-type binuclear cluster domain in the
           N-terminal region [1857 bp, 618 aa]
          Length = 618

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/236 (25%), Positives = 101/236 (42%), Gaps = 56/236 (23%)

Query: 226 LLKPYNYAKGYARL-----QKYM------------DENMEQSSKQR------ILKPLSTI 262
           L+KP+NY   Y +L     +K++            DE+  Q    R      I   L   
Sbjct: 380 LIKPHNYKLAYTKLLTTLRKKFLEGAEIDKSASVKDEHSTQKHNLRYDLEVIIRSILERY 439

Query: 263 RPAFRTIARSLKDVDLILVEENFERLLLSYDRVFTSMS-MPACLWRRTGEIYRANKEFAT 321
            P F ++  ++ + DL+L E   +R LL  + +   +S  P C+WRR+GEI   + EF +
Sbjct: 440 APIFISLTSNMIEEDLLLQEVTLQRALLDLENMAKLVSCTPMCIWRRSGEICFVSNEFYS 499

Query: 322 LVDCTVDELRDGKLAIYELMSEESAVNFWEKYGSI------------------------- 356
           L     + L D    I+E +  +S  N+++ +  +                         
Sbjct: 500 LTGFNKNLLLDRTSFIFEYLDHKSVSNYFQIFNELLAFGYNDINKRKKLLMLNACSSTSS 559

Query: 357 ------AFDKGQKTVLTSCNLQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406
                 +F    K + T CNL   +G   K C   +T++RD +NIPI ++G F+PI
Sbjct: 560 KITEGFSFTTDGKAIFTKCNLLLSNGLYLK-CACCWTVKRDSFNIPILVMGQFLPI 614

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 21 SCLFCRRSHVNCDGKRPCSRCLKRGISNLC 50
          +C FC   H+ CD  RPC  CLKR I   C
Sbjct: 19 ACEFCHTKHIQCDVGRPCQNCLKRNIGKFC 48

>Scas_711.18
          Length = 509

 Score = 74.7 bits (182), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 105/234 (44%), Gaps = 37/234 (15%)

Query: 206 TEMTPEDRLKLVINAKLEAGL---LKPYNYAKGYARLQKYMDE--NMEQSSKQ------- 253
           + M+P D  K++   K    +   +K +NY   Y  + + + +   ++Q S Q       
Sbjct: 279 SHMSPFDIRKIIRTPKDLYRIQNSIKAFNYMLSYYGMIRCLKKLFAIKQESAQGDKDVLK 338

Query: 254 RILKPLST-IRPAFRTIARSLKDVDLILVEENFERLLLSYDRVFT-SMSMPACLWRRTGE 311
            I+K +S    P    +   +   D    E   +R+LL  + + T S   P  +WRRTGE
Sbjct: 339 SIVKEISEEFAPVILALETGMIPDDFQFQELTLQRMLLDLEDMATFSNCTPLVIWRRTGE 398

Query: 312 IYRANKEFATLVDCTVDELRDGKLAIYELMSEESAVNFWEKYGS-IAFDKGQKTVLTSCN 370
           I  AN EF +L   T  EL   +  I+E    +S  N+++K+ S +AF   +K   T   
Sbjct: 399 ICFANNEFLSLTGYTDVELTSRQRFIFEFWDRQSVFNYFKKFHSMLAFGPIEKEGQT--- 455

Query: 371 LQTRDGSR------------------KKNCCFSFTIRRDRYNIPICIVGNFIPI 406
            +T  G R                    NC   +TIRRD +NIP+ +VG F+PI
Sbjct: 456 -ETYPGRRWSFNNSVDRSKILLKNGFHLNCATCWTIRRDTFNIPLLVVGYFLPI 508

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 21 SCLFCRRSHVNCDGKRPCSRCLKRGISNLC 50
          +C FC   H+ CD  RPC  C+KR I N C
Sbjct: 33 ACEFCHIKHLQCDVGRPCKNCIKRNIGNTC 62

>CAGL0L03674g 420574..422463 some similarities with sp|P42950
           Saccharomyces cerevisiae YJL103c, hypothetical start
          Length = 629

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 101/230 (43%), Gaps = 52/230 (22%)

Query: 226 LLKPYNYAKGYARLQKYMDENM--EQSSKQR-----ILK-PLSTIRPAFRTIARSLKDVD 277
           L+KP+NY   Y +L + +++    + S K+R     I+K  L    P F  +  ++ + D
Sbjct: 399 LIKPHNYRHTYKKLLEQLEKIFLSDNSPKRRGQLQSIVKCILEDYVPTFIALTSNMIESD 458

Query: 278 LILVEENFERLLLSYDRVFTSMS-MPACLWRRTGEIYRANKEFATLVDCTVDELRDGKLA 336
           L L E   +R LL  + +   ++  P C+WRR+GEI   + EF  L      E+   +  
Sbjct: 459 LYLQELTLQRTLLELESMAKLVNCSPICIWRRSGEISYVSDEFLQLTGFKRKEILASRRF 518

Query: 337 IYELMSEESAVNFWEKYGS-IAFDKGQKTVLTS--------------------------- 368
           I+E +   S VN++  +   +AF  G K  +TS                           
Sbjct: 519 IFEFLDPTSIVNYFTNFHEYLAF--GSKNQMTSNISLIKQGLLVNGAVVRKSNPIVSSSP 576

Query: 369 ------------CNLQTRDGSRKKNCCFSFTIRRDRYNIPICIVGNFIPI 406
                       C+L   +G   K C   +T++RD +NIP+ I+G F+P+
Sbjct: 577 MCGTNTDGIFDECHLLLSNGYYLK-CATCWTVKRDSFNIPLLIMGQFLPV 625

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 19 TKSCLFCRRSHVNCDGKRPCSRCLKRGISNLC 50
           K+C FC   H++CD  RPC  C+KR    LC
Sbjct: 2  VKACEFCHEKHLHCDPGRPCINCVKRNRGQLC 33

>KLLA0A02585g complement(226562..227674) some similarities with
          ca|CA5890|CaFCR1 Candida albicans Zinc cluster
          transcription factor, hypothetical start
          Length = 370

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 27/37 (72%), Gaps = 2/37 (5%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCT 51
          KR+ +K+C  CR+S   CDG+RPCSRCLK   + LCT
Sbjct: 15 KRRVSKACDACRKSKTKCDGERPCSRCLKE--NKLCT 49

>Scas_542.8
          Length = 902

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGI 46
          K+R K+ +C+ CR+ H+ C G  PC+RC+K  +
Sbjct: 21 KRRPKSLACILCRKRHIKCSGGNPCARCIKHDL 53

>KLLA0F09559g complement(876719..878695) some similarities with
           sgd|S0005698 Saccharomyces cerevisiae YOR172w,
           hypothetical start
          Length = 658

 Score = 45.1 bits (105), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 6/62 (9%)

Query: 14  KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTG 72
           K+RK  KSC FCR+  + CD KRP C+ C  RG+S    +      G N     D +   
Sbjct: 82  KRRKVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD-----GYNFDISHDDVYNK 136

Query: 73  AP 74
           +P
Sbjct: 137 SP 138

>KLLA0E18194g 1613115..1615712 similar to sp|P25502 Saccharomyces
          cerevisiae YKL015w PUT3 positive activator of the
          proline utilisation pathway, start by similarity
          Length = 865

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 15 KRKKTK----SCLFCRRSHVNCDGKRPCSRCLKRGIS 47
          K+KK K    +C  CRR H+ C G  PCS+CLK G++
Sbjct: 35 KKKKVKRSSLACTRCRRRHIKCPGGNPCSKCLKAGVA 71

>Sklu_2191.2 YKL222C, Contig c2191 6517-8673 reverse complement
          Length = 718

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+RK  KSCLFCR+  + CD K+P CS C  R +
Sbjct: 11 KRRKVIKSCLFCRKRKLKCDHKKPKCSTCAARNL 44

>Kwal_23.6425
          Length = 735

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGIS 47
          K+RK  K CLFCR+  + CD  RP C  C  RG++
Sbjct: 28 KRRKSIKQCLFCRKRKLKCDKNRPVCGTCASRGLT 62

>KLLA0D00484g 44879..47893 no similarity, hypothetical start
          Length = 1004

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (67%), Gaps = 4/37 (10%)

Query: 14 KKRKKT---KSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          KKRK T   K CL C+++H  CD ++P CSRC KR I
Sbjct: 60 KKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSI 96

>KLLA0F10835g 997512..999782 no similarity, hypothetical start
          Length = 756

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%), Gaps = 3/39 (7%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCT 51
          K R   K CL C+RSH+ CD  +P C +C+KR IS  CT
Sbjct: 16 KTRYSRKGCLQCKRSHLKCDEGQPKCGKCVKRNIS--CT 52

>CAGL0K05841g 572315..576433 similar to sp|P12351 Saccharomyces
           cerevisiae YLR256w HAP1 transcription factor,
           hypothetical start
          Length = 1372

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 21  SCLFCRRSHVNCDGKRP-CSRCLKRGISNLC 50
           SC  CRR  V CD  RP C++C+K G+++LC
Sbjct: 70  SCTICRRRKVKCDKSRPNCTQCVKTGVAHLC 100

>AGL233C [4079] [Homologous to ScYKL222C - NSH; ScYOR172W - NSH]
          (260414..263032) [2619 bp, 872 aa]
          Length = 872

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          +RK +KSC+FCR+  V C+  RP CS C+ +G+
Sbjct: 12 RRKVSKSCVFCRKRRVKCNKARPKCSTCIGKGL 44

>KLLA0F22990g 2134385..2138146 similar to sp|P12351 Saccharomyces
          cerevisiae YLR256w HAP1 transcription factor singleton,
          hypothetical start
          Length = 1253

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 4/41 (9%)

Query: 14 KKRKKTK---SCLFCRRSHVNCDGKRP-CSRCLKRGISNLC 50
          +KRK+ +   SC  CR+  V CD  RP C +C+K G+ +LC
Sbjct: 14 QKRKRNRVPLSCTICRKRKVKCDKGRPQCQQCVKTGVGHLC 54

>Scas_669.8
          Length = 637

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEM 58
          ++RK   +C  C++  V CD   PC+ C+++G+ N C +  T++ 
Sbjct: 8  ERRKTPYACNVCKKRKVKCDKLIPCTSCIQKGLENECLTSVTSKF 52

>Sklu_2384.6 YKL015W, Contig c2384 10929-13424
          Length = 831

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 23/34 (67%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGIS 47
          ++++ + +C+ CRR HV C G  PCS+C+   I+
Sbjct: 40 RQKRSSMACVRCRRRHVKCPGGNPCSKCIAANIA 73

>ACL195C [854] [Homologous to NOHBY] (19204..19533) [330 bp, 109
          aa]
          Length = 109

 Score = 38.1 bits (87), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/37 (40%), Positives = 24/37 (64%), Gaps = 4/37 (10%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGK----RPCSRCLKRGI 46
          K +K  +SC+ CR++ + CD      +PCS CLK+G+
Sbjct: 23 KMKKPLRSCVRCRKNKIKCDSATRRPKPCSSCLKKGV 59

>AFR117C [3309] [Homologous to ScYLR256W (HAP1) - SH]
          (646832..650290) [3459 bp, 1152 aa]
          Length = 1152

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 4/40 (10%)

Query: 15 KRKKTK---SCLFCRRSHVNCDGKRP-CSRCLKRGISNLC 50
          KRK+ +   SC  CR+  V CD  RP C++C K G+++LC
Sbjct: 9  KRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLC 48

>KLLA0F04609g complement(451579..454329) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, start by similarity
          Length = 916

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRC 41
          K+R+ T++C  CR+  V CDGK+PC  C
Sbjct: 6  KRRRVTRACDECRKKKVKCDGKQPCIHC 33

>Sklu_1993.2 YIL130W, Contig c1993 2139-4610 reverse complement
          Length = 823

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTGA 73
          K+R+ T++C  CR+  V CDG++PC  C     S  CT     + G + +P   ++R  A
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHCTV--YSYECTYNQPTKRGGSCAPQTITVRKPA 64

>CAGL0B03421g complement(336071..340138) similar to sp|P12351
          Saccharomyces cerevisiae YLR256w HAP1 transcription
          factor, hypothetical start
          Length = 1355

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 14 KKRKKTK-SCLFCRRSHVNCDGKRP-CSRCLKRGISNLC 50
          KKR +   SC  CR+  V CD  RP C++C K G+++LC
Sbjct: 14 KKRNRIPLSCTICRKRKVKCDKTRPHCNQCTKTGVAHLC 52

>YOR172W (YRM1) [4969] chr15 (654210..656570) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2361 bp, 786 aa]
          Length = 786

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGIS 47
          K+RK  KSC FCR+  + CD ++P CS C  RG S
Sbjct: 23 KRRKPIKSCAFCRKRKLRCDQQKPMCSTCKTRGRS 57

>YLR256W (HAP1) [3650] chr12 (646417..650925) Transcription factor
          with heme-dependent DNA-binding activity, responsible
          for heme-dependent activation of many genes [4509 bp,
          1502 aa]
          Length = 1502

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 4/40 (10%)

Query: 15 KRKKTK---SCLFCRRSHVNCDGKRP-CSRCLKRGISNLC 50
          KRK+ +   SC  CR+  V CD  RP C +C K G+++LC
Sbjct: 54 KRKRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAHLC 93

>Scas_573.4
          Length = 1478

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 4/40 (10%)

Query: 15 KRKKTK---SCLFCRRSHVNCDGKRP-CSRCLKRGISNLC 50
          KRK+ +   SC  CR+  V CD  RP C +C K G+++LC
Sbjct: 33 KRKRNRVPLSCTICRKRKVKCDKIRPHCQQCTKTGVAHLC 72

>CAGL0L03377g complement(382932..386561) some similarities with
          sp|P46954 Saccharomyces cerevisiae YJL089w SIP4
          interacts with SNF1 protein kinase, hypothetical start
          Length = 1209

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGL 60
          K++ +++C  CR   + CDG +PCS C K G  N  TS   +  GL
Sbjct: 22 KKRHSQACDRCRSKKIKCDGLQPCSNCAKIGY-NCVTSDKLSRRGL 66

>KLLA0C04620g complement(422705..426514) weakly similar to
          sp|Q05854 Saccharomyces cerevisiae YLR278c, start by
          similarity
          Length = 1269

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 34/68 (50%), Gaps = 10/68 (14%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI-----SNLCTSGATAEMGLNMSPPQDS 68
          K+ ++++CL C+R    CD K P C+ CLK G+     +     GA  E     S PQ S
Sbjct: 34 KKGRSRACLLCQRRKQKCDHKIPSCTACLKAGVKCIQPAKYGYDGAVGE----QSSPQSS 89

Query: 69 IRTGAPGS 76
          + T   GS
Sbjct: 90 VATVTRGS 97

>YLR278C (YLR278C) [3671] chr12 complement(700001..704026) Protein
          with similarity to transcription factors, contains an
          N-terminal Zn[2]-Cys[6] fungal-type binuclear cluster
          domain [4026 bp, 1341 aa]
          Length = 1341

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ +++SCL CRR    CD K P C+ CLK GI
Sbjct: 34 KKGRSRSCLLCRRRKQRCDHKLPSCTACLKAGI 66

>KLLA0F19602g complement(1814949..1816760) similar to sp|P43634
          Saccharomyces cerevisiae YLR098c CHA4 transcription
          factor, start by similarity
          Length = 603

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGI 46
          +KRK   +C  CR     CD +RPCS CLK GI
Sbjct: 9  RKRKAHLACQNCRIKRRKCDMERPCSNCLKYGI 41

>YOR162C (YRR1) [4961] chr15 complement(639560..641992)
           Transcription factor involved in drug-induced
           transcriptional regulation, including activation of
           multidrug transporter gene SNQ2, has a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain [2433 bp, 810 aa]
          Length = 810

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 40/98 (40%), Gaps = 29/98 (29%)

Query: 14  KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSGATAEMGLNMS--------P 64
           K+ K  KSC FCRR  + CD ++P CS C+ R   NL T     E   N+         P
Sbjct: 46  KRNKLIKSCGFCRRRKLRCDQQKPMCSTCISR---NLTTCQYAEEFNKNIEKKATYGPYP 102

Query: 65  PQDSIR-----------------TGAPGSSMYETPPIP 85
             D ++                 T +  SSMY +P  P
Sbjct: 103 NADLLKKVEELENKIRILEAEKNTNSSASSMYTSPNFP 140

>Scas_662.8
          Length = 906

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRC 41
          K+R+ T++C  CR+  V CDG++PC  C
Sbjct: 29 KRRRVTRACDECRKKKVKCDGQQPCIHC 56

>Kwal_23.3514
          Length = 579

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 18 KTKS-CLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGL-NMSPP 65
          KT++ C+ C +  V CD   PCS C+KRG   LC +    ++   + SPP
Sbjct: 7  KTRTPCVVCTKRKVKCDRNIPCSNCVKRGQQELCIASERTKLDRSSRSPP 56

>YIL130W (YIL130W) [2546] chr9 (102782..105676) Protein that
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region, putative transcription
          factor [2895 bp, 964 aa]
          Length = 964

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRC 41
          K+R+ T++C  CR+  V CDG++PC  C
Sbjct: 13 KRRRVTRACDECRKKKVKCDGQQPCIHC 40

>Kwal_23.4754
          Length = 812

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRC 41
          K+R+ T++C  CR+  V CDG++PC  C
Sbjct: 7  KRRRVTRACDECRKKKVKCDGQQPCIHC 34

>CAGL0G08844g complement(846590..849133) similar to sp|P40467
          Saccharomyces cerevisiae YIL130w, hypothetical start
          Length = 847

 Score = 39.3 bits (90), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRC 41
          K+RK T++C  CR+  V CDG +PC  C
Sbjct: 12 KRRKVTRACDDCRKKKVKCDGNQPCIHC 39

>YBR297W (MAL33) [474] chr2 (800479..801885) Maltose fermentation
          regulatory protein, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1407 bp, 468 aa]
          Length = 468

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 21 SCLFCRRSHVNCDGKRPCSRCLKRGI 46
          +C +CR   V CDGK+PCSRC++   
Sbjct: 7  ACDYCRVRRVKCDGKKPCSRCIEHNF 32

>YNR063W (YNR063W) [4646] chr14 (746940..748763) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1824 bp, 607 aa]
          Length = 607

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 20/30 (66%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLK 43
          +KR  + +C  CR+  + CDG +PC RC++
Sbjct: 8  RKRSISLACTVCRKRKLKCDGNKPCGRCIR 37

>CAGL0L04400g complement(511762..514725) similar to tr|Q12340
          Saccharomyces cerevisiae YOR172w, hypothetical start
          Length = 987

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 5/52 (9%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCT---SGATAEMGLN 61
          K+ K  KSC FCR+  + CD ++P CS C +R +  +C    +  TAEM  N
Sbjct: 29 KRFKPLKSCAFCRKRKLKCDKQKPRCSSCARRNLP-VCVYIENAFTAEMVQN 79

>KLLA0D10153g 858016..859983 weakly similar to sp|P35995
          Saccharomyces cerevisiae YKL222c, hypothetical start
          Length = 655

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRG 45
          + K T+SCL C+R    CD K P CS CLK+G
Sbjct: 5  RNKPTRSCLMCQRRKKKCDRKAPSCSACLKKG 36

>Scas_659.10
          Length = 757

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 41/95 (43%), Gaps = 7/95 (7%)

Query: 14  KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTG 72
           ++RK  KSC FCR   + CD  +P C++CL R     C    T     N+  PQ+ +   
Sbjct: 13  RRRKPIKSCAFCRGRKLKCDKNKPICNQCLMRK-HPTCIYTET----FNIPIPQEQLYGK 67

Query: 73  APGSSMY-ETPPIPNSINTYNKMVSSATGTTPATN 106
            P   +  +   +  +I   NK +S       A +
Sbjct: 68  MPNIELLAKIQELEKTIEEMNKRISDQVSNLKAAD 102

>CAGL0M05907g 622029..624704 similar to sp|P36023 Saccharomyces
          cerevisiae YKR064w, hypothetical start
          Length = 891

 Score = 37.7 bits (86), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 3/63 (4%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTGAP 74
          +R+    C+ CR+    CD + PCS+C++ G ++ CT      +G   + P   +    P
Sbjct: 11 RRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTDTCTYLNDVPIGKKNNVPNTQV---TP 67

Query: 75 GSS 77
           SS
Sbjct: 68 NSS 70

>Kwal_47.17565
          Length = 628

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 22/40 (55%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSG 53
          K+ +  K+C +C    + C+ + PC  C + GI++ C  G
Sbjct: 5  KRHRSIKTCKYCYEHKLKCNKQSPCDNCTRLGITSHCVYG 44

>KLLA0D10593g complement(900326..903103) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 925

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 16 RKKTKSCLFCRRSHVNCDGKR----PCSRCLKRGI 46
          +KK  +C+ CR+    CD       PCSRCLK+G+
Sbjct: 43 QKKKLACVECRQQKSKCDAHERAPEPCSRCLKKGV 77

>Scas_657.3
          Length = 856

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 40/81 (49%), Gaps = 21/81 (25%)

Query: 21  SCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTG--APGSS 77
           SC FCR+  + CD KRP CS C+ R +    T+   A+  L+   P DS  TG  + GSS
Sbjct: 44  SCAFCRQRKLKCDQKRPICSTCIGRKL----TTCVYADDNLS---PNDSRYTGPHSVGSS 96

Query: 78  ----------MYETPPIPNSI 88
                     M + PP PN +
Sbjct: 97  NSSHGTESTTMMQAPP-PNDL 116

>YGR288W (MAL13) [2233] chr7 (1070298..1071719) Maltose pathway
          regulatory protein, contains a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1422 bp, 473 aa]
          Length = 473

 Score = 37.0 bits (84), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 20 KSCLFCRRSHVNCDGKRPCSRCLKRGI 46
          ++C  CR   V CDGKRPCS CL+  +
Sbjct: 11 QACDCCRIRRVKCDGKRPCSSCLQNSL 37

>ACR028C [1076] [Homologous to NOHBY] (408701..410506) [1806 bp,
          601 aa]
          Length = 601

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 14 KKRKK---TKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          KKRK     K CL C++SH  CD  +P C +C+KR +
Sbjct: 10 KKRKSPYSRKGCLQCKKSHTKCDETKPACLKCVKRNV 46

>Scas_702.7
          Length = 1113

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 11/54 (20%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRC-----------LKRGISNLCTSGATAE 57
          ++K +K+C  CRR  + C G  PCS C           LK   SN  T G T +
Sbjct: 30 RKKVSKACANCRRRKIKCTGTYPCSNCAAYQCECIFDDLKEDSSNPSTVGGTTQ 83

>Scas_709.51
          Length = 759

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 20 KSCLFCRRSHVNCDGKRPCSRCLKRGI 46
          ++C  C+R  V CDG +PC  C+K+ I
Sbjct: 32 RACNICKRRKVKCDGNKPCLNCIKKEI 58

>KLLA0F22880g 2123577..2127071 some similarities with
          ca|CA3639|IPF9251 Candida albicans unknown function,
          hypothetical start
          Length = 1164

 Score = 37.0 bits (84), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 16 RKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLC 50
          +K  KSCL CRR  V CD  +P C  C+K G +  C
Sbjct: 3  KKNGKSCLVCRRRKVRCDRAKPVCLVCVKHGSNMEC 38

>Scas_526.3
          Length = 1109

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ +++SCL CRR    CD K P C+ CLK  +
Sbjct: 34 KKGRSRSCLLCRRRKQRCDHKMPSCTACLKAAV 66

>CAGL0G09757g 930351..934622 some similarities with sp|Q05854
          Saccharomyces cerevisiae YLR278c, hypothetical start
          Length = 1423

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ +++SCL CRR    CD K P C+ CLK  +
Sbjct: 34 KKGRSRSCLLCRRRKQRCDHKLPSCTACLKAAV 66

>CAGL0J07150g complement(686734..689802) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 1022

 Score = 36.6 bits (83), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ + +  C  CR++   CD ++P CSRCLK GI
Sbjct: 15 KRNRLSFVCQGCRKAKTKCDKEKPACSRCLKHGI 48

>YLR266C (PDR8) [3660] chr12 complement(675621..677726)
          Zn[2]-Cys[6] zinc finger transcription factor, likely
          involved in pleiotropic drug response [2106 bp, 701 aa]
          Length = 701

 Score = 36.6 bits (83), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+RK  KSC FCR+  + C   RP C +C+ R +
Sbjct: 23 KRRKVIKSCAFCRKRKLKCSQARPMCQQCVIRKL 56

>YKL015W (PUT3) [3241] chr11 (408187..411126) Transcription factor
          that activates the proline utilization pathway genes,
          contains a Zn[2]-Cys[6] fungal-type binuclear cluster
          domain in the N-terminal region [2940 bp, 979 aa]
          Length = 979

 Score = 36.6 bits (83), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 20/29 (68%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCL 42
          ++++ + +CL CR+ H+ C G  PC +C+
Sbjct: 26 RQQRSSVACLSCRKRHIKCPGGNPCQKCV 54

>KLLA0B04840g 439864..442179 weakly similar to ca|CA4996|IPF2029
          Candida albicans unknown function, hypothetical start
          Length = 771

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 16 RKKTKSCLFCRRSHVNCDGKR--PCSRCLKRGI 46
          +K+TK C+ C+ S V C+     PC RCLK GI
Sbjct: 6  KKRTKPCISCKLSKVKCEYTEALPCKRCLKLGI 38

>AGR280C [4591] [Homologous to ScYLR278C - SH] (1266918..1270238)
          [3321 bp, 1106 aa]
          Length = 1106

 Score = 36.6 bits (83), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ +++SCL C+R    CD K P C+ CLK G+
Sbjct: 34 KKGRSRSCLLCQRRKQRCDHKIPSCTACLKAGV 66

>ACL096W [953] [Homologous to ScYKL015W (PUT3) - SH]
          complement(169508..172015) [2508 bp, 835 aa]
          Length = 835

 Score = 36.2 bits (82), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%)

Query: 21 SCLFCRRSHVNCDGKRPCSRCLKRGIS 47
          +CL CRR HV C G  PC++C    I+
Sbjct: 60 ACLRCRRRHVRCPGGTPCAKCAVANIA 86

>CAGL0F09229g complement(908186..910693) weakly similar to
          sp|P39961 Saccharomyces cerevisiae YER184c,
          hypothetical start
          Length = 835

 Score = 36.2 bits (82), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATA 56
          K +  ++C  CR+  V CDG +PCS C+    S +C     A
Sbjct: 14 KDRVIRACDVCRKRKVKCDGDQPCSSCMTA--STVCIYNGVA 53

>AER370W [2871] [Homologous to ScYIL130W (GIN1) - SH]
          complement(1320487..1322892) [2406 bp, 801 aa]
          Length = 801

 Score = 36.2 bits (82), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRC 41
          K+R+ T++C  CR+  V CD + PC  C
Sbjct: 10 KRRRVTRACDECRKKKVKCDSRHPCIHC 37

>Scas_717.33
          Length = 904

 Score = 35.8 bits (81), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 41/102 (40%), Gaps = 21/102 (20%)

Query: 14  KKRKKTKSCLFCRRSHVNCD-------GKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQ 66
           K ++  ++C+ CR   V CD        K PC RC + G + + +SG       N+S   
Sbjct: 26  KWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSSANLSTMN 85

Query: 67  D--------------SIRTGAPGSSMYETPPIPNSINTYNKM 94
                          S+   +  +S Y T  I  + NTY ++
Sbjct: 86  GKNNQATFTGIKRALSVDANSTLNSQYHTTKIKKTENTYKRL 127

>CAGL0L04576g 526960..529557 similar to tr|Q12340 Saccharomyces
          cerevisiae YOR172w, hypothetical start
          Length = 865

 Score = 35.8 bits (81), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 20 KSCLFCRRSHVNCDGKRP-CSRCLKRGIS 47
          ++C FCRR  + CD  RP CS C+ R  S
Sbjct: 38 RTCAFCRRRKLKCDNARPMCSTCVSRKFS 66

>CAGL0L09691g complement(1039799..1042273) some similarities with
          sp|P25502 Saccharomyces cerevisiae YKL015w PUT3
          positive activator of the proline utilisation pathway,
          hypothetical start
          Length = 824

 Score = 35.8 bits (81), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 17 KKTKSCLFCRRSHVNCDGKRPCSRCL 42
          +K  +CL CR+ H+ C G  PC++C+
Sbjct: 23 EKRVACLRCRQKHIKCPGGNPCAKCV 48

>CAGL0D03850g 384689..387193 weakly similar to sp|Q06639
          Saccharomyces cerevisiae YDR303c RSC3 or sp|P38781
          Saccharomyces cerevisiae YHR056c, hypothetical start
          Length = 834

 Score = 35.8 bits (81), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCD-GKRPCSRCLKRG 45
          KK KK  +C  CRR  + CD GK  C  CLK+G
Sbjct: 8  KKVKKPPACQQCRRRKIGCDRGKPICGNCLKQG 40

>CAGL0F07755g complement(755947..757782) similar to sp|P40969
          Saccharomyces cerevisiae YMR168c CEP3 kinetochore
          protein complex, start by similarity
          Length = 611

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 18/40 (45%)

Query: 17 KKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATA 56
          K  + C  C +  V CD   PC  C KRG  + C   A +
Sbjct: 9  KSNRPCSVCSKRKVKCDRLVPCGHCRKRGTESECVQSAIS 48

>KLLA0A06039g 557368..559341 weakly similar to sp|P36023
          Saccharomyces cerevisiae YKR064w singleton, start by
          similarity
          Length = 657

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCD-GKRPCSRCLKRG 45
          K+ + T  CL CRR    CD GK  CS CLK G
Sbjct: 13 KRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKLG 45

>CAGL0H01507g complement(147689..150073) similar to sp|Q06639
           Saccharomyces cerevisiae YDR303c RSC3, start by
           similarity
          Length = 794

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 54/135 (40%), Gaps = 13/135 (9%)

Query: 14  KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSGATAEMGLNM--SP-PQDSI 69
           +K KK  +C  CRR  V CD  RP C  C + G  +        +   N   SP PQ+  
Sbjct: 6   RKMKKPPACAQCRRRKVGCDRVRPVCGNCARAGKGDCFYPDVPGQYIQNNGGSPLPQN-- 63

Query: 70  RTGAPGSSMYETPPIPNSINTYNK--MVSSATGTTPATNPNLYLPQQPSFISENAGSEFN 127
                GS   E     + I  YN    +S+  G      P  Y+P+  +F         +
Sbjct: 64  -----GSGRPEEISTVDQIREYNTRLQLSNMDGNELPQAPKQYIPRTSTFPHNKEVPSGS 118

Query: 128 SLNEFLNMLEDPSLL 142
           S+   +N ++ P++ 
Sbjct: 119 SMRSNVNWVQGPAIF 133

>Sklu_2411.11 YMR019W, Contig c2411 20506-22569 reverse complement
          Length = 687

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 20 KSCLFCRRSHVNCDGKRPCSRCLKRGI 46
          K+C  C++  + CDG +PC+ C K  +
Sbjct: 26 KACEICKKRKIKCDGHQPCTSCTKNSV 52

>KLLA0C19228g 1713787..1715562 similar to sp|P53749 Saccharomyces
          cerevisiae YNR063w singleton, hypothetical start
          Length = 591

 Score = 34.3 bits (77), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 21 SCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSG 53
          +CL C++    CDG++PC RC K  +   C  G
Sbjct: 2  ACLECKKRKQKCDGQKPCRRCTKLNVK--CIYG 32

>AFL200W [2995] [Homologous to ScYMR168C (CEP3) - SH]
          complement(60109..61899) [1791 bp, 596 aa]
          Length = 596

 Score = 34.3 bits (77), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 19 TKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAE---MGLNMSPPQDSI 69
          +K C  C +  V CD   PC+ C+KRG +  C    T +   +G N SP  D +
Sbjct: 9  SKPCAVCIKRKVKCDRLVPCTNCVKRGGAAECERADTIKRPRLG-NPSPGSDWL 61

>Sklu_2434.10 YAL051W, Contig c2434 22765-25716
          Length = 983

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ + +  C  CR+S   CD ++P C+RC+K GI
Sbjct: 20 KRNRISFVCKACRKSKTKCDREKPSCTRCIKNGI 53

>Scas_663.12
          Length = 944

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSGATAEMG 59
          K+ + +  C  CRRS V CD ++P CSRC K  +   C    T +  
Sbjct: 32 KRYRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLE--CVYDVTKQHA 76

>KLLA0E14036g complement(1239566..1241602) some similarities with
          ca|CA4758|CaPPR1 Candida albicans transcription factor
          regulating pyrimidine pathway (by homology),
          hypothetical start
          Length = 678

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 14 KKRKKTK--SCLFCRRSHVNCDGKRP-CSRCLKRGISNLCT 51
          KKR+K +  +C FC+R    CDG  P C  C+  GI   CT
Sbjct: 57 KKRRKNQGVACCFCKRRRKRCDGGFPQCGACVNAGIQ--CT 95

>AGL361C [3951] [Homologous to NOHBY] (24101..26191) [2091 bp, 696
          aa]
          Length = 696

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 3/39 (7%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCT 51
          K +   K C  C++SH+ CD  +P C+ C K+ I  LCT
Sbjct: 53 KVQYSRKGCSQCKKSHIKCDKVQPLCTTCAKKNI--LCT 89

>Scas_275.1
          Length = 335

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 3/38 (7%)

Query: 105 TNPNLYLPQQPSFISENAGSEFN---SLNEFLNMLEDP 139
           T PNL +PQQ S  S N G+ FN    +++F+++L++P
Sbjct: 245 TQPNLRIPQQRSIYSINEGNTFNWDPKISKFIDLLKNP 282

>YOR380W (RDR1) [5153] chr15 (1051286..1052926) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [1641 bp, 546 aa]
          Length = 546

 Score = 33.5 bits (75), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRG 45
          K+++  K+C+ CR     C+GK PC  C+  G
Sbjct: 12 KRQRVRKACVPCRERKRKCNGKSPCEMCVAYG 43

>Kwal_26.6805
          Length = 944

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%)

Query: 22 CLFCRRSHVNCDGKRP-CSRCLKRGI 46
          C  CR+    CD  +P CSRCLK GI
Sbjct: 29 CQSCRKGKTKCDRAKPSCSRCLKHGI 54

>Sklu_2335.6 YBL005W, Contig c2335 10191-13013
          Length = 940

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 17 KKTKSCLFCRRSHVNCDGKRPCSRC 41
          K +++C  CRR  + C GK+PCS C
Sbjct: 23 KVSRACDNCRRRKIKCTGKQPCSNC 47

>Sklu_2064.2 , Contig c2064 873-3641
          Length = 922

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCS-RCLKRGIS 47
          K+ + +  CL CRR  + CD +RPC  +C ++G++
Sbjct: 17 KRNRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLT 51

>Scas_590.2
          Length = 1172

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ ++ +CL CRR    CD + P C+ CLK  +
Sbjct: 34 KKGRSTACLLCRRRKQKCDHQLPSCTACLKAAV 66

>Scas_691.32
          Length = 906

 Score = 33.5 bits (75), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 4/37 (10%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKR----PCSRCLKRGI 46
           KRK+  +C+ CR+    CD       PC++C K+G+
Sbjct: 38 HKRKRKFACVECRQQKSKCDAYEKAPDPCTKCQKKGV 74

>Kwal_14.915
          Length = 822

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 15/27 (55%)

Query: 21 SCLFCRRSHVNCDGKRPCSRCLKRGIS 47
          +C+ CRR H  C G  PC+ C    I+
Sbjct: 48 ACVRCRRRHAKCSGDNPCTTCRAANIA 74

>Kwal_23.6529
          Length = 598

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRG 45
          K ++    C+ C++S + CD K+P C +C K+G
Sbjct: 6  KNQRSRGGCINCKKSKIKCDEKKPMCGQCAKKG 38

>CAGL0I07755g complement(745315..748476) similar to tr|Q12180
           Saccharomyces cerevisiae YOL089c HAL9, hypothetical
           start
          Length = 1053

 Score = 33.5 bits (75), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%)

Query: 14  KKRKKTKSCLFCRRSHVNCDGKRP----CSRCLKRGI 46
           +KR+  K+C +CR+    CD   P    CS C K G+
Sbjct: 170 EKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGV 206

>CAGL0F07909g 776659..779808 some similarities with tr|Q12180
          Saccharomyces cerevisiae YOL089c HAL9 or sp|P38114
          Saccharomyces cerevisiae YBR150c TBS1, hypothetical
          start
          Length = 1049

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP----CSRCLKRGISNLCTSGATAEM 58
          KR+ TK+C  CR+  + CD   P    CS C+K  +   CT     E+
Sbjct: 34 KRRSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVE--CTFKFHEEL 79

>Sklu_1973.1 YDR303C, Contig c1973 815-3148 reverse complement
          Length = 777

 Score = 33.1 bits (74), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRG 45
          +K KK  +C+ CR+  + CD  +P C  CL+ G
Sbjct: 8  RKMKKPPACVQCRKRKIGCDRAKPICGNCLRNG 40

>AAL057C [130] [Homologous to ScYDR303C (RSC3) - SH; ScYHR056C
          (RSC30) - SH] (246899..249328) [2430 bp, 809 aa]
          Length = 809

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISN 48
          +K KK  +C+ CR+  + CD  +P C  C++ G S+
Sbjct: 8  RKMKKPPACVQCRKRKIGCDRAKPLCGNCVRNGKSD 43

>YPR196W (YPR196W) [5609] chr16 (931370..932782) Positive
          regulator of the maltose pathway MAL genes, contains a
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [1413 bp, 470 aa]
          Length = 470

 Score = 33.1 bits (74), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%)

Query: 20 KSCLFCRRSHVNCDGKRPCSRCLKRGI 46
          +SC  CR   V CD  RPC RC +R +
Sbjct: 6  QSCDCCRVRRVKCDRNRPCDRCRQRNL 32

>Scas_234.1
          Length = 337

 Score = 32.7 bits (73), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCT----SGATAEMGLNMSPPQ 66
          K+ + T  C  C++    CD  RPCS C + G  + C     +G+ + + +N   P+
Sbjct: 25 KRNRPTVVCTNCKKRKSKCDRGRPCSTCARLGDGDRCIYVSDTGSESPVPMNQFMPK 81

>KLLA0F02299g 205549..208167 no similarity, hypothetical start
          Length = 872

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 21 SCLFCRRSHVNC--DGKRPCSRCLKRGISNLCT 51
          +C  CR+  + C  DGK PC+ CL +G  + C 
Sbjct: 6  ACSRCRQQKIRCIHDGKPPCTYCLHKGCGDECV 38

>Scas_702.7d
          Length = 978

 Score = 33.1 bits (74), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 33/74 (44%), Gaps = 10/74 (13%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLC----TSGATAEMGLNMSPPQDSI 69
          KK + +++C  CRR  + C G +PC  C   G   LC     +G T  M  +  P +   
Sbjct: 10 KKLRSSRACSNCRRRKIKCSGIQPCPNCEIYGC--LCVFEPVNGMTP-MNFSSKPSETEF 66

Query: 70 RTGAPGSSMYETPP 83
               G+SM+   P
Sbjct: 67 H---HGNSMHSVKP 77

>CAGL0A00583g 65286..67226 weakly similar to sp|Q06149
          Saccharomyces cerevisiae YLR266c, hypothetical start
          Length = 646

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 20/37 (54%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCT 51
          +R+  KSC +C    + C+ + PC  C ++G  + C 
Sbjct: 11 RRRVIKSCQYCYAHKLKCNRESPCLTCQQQGTQDQCV 47

>YBL005W (PDR3) [189] chr2 (217435..220365) Zinc-finger
          transcription factor, in conjunction with Pdr1p
          regulates the expression of a network of genes involved
          in multiple drug resistance [2931 bp, 976 aa]
          Length = 976

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 18/28 (64%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRCL 42
          + K + +C+ CR+  + C GK PC+ C+
Sbjct: 8  RSKVSTACVNCRKRKIKCTGKYPCTNCI 35

>YBL066C (SEF1) [131] chr2 complement(96906..100079) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [3174 bp, 1057 aa]
          Length = 1057

 Score = 32.7 bits (73), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 4/35 (11%)

Query: 16 RKKTKSCLFCRRSHVNCDGKR----PCSRCLKRGI 46
           +   SC  CR+  + CD  +    PCSRC K G+
Sbjct: 51 HRPVTSCTHCRQHKIKCDASQNFPHPCSRCEKIGL 85

>CAGL0A04455g 432854..436150 similar to sp|P34228 Saccharomyces
           cerevisiae YBL066c SEF1, hypothetical start
          Length = 1098

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 4/35 (11%)

Query: 16  RKKTKSCLFCRRSHVNCDGKR----PCSRCLKRGI 46
            +   SC  CR+  + CD  +    PC+RC K G 
Sbjct: 81  HRPVTSCTHCRQHKIKCDASQNFPAPCTRCAKNGF 115

>AFR108W [3300] [Homologous to ScYGL045W - SH; ScYGL046W - SH]
           complement(631113..632759) [1647 bp, 548 aa]
          Length = 548

 Score = 32.3 bits (72), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 353 YGSIAFDKGQKTVLTSCNLQTRDGSRKKNCC 383
           Y SIAF+KG  +    C L+TR G+++ + C
Sbjct: 137 YTSIAFEKGSISYAVGCVLETRSGAQRLSSC 167

>Scas_638.14
          Length = 1043

 Score = 32.7 bits (73), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 17/25 (68%)

Query: 17 KKTKSCLFCRRSHVNCDGKRPCSRC 41
          K +K+C  CR+  + C GK+PC+ C
Sbjct: 43 KVSKACDNCRKRKIKCTGKQPCATC 67

>Scas_674.12*
          Length = 909

 Score = 32.7 bits (73), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 3/39 (7%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCT 51
          +K + +  CL CR   V CD  RP C RC  R  + LC 
Sbjct: 7  RKARPSFVCLVCRSKKVKCDKARPSCGRC--RKTNKLCV 43

>YGL013C (PDR1) [1960] chr7 complement(469095..472301) Zinc-finger
          transcription factor, in conjunction with Pdr3p
          regulates the expression of a network of genes involved
          in multiple drug resistance [3207 bp, 1068 aa]
          Length = 1068

 Score = 32.7 bits (73), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRC 41
          + K +K+C  CR+  + C+GK PC+ C
Sbjct: 39 RSKVSKACDNCRKRKIKCNGKFPCASC 65

>KLLA0D12650g complement(1073580..1075535) weakly similar to
           ca|CA2184|IPF6874.3 Candida albicans unknown function,
           3-prime end, hypothetical start
          Length = 651

 Score = 32.3 bits (72), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 36/83 (43%), Gaps = 7/83 (8%)

Query: 15  KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSGATAE----MGLNMSPPQDSI 69
           +++ ++ CL CR  H  CD K+P CS C +  +  +      A+    M LN     D  
Sbjct: 25  EKRSSRGCLTCRDRHKKCDEKKPLCSGCKENFLRCVWRDNEEAQEEPHMFLNFH--LDDW 82

Query: 70  RTGAPGSSMYETPPIPNSINTYN 92
           +    G SM  T  +    N Y+
Sbjct: 83  KVRERGKSMKLTLAVTQKRNFYS 105

>ADR405C [2145] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1435705..1438128) [2424 bp, 807 aa]
          Length = 807

 Score = 32.3 bits (72), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRG 45
          ++ K +  C  CRRS   CD  +P C+RC+K G
Sbjct: 31 RRNKLSFVCQSCRRSKTKCDKVKPSCTRCVKNG 63

>ADR404C [2144] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1432323..1434950) [2628 bp, 875 aa]
          Length = 875

 Score = 32.3 bits (72), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
           KRK +  C+ CR+    CD  +P CSRC + G+
Sbjct: 16 HKRKLSYVCIPCRKCKTKCDKLKPTCSRCAELGL 49

>YKL222C (YKL222C) [3053] chr11 complement(3504..5621) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2118 bp, 705 aa]
          Length = 705

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRG 45
          +RK  KSC FCR   + CD  RP C  C  R 
Sbjct: 17 RRKPAKSCHFCRVRKLKCDRVRPFCGSCSSRN 48

>Kwal_55.21884
          Length = 882

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 21/38 (55%), Gaps = 4/38 (10%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGK----RPCSRCLKRGIS 47
          + R+K  +C+ CR+    CD       PC+RC K+ ++
Sbjct: 23 RGRRKKLACVECRQQKSKCDAHEKAPEPCTRCAKKNVA 60

>Sklu_2376.6 , Contig c2376 12573-15341 reverse complement
          Length = 922

 Score = 32.3 bits (72), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLC 50
          K+++ T  C  C++  + CD KRP CS C    ++  C
Sbjct: 20 KRQRTTVVCTNCKKRKIKCDRKRPACSNCSVANVAEYC 57

>Kwal_47.18089
          Length = 745

 Score = 32.0 bits (71), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%)

Query: 21 SCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          SC FCR   + CD KRP C  C  R +
Sbjct: 28 SCTFCRHRKLKCDHKRPMCGSCAARKL 54

>CAGL0A00451g 47557..50880 similar to sp|P12383 Saccharomyces
          cerevisiae YGL013c PDR1 transcription factor,
          hypothetical start
          Length = 1107

 Score = 32.0 bits (71), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRG 45
          ++ K  K+C  CRR  + C+G +PC  C   G
Sbjct: 23 RRTKVGKACDSCRRRKIKCNGLKPCPSCTIYG 54

>KLLA0D11286g complement(964642..966678) no similarity,
          hypothetical start
          Length = 678

 Score = 32.0 bits (71), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 2/33 (6%)

Query: 16 RKKT-KSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          RK+T KSC+ C      CD K+P C+RC K+ +
Sbjct: 19 RKRTPKSCIRCYSIKRKCDHKKPSCTRCFKKSL 51

>KLLA0C03201g complement(286973..288925) similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, start by similarity
          Length = 650

 Score = 32.0 bits (71), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 8/50 (16%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSP 64
          + K   +C  C+   V CDG+ PC+ C+   +          E  +NM P
Sbjct: 29 RHKVKHACSSCKERKVRCDGQSPCASCINARVK--------CEYVMNMKP 70

>KLLA0D09977g complement(841852..843756) weakly similar to
          sp|P40969 Saccharomyces cerevisiae YMR168c CEP3
          kinetochore protein complex, 71 KD subunit singleton,
          start by similarity
          Length = 634

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%)

Query: 17 KKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLC 50
          K    C FC+   V CD   P C  C++R ++ LC
Sbjct: 10 KGKHPCTFCQARKVKCDRSLPACQNCIERNVTELC 44

>YMR168C (CEP3) [4123] chr13 complement(597331..599157) Component
          (subunit b) of the Cbf3 kinetochore protein complex
          [1827 bp, 608 aa]
          Length = 608

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 15/34 (44%)

Query: 17 KKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLC 50
          K    C  C R  V CD   PC  C KRG  + C
Sbjct: 9  KSKHPCSVCTRRKVKCDRMIPCGNCRKRGQDSEC 42

>YMR019W (STB4) [3983] chr13 (312155..315004) Sin3p-binding protein,
           contains a Zn[2]-Cys[6] fungal-type binuclear cluster
           domain in the N-terminal region [2850 bp, 949 aa]
          Length = 949

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 14/25 (56%)

Query: 20  KSCLFCRRSHVNCDGKRPCSRCLKR 44
           K+C  C++  V CDG  PC  C K 
Sbjct: 85  KACELCKKRKVKCDGNNPCLNCSKH 109

>YER184C (YER184C) [1612] chr5 complement(556291..558675) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2385 bp, 794 aa]
          Length = 794

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCT 51
          +K + TK+C  C R  + C+ K+PC  C+  G  + CT
Sbjct: 10 QKSRVTKACDRCHRKKIKCNSKKPCFGCI--GSQSKCT 45

>Kwal_47.17506
          Length = 924

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 17/28 (60%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRC 41
          K+ K +++C  CRR  + C G +PC  C
Sbjct: 11 KRSKVSRACNNCRRRKIKCTGAQPCLNC 38

>Sklu_2397.8 YML099C, Contig c2397 9784-12330
          Length = 848

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 31/75 (41%), Gaps = 13/75 (17%)

Query: 15 KRKKT-KSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSGATAEMGLNMSPPQDSIRTG 72
          +R KT   C  CR   V CD  RP C RC + G    C      ++ L  S P    R G
Sbjct: 12 RRAKTFTGCWTCRSRKVKCDLGRPSCKRCERSGFE--C---GGYDIKLRWSKPIKFDRYG 66

Query: 73 APGSSMYETPPIPNS 87
                 + PP PNS
Sbjct: 67 V------QLPPSPNS 75

>AER183C [2685] [Homologous to ScYOL089C (HAL9) - NSH]
           (975879..978518) [2640 bp, 879 aa]
          Length = 879

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 18/29 (62%)

Query: 15  KRKKTKSCLFCRRSHVNCDGKRPCSRCLK 43
           +++ +K+C  CR   + C+G+ PC  C K
Sbjct: 74  RKRVSKACDICRAKKIRCNGEEPCVNCEK 102

>KLLA0F02750g complement(250368..253814) some similarities with
          sgd|S0005449 Saccharomyces cerevisiae YOL089c HAL9
          transcriptional activator of ENA1, hypothetical start
          Length = 1148

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 6/48 (12%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRP----CSRCLKRGISNLCTSGATAEM 58
          K++ +K+C  CRR  + CD   P    CS C+K  +   CT     EM
Sbjct: 27 KKRVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVP--CTFHYHEEM 72

>KLLA0A09119g complement(797533..800781) weakly similar to
          sp|P12383 Saccharomyces cerevisiae YGL013c PDR1
          transcription factor, start by similarity
          Length = 1082

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRCLKRG 45
          +RK +++C  CR+  + C G  PC  C   G
Sbjct: 48 RRKVSRACDSCRKKKIKCSGTLPCKSCETYG 78

>KLLA0A03421g 308414..311056 weakly similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor, start by similarity
          Length = 880

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 1/29 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRC 41
          K+ K +  C  CR+S   CD K+P C+RC
Sbjct: 13 KRYKLSFVCQLCRKSKTKCDRKKPSCARC 41

>Scas_688.17
          Length = 769

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 39/111 (35%), Gaps = 17/111 (15%)

Query: 14  KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLK------------RGISNLCTSGATAEMGL 60
           +K KK  +C+ CR+  + CD   P C  C+K               S L      A    
Sbjct: 9   RKPKKNPACIQCRKRKIGCDRGHPKCGNCIKLKRAQCIYPDEFHTASELLREMEKASPLQ 68

Query: 61  NMSPPQDSIRTGAP----GSSMYETPPIPNSINTYNKMVSSATGTTPATNP 107
            +SP   +I    P    G+ +Y   P     NT    +    GTT    P
Sbjct: 69  TLSPASRNINPNKPTLVNGNHVYIQTPGNTPSNTDQNKLQMLLGTTSMDGP 119

>YLL054C (YLL054C) [3369] chr12 complement(32894..35203) Protein
          with similarity to transcription factors, has
          Zn[2]-Cys[6] fungal-type binuclear cluster domain in
          the N-terminal region [2310 bp, 769 aa]
          Length = 769

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 11/70 (15%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSGATAEMG-LNMSP-----PQ 66
          KK K +  CL C++  + CD   P CS+C  +  S++C+     E G +N SP     P 
Sbjct: 7  KKVKPSFVCLRCKQRKIKCDKLWPTCSKC--KASSSICS--YEVEPGRINKSPTIENAPH 62

Query: 67 DSIRTGAPGS 76
            IR   P S
Sbjct: 63 RDIRNITPAS 72

>CAGL0H00396g complement(37005..39827) similar to sp|P08638
          Saccharomyces cerevisiae YLR451w LEU3 transcription
          factor, hypothetical start
          Length = 940

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 4/30 (13%)

Query: 21 SCLFCRRSHVNCDGK----RPCSRCLKRGI 46
          +C+ CR+    CD       PC+RC K+G+
Sbjct: 57 ACVECRQQKSKCDAHDKAPEPCTRCQKKGV 86

>KLLA0D00396g complement(36277..37362) some similarities with
          ca|CA2346|CaSEF1 Candida albicans Putative
          transcription factor1, hypothetical start
          Length = 361

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 17 KKTKSCLFCRRSHVNCDGKR----PCSRCLKRGISNLCT 51
          K  +SC  CR++ V CD       PC+ C KRG+  +CT
Sbjct: 3  KPLRSCTRCRKNKVKCDSANTRPGPCTACSKRGL--VCT 39

>ABL121C [471] [Homologous to ScYMR280C (CAT8) - SH]
           (170784..174641) [3858 bp, 1285 aa]
          Length = 1285

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%), Gaps = 1/29 (3%)

Query: 19  TKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
            ++C  CR     CDGKRP CS+C   G 
Sbjct: 75  AQACDRCRSKKTRCDGKRPQCSQCAAVGF 103

>KLLA0D01452g 124018..128355 gi|3228691|gb|AAC23607.1 Kluyveromyces
           lactis Cat8p, start by similarity
          Length = 1445

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 20  KSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
           ++C  CR   + CDGKRP C++C   G 
Sbjct: 181 QACDRCRAKKIRCDGKRPQCTQCAAVGF 208

>YDR303C (RSC3) [1131] chr4 complement(1068721..1071378) Component
          of the abundant RSC chromatin remodeling complex [2658
          bp, 885 aa]
          Length = 885

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRG 45
          +K KK  +C+ CR+  + CD  +P C  C+K  
Sbjct: 6  RKMKKPPACVQCRKRKIGCDRVKPICGNCMKHN 38

>KLLA0C14212g complement(1229219..1232341) some similarities with
          sp|P25611 Saccharomyces cerevisiae YCR106w,
          hypothetical start
          Length = 1040

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 16/29 (55%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCL 42
          K+ + +  C  CRR    CD   PCS+C+
Sbjct: 67 KRNRVSYVCYACRRRKTRCDRGNPCSKCV 95

>ADR403C [2143] [Homologous to ScYAL051W (OAF1) - SH; ScYOR363C
          (PIP2) - SH] (1429118..1432030) [2913 bp, 970 aa]
          Length = 970

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ + +  C  CR+S   CD ++P CSRC K  +
Sbjct: 24 KRNRISFVCQACRKSKTKCDREKPRCSRCAKNNV 57

>YMR280C (CAT8) [4234] chr13 complement(827027..831328)
          Transcription factor required for derepression of
          gluconeogenic enzymes, contains an N-terminal
          Zn[2]-Cys[6] fungal-type binuclear cluster domain [4302
          bp, 1433 aa]
          Length = 1433

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%)

Query: 20 KSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          ++C  CR     CDGKRP CS+C   G 
Sbjct: 68 QACDRCRSKKTRCDGKRPQCSQCAAVGF 95

>Scas_449.1
          Length = 636

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 16 RKKTKSCLFCRRSHVNCDGKRPCSRCLKRGIS 47
          ++K  +C  CRR    CD   PC+ C++ G++
Sbjct: 31 KRKRLACSNCRRRRKKCDLNFPCANCIRLGLN 62

>Scas_626.6
          Length = 839

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 15 KRKKT-KSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          +R KT   C  CR   V CD +RP C RC K G+
Sbjct: 13 RRAKTFTGCWTCRSRKVKCDLRRPGCVRCDKSGL 46

>Scas_556.6
          Length = 1022

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGIS 47
          K+ + +  C  CR++   CD ++P C+RC+K+ ++
Sbjct: 38 KRNRISFVCQECRKAKTKCDKEKPACTRCVKQNLA 72

>Kwal_27.10232
          Length = 1209

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 1/28 (3%)

Query: 20 KSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          ++C  CR     CDGKRP CS+C   G 
Sbjct: 72 QACDRCRSKKTRCDGKRPQCSQCAAVGF 99

>ADR365W [2106] [Homologous to ScYOR337W (TEA1) - SH]
          complement(1355410..1357515) [2106 bp, 701 aa]
          Length = 701

 Score = 30.8 bits (68), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 17 KKTKSCLFCRRSHVNCDGKRPCSRCLK 43
          KK  +C  CRR    CD   PCS CL+
Sbjct: 42 KKRLACTNCRRRRKKCDLNYPCSSCLR 68

>KLLA0D10197g complement(861726..864296) similar to sp|P05085
          Saccharomyces cerevisiae YML099c ARG81 transcription
          factor involved in arginine metabolism singleton, start
          by similarity
          Length = 856

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 2/35 (5%)

Query: 14 KKRKKT-KSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K R KT   C  CR   V CD +RP C RC K G+
Sbjct: 5  KPRVKTFTGCWTCRSRKVKCDLRRPGCERCEKGGL 39

>AFR096W [3288] [Homologous to ScYJL089W (SIP4) - SH]
          complement(606993..609551) [2559 bp, 852 aa]
          Length = 852

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 16 RKKTKSCLFCRRSHVNCDGKRP-CSRCLKRG 45
          ++ +++C  CR   + CDG RP C+ C K G
Sbjct: 23 KRSSQACDRCRLKKIKCDGLRPSCTSCKKIG 53

>Scas_637.7
          Length = 998

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 4/33 (12%)

Query: 15  KRKKTKSCLFCRRSHVNCDGKRP----CSRCLK 43
           K++ +K+C  CR+  + CD   P    CS CLK
Sbjct: 99  KKRVSKACDHCRKRKIKCDKVDPSTGKCSNCLK 131

>Scas_715.3
          Length = 1115

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 4/35 (11%)

Query: 16  RKKTKSCLFCRRSHVNCDGKR----PCSRCLKRGI 46
            +   SC  CR+  + CD  +    PCSRC K  +
Sbjct: 100 HRPVTSCSHCRQQKIKCDASQNFPAPCSRCQKMAL 134

>Kwal_47.16939
          Length = 669

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 2/33 (6%)

Query: 16 RKKTKSCLFCRRSHVNCD--GKRPCSRCLKRGI 46
          RK+TK C  C+++ V C+     PC RC +  +
Sbjct: 7  RKRTKPCSNCKKNKVKCEYLSSLPCQRCARHSL 39

>Sklu_2382.2 YDL195W, Contig c2382 2146-5931 reverse complement
          Length = 1261

 Score = 30.8 bits (68), Expect = 2.8,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 64   PPQDSIRTGAP-GSSMYETPPIPNSINTYNKMVSSATGTTPATN------PNLYLP 112
            PP+ + R+ +  GS+ Y  PPI N+   +  + SS     PATN      PN Y P
Sbjct: 997  PPKSTSRSASSNGSNPYAPPPISNA---HTPVASSPYAPPPATNFAQPAAPNPYAP 1049

>KLLA0F02387g complement(213669..215852) similar to sp|P47988
          Saccharomyces cerevisiae YOR337w TEA1 TY1 enhancer
          activator, start by similarity
          Length = 727

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 18 KTKSCLFCRRSHVNCDGKRPCSRCLKRGI 46
          K  +C  CRR    CD + PC RC + G+
Sbjct: 37 KRLACANCRRRRKKCDLEYPCGRCQELGL 65

>Sklu_2267.6 YNL201C, Contig c2267 7034-9526 reverse complement
          Length = 830

 Score = 30.4 bits (67), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 6/73 (8%)

Query: 309 TGEIYRANKEFATLVDCTVDEL-RDG-KLAIYELMSEESA---VNFWEKY-GSIAFDKGQ 362
           TGE+ R NK+  T   CT  E   DG KLA Y L+++ESA   +    K  G+I + + +
Sbjct: 37  TGEVERNNKDADTGTGCTEQETSSDGTKLAAYLLVNDESAPEKILLKSKLEGNIEYQRQE 96

Query: 363 KTVLTSCNLQTRD 375
           +T++   +L  +D
Sbjct: 97  ETLIVWKDLAGQD 109

>Scas_696.44
          Length = 1164

 Score = 30.4 bits (67), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%)

Query: 20  KSCLFCRRSHVNCDGKRP-CSRCLKRG 45
           ++C  CR     CDGKRP CS+C   G
Sbjct: 79  QACDRCRSKKTRCDGKRPQCSQCAIVG 105

>Scas_721.94
          Length = 869

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%)

Query: 17 KKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K  + C  C+R  V CD  +P C RCL   +
Sbjct: 50 KSKQGCTHCKRRRVKCDELKPACRRCLNWNV 80

>KLLA0F14322g 1328925..1331078 gi|32440908|emb|CAE00852.1
          Kluyveromyces lactis Sip4 protein, start by similarity
          Length = 717

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRG 45
          K ++ +++C  CR   + CDG +P CS C K G
Sbjct: 55 KVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIG 87

>Scas_711.31
          Length = 932

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 17 KKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ ++C  CR   + CD + P C+ C+K GI
Sbjct: 40 KRKQACDRCRLKKIKCDDRTPDCTPCMKAGI 70

>CAGL0M12298g complement(1225753..1228737) similar to sp|P39720
          Saccharomyces cerevisiae YAL051w OAF1 peroxisome
          proliferating transcription factor or sp|P52960
          Saccharomyces cerevisiae YOR363c PIP2, hypothetical
          start
          Length = 994

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLK 43
          K+ + +  C  CRRS   CD ++P C+RC K
Sbjct: 19 KRNRISFVCQACRRSKTRCDKEKPICTRCKK 49

>YKR064W (YKR064W) [3315] chr11 (562189..564780) Protein with
          similarity to transcription factors, has Zn[2]-Cys[6]
          fungal-type binuclear cluster domain in the N-terminal
          region [2592 bp, 863 aa]
          Length = 863

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 19/38 (50%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCT 51
          K+ + T  C  C++    CD  +PC  C++ G  + C 
Sbjct: 11 KRHRITVVCTNCKKRKSKCDRTKPCGTCVRLGDVDSCV 48

>KLLA0D05038g 433653..435674 weakly similar to sp|P40971
          Saccharomyces cerevisiae YDR034c LYS14 transcriptional
          activator of lysine pathway genes singleton, start by
          similarity
          Length = 673

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 2/30 (6%)

Query: 14 KKRKKTKS-CLFCRRSHVNCDGKRP-CSRC 41
          KKRK +K+ CL C+R  V CD  +P C +C
Sbjct: 19 KKRKYSKNGCLECKRKKVKCDETKPMCWQC 48

>YLR451W (LEU3) [3825] chr12 (1036089..1038749) Transcription
          factor regulating genes of branched chain amino acid
          biosynthesis pathways, acts as both a repressor and an
          inducer [2661 bp, 886 aa]
          Length = 886

 Score = 30.4 bits (67), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 19/35 (54%), Gaps = 4/35 (11%)

Query: 16 RKKTKSCLFCRRSHVNCDGK----RPCSRCLKRGI 46
          RK+  +C+ CR+    CD       PC++C K+ +
Sbjct: 31 RKRKFACVECRQQKSKCDAHERAPEPCTKCAKKNV 65

>Kwal_14.2619
          Length = 1167

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (62%), Gaps = 1/24 (4%)

Query: 21 SCLFCRRSHVNCDGKRP-CSRCLK 43
          SCL CRR  V CD  +P C  C+K
Sbjct: 11 SCLTCRRRKVKCDRSKPVCLACIK 34

>KLLA0A04169g complement(376273..378600) similar to sgd|S0004218
           Saccharomyces cerevisiae YLR228c ECM22, start by
           similarity
          Length = 775

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 21/95 (22%)

Query: 14  KKRKKTKS-CLFCRRSHVNCDGKRP-CSRCLKRGISNLCT---------SGATAEMGLNM 62
           K  KK+K+ C  C+R  V CD  RP C  C K  +  + T         S ATA      
Sbjct: 48  KFHKKSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDCVYTPVQPRSRKNSAATA------ 101

Query: 63  SPPQDSIRTGAPGSSMYETPPIPNSINTYNKMVSS 97
             P+ S +   P +    TP  P S+N  + +V++
Sbjct: 102 --PKHSSKVSKPAT--VSTPTEPISLNQVDILVNT 132

>Scas_630.14
          Length = 701

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ +  KSC  CR     CD  +P CS C+  GI
Sbjct: 18 KRNRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGI 51

>KLLA0C01023g 76863..78773 similar to sgd|S0002928 Saccharomyces
          cerevisiae YDR520c, hypothetical start
          Length = 636

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNMSPPQ 66
          +K++KT SC  CR+    CD +    +C +  + NL  S  T +  LN+  PQ
Sbjct: 13 RKKRKTYSCELCRKFKTRCDFEPSEGKCYRCRMLNLDCS-LTNDPELNIKFPQ 64

>KLLA0C17050g 1490472..1493339 some similarities with
          ca|CA3454|IPF10533.exon1 Candida albicans unknown
          function, exon 1, hypothetical start
          Length = 955

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRG 45
          K++++  SC+ C +  + CD  +P C  C K G
Sbjct: 38 KRQRQILSCVACHKRKIKCDRAKPVCESCGKNG 70

>Scas_610.9
          Length = 809

 Score = 29.6 bits (65), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 10/34 (29%), Positives = 19/34 (55%), Gaps = 4/34 (11%)

Query: 17 KKTKSCLFCRRSHVNCDGK----RPCSRCLKRGI 46
          ++  +C+ CR+    CD       PCS+C ++G+
Sbjct: 14 RRKYACVECRQQKSKCDANDKAPNPCSKCARKGV 47

>Kwal_47.17233
          Length = 948

 Score = 29.6 bits (65), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKR 44
          ++++K  SC+ C +  + C  + P CS+CLK+
Sbjct: 27 RRQRKILSCVPCHKRKIKCTRETPSCSKCLKK 58

>KLLA0C18953g 1682246..1684357 weakly similar to
          sp|P36598|Q9UTJ9|P40378 Schizosaccharomyces pombe
          Thiamine repressible genes regulatory protein THI1
          (Transcription factor NTF1), start by similarity
          Length = 703

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 17 KKTKSCLFCRRSHVNCDGKRPCSRCLKRG 45
          K  ++C  C+R    C G  PC  C+K G
Sbjct: 13 KSKRACETCKRRKKRCSGGLPCEYCVKIG 41

>YJL206C (YJL206C) [2722] chr10 complement(47659..49935) Protein
          with weak similarity to Put3p and other transcription
          factors, has a Zn[2]-Cys[6] fungal-type binuclear
          cluster domain in the N-terminal region [2277 bp, 758
          aa]
          Length = 758

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 15/27 (55%)

Query: 15 KRKKTKSCLFCRRSHVNCDGKRPCSRC 41
          K +  ++C+ CR+  V C G  PC  C
Sbjct: 40 KGRAHRACIACRKRKVRCSGNIPCRLC 66

>Sklu_2268.2 YKR064W, Contig c2268 4260-6887 reverse complement
          Length = 875

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCT 51
          ++ + T  C  C+R    CD ++P CS C++ G    CT
Sbjct: 5  RRNRPTVVCSNCKRRKSKCDKQKPACSNCVRLGDEATCT 43

>CAGL0E05434g 532577..535027 similar to sp|P47988 Saccharomyces
           cerevisiae YOR337w TEA1 TY1 enhancer activator,
           hypothetical start
          Length = 816

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 16/30 (53%)

Query: 17  KKTKSCLFCRRSHVNCDGKRPCSRCLKRGI 46
           KK  +C  CRR    CD + PC  C K G+
Sbjct: 71  KKRLACSNCRRRRKKCDLQYPCFTCDKLGL 100

>Sklu_2296.6 YJL089W, Contig c2296 12179-14938 reverse complement
          Length = 919

 Score = 29.3 bits (64), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          ++ + +++C  CR   + CDG +P C+ C K G 
Sbjct: 21 RQERSSQACDRCRLKKIKCDGLKPNCTSCKKVGF 54

>AGL091W [4220] [Homologous to ScYLR228C (ECM22) - SH; ScYDR213W
           (UPC2) - SH] complement(535317..537917) [2601 bp, 866
           aa]
          Length = 866

 Score = 29.3 bits (64), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 17  KKTKSCLFCRRSHVNCD-GKRPCSRCLKRGIS 47
           K    C  C+R  V CD GK  C +CLK  +S
Sbjct: 84  KSKNGCDNCKRRRVKCDEGKPGCQKCLKMRLS 115

>ACR241C [1288] [Homologous to ScYKR064W - SH] (784358..786745)
          [2388 bp, 795 aa]
          Length = 795

 Score = 29.3 bits (64), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCD-GKRPCSRCLKRGISNLC 50
          K++++T  C  C+R    CD GK  C  C++ G    C
Sbjct: 6  KRQRQTLVCSNCKRRKSRCDRGKPACGNCIRLGNRETC 43

>YOR363C (PIP2) [5140] chr15 complement(1020218..1023208)
          Transcription factor required for induction of
          peroxisomal proteins in response to oleic acid [2991
          bp, 996 aa]
          Length = 996

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGI 46
          K+ + +  C  CR++   CD ++P C RC K+ +
Sbjct: 17 KRNRLSFVCQACRKAKTKCDQEKPRCGRCTKQNL 50

>KLLA0F18084g complement(1652031..1654613) no similarity,
          hypothetical start
          Length = 860

 Score = 28.9 bits (63), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%)

Query: 21 SCLFCRRSHVNCD-GKRPCSRCLKRGI 46
          SC  CR++   CD GK  C+RC+K  I
Sbjct: 4  SCQNCRKTRRKCDRGKPTCARCIKYKI 30

>Kwal_23.6537
          Length = 552

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 16/32 (50%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRG 45
          K+ +  K+CL CR+    CD   PC  C   G
Sbjct: 12 KRLRVRKACLPCRQRKRKCDSGFPCGMCTSYG 43

>YJL089W (SIP4) [2826] chr10 (265842..268331) Transcriptional
          activator of gluconeogenic genes through CSRE elements,
          activated by Snf1p kinase, contains a Zn[2]-Cys[6]
          fungal-type binuclear cluster domain [2490 bp, 829 aa]
          Length = 829

 Score = 28.9 bits (63), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%)

Query: 17 KKTKSCLFCRRSHVNCDGKRP-CSRCLK 43
          +K  +C  CR   + CDG +P CS C K
Sbjct: 41 RKAHACDRCRLKKIKCDGLKPNCSNCAK 68

>YLR098C (CHA4) [3513] chr12 complement(337528..339474)
          Zinc-finger protein required for transcriptional
          activation of CHA1, has a Zn[2]-Cys[6] fungal-type
          binuclear cluster domain [1947 bp, 648 aa]
          Length = 648

 Score = 28.9 bits (63), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 16 RKKTKSCLFCRRSHVNCDGKRPCSRCLK 43
          RK+  +C  CRR    C+ ++PCS C+K
Sbjct: 38 RKRKLACQNCRRRRRKCNMEKPCSNCIK 65

>YOL089C (HAL9) [4731] chr15 complement(150397..153489) Protein
           involved in salt tolerance, has similarity to
           transcription factors, contains a Zn[2]-Cys[6]
           fungal-type binuclear cluster domain in the N-terminal
           region [3093 bp, 1030 aa]
          Length = 1030

 Score = 28.9 bits (63), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 39/85 (45%), Gaps = 14/85 (16%)

Query: 15  KRKKTKSCLFCRRSHVNCD----GKRPCSRCLKRGISNLCTSGATAEM--------GLNM 62
           K++ +K+C  CR+  + CD      + CS C+K  +   CT     E+          + 
Sbjct: 129 KKRVSKACDHCRKRKIRCDEVDQQTKKCSNCIKFQLP--CTFKHRDEILKKKRKLEIKHH 186

Query: 63  SPPQDSIRTGAPGSSMYETPPIPNS 87
           + P +S++T    S+   +  +PNS
Sbjct: 187 ATPGESLQTSNSISNPVASSSVPNS 211

>Scas_719.13
          Length = 995

 Score = 28.9 bits (63), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 98  ATGTTPATNPNLYLPQQPSFISENAGSEFNSLNEFLNMLEDPSLLENT 145
           A  T+P  NPN +LP+   FI+ N   +   L E +  LE+P LL+ T
Sbjct: 494 AKITSPGLNPNFHLPRPNEFIANNF--QVTKL-ENVTPLEEPHLLKET 538

>Kwal_33.13934
          Length = 797

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 1/41 (2%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRP-CSRCLKRGISNLCTSG 53
          K+R+ T  C  C+R    CD  +P C  C + G    C  G
Sbjct: 15 KRRRPTVVCTNCKRRKSKCDRLKPICGNCSRLGDQATCVYG 55

>CAGL0F07865g complement(768270..770804) similar to tr|Q12151
          Saccharomyces cerevisiae YDR213w UPC2, start by
          similarity
          Length = 844

 Score = 28.9 bits (63), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%)

Query: 17 KKTKSCLFCRRSHVNCDGKRP-CSRCLK 43
          K    C  C+R  V CD  +P C +C+K
Sbjct: 49 KSKNGCDHCKRRRVKCDEGKPMCDKCVK 76

>CAGL0F02519g 245120..247618 weakly similar to sp|P39529
          Saccharomyces cerevisiae YJL206c, hypothetical start
          Length = 832

 Score = 28.9 bits (63), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 14/62 (22%), Positives = 29/62 (46%), Gaps = 3/62 (4%)

Query: 14 KKRKKTKSCLFCRRSHVNCDGKRPCSRCLKRGISNLCTSGATAEMGLNM---SPPQDSIR 70
          + ++ +++C  C++    C G  PC  C K  I  +    A+ +   ++   SP +   R
Sbjct: 28 RTQRLSRACDLCKKRKTKCQGGNPCQSCRKANIQCIYREIASHDKSHDLILGSPNKIKKR 87

Query: 71 TG 72
          +G
Sbjct: 88 SG 89

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.318    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 11,678,469
Number of extensions: 474977
Number of successful extensions: 1957
Number of sequences better than 10.0: 218
Number of HSP's gapped: 1947
Number of HSP's successfully gapped: 239
Length of query: 407
Length of database: 16,596,109
Length adjustment: 104
Effective length of query: 303
Effective length of database: 12,995,837
Effective search space: 3937738611
Effective search space used: 3937738611
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)