Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_700.391611617981e-111
YPL135W (ISU1)1651366227e-84
Scas_640.221601366043e-81
CAGL0M02629g2131356051e-80
Kwal_26.86801581295931e-79
ACR112C1541275888e-79
KLLA0D07161g1801325909e-79
YOR226C (ISU2)1561275861e-78
Sklu_2012.41501255818e-78
CAGL0J04048g1451315634e-75
YDR502C (SAM2)38479641.3
Sklu_2254.738479631.9
Kwal_56.2284184836614.1
CAGL0B01122g38279604.6
Kwal_47.1916867327605.2
Scas_695.4526833596.4
Scas_587.338279589.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_700.39
         (161 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_700.39                                                           311   e-111
YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with simila...   244   7e-84
Scas_640.22                                                           237   3e-81
CAGL0M02629g 303016..303657 some similarities with tr|Q03020 Sac...   237   1e-80
Kwal_26.8680                                                          233   1e-79
ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C (...   231   8e-79
KLLA0D07161g complement(612348..612890) some similarities with s...   231   9e-79
YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein w...   230   1e-78
Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement        228   8e-78
CAGL0J04048g 381327..381764 highly similar to tr|Q12056 Saccharo...   221   4e-75
YDR502C (SAM2) [1317] chr4 complement(1453298..1454452) S-adenos...    29   1.3  
Sklu_2254.7 YLR180W, Contig c2254 10940-12094 reverse complement       29   1.9  
Kwal_56.22841                                                          28   4.1  
CAGL0B01122g 100472..101620 highly similar to sp|P10659 Saccharo...    28   4.6  
Kwal_47.19168                                                          28   5.2  
Scas_695.45                                                            27   6.4  
Scas_587.3                                                             27   9.6  

>Scas_700.39
          Length = 161

 Score =  311 bits (798), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 152/161 (94%), Positives = 152/161 (94%)

Query: 1   MLSRLALRARXXXXXXXXXGLISPMIQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLV 60
           MLSRLALRAR         GLISPMIQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLV
Sbjct: 1   MLSRLALRARTTTTTQTPTGLISPMIQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLV 60

Query: 61  GAPACGDVMRLQIQVNDDTGIIENVKFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNT 120
           GAPACGDVMRLQIQVNDDTGIIENVKFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNT
Sbjct: 61  GAPACGDVMRLQIQVNDDTGIIENVKFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNT 120

Query: 121 QIAKELSLPPVKLHCSMLAEDAIKAAINDYKSKRTTKTVLT 161
           QIAKELSLPPVKLHCSMLAEDAIKAAINDYKSKRTTKTVLT
Sbjct: 121 QIAKELSLPPVKLHCSMLAEDAIKAAINDYKSKRTTKTVLT 161

>YPL135W (ISU1) [5310] chr16 (297552..298049) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [498 bp, 165 aa]
          Length = 165

 Score =  244 bits (622), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 114/136 (83%), Positives = 127/136 (93%)

Query: 26  IQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENV 85
           I +RLYHPKVI+HYTHPRNVGSLDKK  NVGTGLVGAPACGDVMRLQI+VND TG+IE+V
Sbjct: 30  ITKRLYHPKVIEHYTHPRNVGSLDKKLPNVGTGLVGAPACGDVMRLQIKVNDSTGVIEDV 89

Query: 86  KFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKA 145
           KFKTFGCGSAIASSSYMTE+V+GM+++DA  IKNT+IAKELSLPPVKLHCSMLAEDAIKA
Sbjct: 90  KFKTFGCGSAIASSSYMTELVQGMTLDDAAKIKNTEIAKELSLPPVKLHCSMLAEDAIKA 149

Query: 146 AINDYKSKRTTKTVLT 161
           AI DYKSKR T T+L+
Sbjct: 150 AIKDYKSKRNTPTMLS 165

>Scas_640.22
          Length = 160

 Score =  237 bits (604), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 111/136 (81%), Positives = 123/136 (90%)

Query: 25  MIQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIEN 84
           ++ +RLYH KVI+HYT+PRNVGSLDK   NVGTG+VGAPACGDV++LQIQVNDDTGIIEN
Sbjct: 24  LLTKRLYHAKVIEHYTNPRNVGSLDKSLSNVGTGIVGAPACGDVIKLQIQVNDDTGIIEN 83

Query: 85  VKFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIK 144
           VKFKTFGCGSAIASSSYMTE+V GMSV+DA  IKN +IAKELSLPPVKLHCSMLAEDAIK
Sbjct: 84  VKFKTFGCGSAIASSSYMTELVNGMSVDDAAKIKNIEIAKELSLPPVKLHCSMLAEDAIK 143

Query: 145 AAINDYKSKRTTKTVL 160
           AAI DYK+KRT  T L
Sbjct: 144 AAIKDYKTKRTHSTTL 159

>CAGL0M02629g 303016..303657 some similarities with tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1 or tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2, hypothetical
           start
          Length = 213

 Score =  237 bits (605), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 112/135 (82%), Positives = 123/135 (91%)

Query: 26  IQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENV 85
           I RR+YHPKVI+HYTHPRNVGS+DK   NVGTGLVGAPACGDVMRLQI+VND TG+IE+V
Sbjct: 78  IGRRMYHPKVIEHYTHPRNVGSMDKTLPNVGTGLVGAPACGDVMRLQIKVNDKTGVIEDV 137

Query: 86  KFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKA 145
           KFKTFGCGSAIASSSYMTE+V GM+++DA  IKNT IAKELSLPPVKLHCSMLAEDAIKA
Sbjct: 138 KFKTFGCGSAIASSSYMTELVHGMTLDDAAKIKNTTIAKELSLPPVKLHCSMLAEDAIKA 197

Query: 146 AINDYKSKRTTKTVL 160
           AI DYKSKRT+ T L
Sbjct: 198 AIKDYKSKRTSTTTL 212

>Kwal_26.8680
          Length = 158

 Score =  233 bits (593), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 108/129 (83%), Positives = 120/129 (93%)

Query: 26  IQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENV 85
           + RR YHPKVIDHYT+PRNVGSLDKK  NVGTGLVGAPACGDVM+LQIQVND+TG+IENV
Sbjct: 24  VARRAYHPKVIDHYTNPRNVGSLDKKLENVGTGLVGAPACGDVMKLQIQVNDETGVIENV 83

Query: 86  KFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKA 145
           KFKTFGCGSAIASSSYMTE+V+G +++ A  IKNT+IAKELSLPPVKLHCSMLAEDAIKA
Sbjct: 84  KFKTFGCGSAIASSSYMTELVRGKTLDVASQIKNTEIAKELSLPPVKLHCSMLAEDAIKA 143

Query: 146 AINDYKSKR 154
           AI DY+SKR
Sbjct: 144 AIKDYRSKR 152

>ACR112C [1159] [Homologous to ScYPL135W (ISU1) - SH; ScYOR226C
           (ISU2) - SH] (549554..550018) [465 bp, 154 aa]
          Length = 154

 Score =  231 bits (588), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (92%)

Query: 28  RRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENVKF 87
           RR YHPKVIDHYT+PRNVG+LDKK  NVGTGLVGAPACGDVMRLQIQV+D TG+IENVKF
Sbjct: 22  RRCYHPKVIDHYTNPRNVGTLDKKLTNVGTGLVGAPACGDVMRLQIQVDDSTGVIENVKF 81

Query: 88  KTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKAAI 147
           KTFGCGSAIASSSYMTE+V+G ++ DA  IKNT+IA+ELSLPPVKLHCSMLAEDAIKAAI
Sbjct: 82  KTFGCGSAIASSSYMTELVRGKTLADAEKIKNTEIARELSLPPVKLHCSMLAEDAIKAAI 141

Query: 148 NDYKSKR 154
            DY+SKR
Sbjct: 142 KDYRSKR 148

>KLLA0D07161g complement(612348..612890) some similarities with
           sgd|S0006056 Saccharomyces cerevisiae YPL135w ISU1,
           hypothetical start
          Length = 180

 Score =  231 bits (590), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%)

Query: 25  MIQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIEN 84
           M   R YHPKVIDHYT+PRNVGSLDK   NVGTGLVGAPACGDVM+LQIQVND+TG+IEN
Sbjct: 45  MASARFYHPKVIDHYTNPRNVGSLDKNLPNVGTGLVGAPACGDVMKLQIQVNDETGVIEN 104

Query: 85  VKFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIK 144
           VKFKTFGCGSAIASSSYMTE+V+G ++ DA  IKNT+IA+ELSLPPVKLHCSMLAEDAIK
Sbjct: 105 VKFKTFGCGSAIASSSYMTELVRGKTLEDAAKIKNTEIARELSLPPVKLHCSMLAEDAIK 164

Query: 145 AAINDYKSKRTT 156
           AAI DY++KR T
Sbjct: 165 AAIKDYQAKRPT 176

>YOR226C (ISU2) [5017] chr15 complement(761614..762084) Protein with
           similarity to iron-sulfur cluster nitrogen fixation
           proteins [471 bp, 156 aa]
          Length = 156

 Score =  230 bits (586), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 120/127 (94%)

Query: 28  RRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENVKF 87
           +RLYHPKVIDHYT+PRNVGS+DK   NVGTG+VGAPACGDV++LQIQVND +GIIENVKF
Sbjct: 24  KRLYHPKVIDHYTNPRNVGSMDKSLANVGTGIVGAPACGDVIKLQIQVNDKSGIIENVKF 83

Query: 88  KTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKAAI 147
           KTFGCGSAIASSSYMTE+V+GMS+++A  IKNT+IAKELSLPPVKLHCSMLAEDAIKAAI
Sbjct: 84  KTFGCGSAIASSSYMTELVRGMSLDEAVKIKNTEIAKELSLPPVKLHCSMLAEDAIKAAI 143

Query: 148 NDYKSKR 154
            DYK+KR
Sbjct: 144 KDYKTKR 150

>Sklu_2012.4 YPL135W, Contig c2012 4922-5374 reverse complement
          Length = 150

 Score =  228 bits (581), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 117/125 (93%)

Query: 26  IQRRLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENV 85
           + RRLYHPKVIDHYT+PRNVGSLDK   NVGTGLVGAPACGDVM+LQIQVNDDTG+IENV
Sbjct: 16  LTRRLYHPKVIDHYTNPRNVGSLDKNLTNVGTGLVGAPACGDVMKLQIQVNDDTGVIENV 75

Query: 86  KFKTFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKA 145
           KFKTFGCGSAIASSSYMTE+V+G +++DA  I+NT+IA+ELSLPPVKLHCSMLAEDAIKA
Sbjct: 76  KFKTFGCGSAIASSSYMTELVRGKTLDDAAKIRNTEIARELSLPPVKLHCSMLAEDAIKA 135

Query: 146 AINDY 150
           AI DY
Sbjct: 136 AIKDY 140

>CAGL0J04048g 381327..381764 highly similar to tr|Q12056
           Saccharomyces cerevisiae YOR226c ISU2 or tr|Q03020
           Saccharomyces cerevisiae YPL135w ISU1, hypothetical
           start
          Length = 145

 Score =  221 bits (563), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 99/131 (75%), Positives = 120/131 (91%)

Query: 29  RLYHPKVIDHYTHPRNVGSLDKKALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENVKFK 88
           R+YHPKVI+HYT+PRNVGS+DK   NVGTG+VGAPACGDV++LQIQVND+TG+IE  KFK
Sbjct: 14  RMYHPKVIEHYTNPRNVGSMDKTLRNVGTGVVGAPACGDVIKLQIQVNDNTGVIEEAKFK 73

Query: 89  TFGCGSAIASSSYMTEMVKGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDAIKAAIN 148
           TFGCGSAIASSSY+TE+V+G+++ DA  IKN +IAKELSLPPVKLHCSMLAEDAIKAA+ 
Sbjct: 74  TFGCGSAIASSSYLTELVQGITIEDAEKIKNIEIAKELSLPPVKLHCSMLAEDAIKAAVR 133

Query: 149 DYKSKRTTKTV 159
           DYK+KR++ T+
Sbjct: 134 DYKTKRSSTTL 144

>YDR502C (SAM2) [1317] chr4 complement(1453298..1454452)
           S-adenosylmethionine synthetase 2 [1155 bp, 384 aa]
          Length = 384

 Score = 29.3 bits (64), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 52  ALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENVKFKTFGCGSAIASSSYMTEMV-KGMS 110
           A  V   LV A  C    R+Q+Q +   GI E +       G+A  S   + E++ K   
Sbjct: 287 ARWVAKSLVAAGLC---KRVQVQFSYAIGIAEPLSLHVDTYGTATKSDDEIIEIIKKNFD 343

Query: 111 VNDAFLIKNTQIAKELSLP 129
           +    L+K   +A+ + LP
Sbjct: 344 LRPGVLVKELDLARPIYLP 362

>Sklu_2254.7 YLR180W, Contig c2254 10940-12094 reverse complement
          Length = 384

 Score = 28.9 bits (63), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 35/79 (44%), Gaps = 4/79 (5%)

Query: 52  ALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENVKFKTFGCGSAIASSSYMTEMV-KGMS 110
           A  V   LV A  C    R+Q+Q +   GI E +       G+A  S   + E++ K   
Sbjct: 287 ARWVAKSLVHAGLC---KRVQVQFSYAIGIAEPLSLHVDTYGTATKSDEEIIEIIKKNFD 343

Query: 111 VNDAFLIKNTQIAKELSLP 129
           +    L+K   +A+ + LP
Sbjct: 344 LRPGVLVKELDLARPIYLP 362

>Kwal_56.22841
          Length = 848

 Score = 28.1 bits (61), Expect = 4.1,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 107 KGMSVNDAFLIKNTQIAKELSLPPVKLHCSMLAEDA 142
           K + + D  L KN+Q    L+L  + L+C+   EDA
Sbjct: 40  KSLKLVDTILKKNSQHVDSLALKGLNLYCTAQKEDA 75

>CAGL0B01122g 100472..101620 highly similar to sp|P10659
           Saccharomyces cerevisiae YLR180w SAM1
           S-adenosylmethionine synthetase or sp|P19358
           Saccharomyces cerevisiae YDR502c SAM2, start by
           similarity
          Length = 382

 Score = 27.7 bits (60), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 4/79 (5%)

Query: 52  ALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENVKFKTFGCGSAIASSSYMTEMV-KGMS 110
           A  V   LV A  C    R+Q+Q +   GI E +       G+A      + E++ K   
Sbjct: 285 ARWVAKSLVAAGLC---KRVQVQFSYAIGIAEPLSLHVETYGTATRPDDEIIEIIKKNFD 341

Query: 111 VNDAFLIKNTQIAKELSLP 129
           +    L+K   +A+ + LP
Sbjct: 342 LRPGILVKELDLARPIYLP 360

>Kwal_47.19168
          Length = 673

 Score = 27.7 bits (60), Expect = 5.2,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 18/27 (66%)

Query: 98  SSSYMTEMVKGMSVNDAFLIKNTQIAK 124
           +  +MT + KG+  +D FL+KN Q+ K
Sbjct: 492 AHKFMTSVPKGLIPDDNFLVKNFQLEK 518

>Scas_695.45
          Length = 268

 Score = 27.3 bits (59), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 46 GSLDKKALNVGTGLVGAPACGDVMRLQIQVNDD 78
          G +DK A N+  G++ A     + R++  +NDD
Sbjct: 13 GHIDKMAQNIKEGIISAGGMATIYRVEETLNDD 45

>Scas_587.3
          Length = 382

 Score = 26.9 bits (58), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 4/79 (5%)

Query: 52  ALNVGTGLVGAPACGDVMRLQIQVNDDTGIIENVKFKTFGCGSAIASSSYMTEMV-KGMS 110
           A  V   LV A  C    R+Q+Q +   GI E +       G+A  S   +  ++ K   
Sbjct: 285 ARWVAKSLVAAGLC---KRVQVQFSYAIGIAEPLSLHVDTYGTATKSDEEIIAIIKKNFD 341

Query: 111 VNDAFLIKNTQIAKELSLP 129
           +    L+K   +A+ + LP
Sbjct: 342 LRPGILVKELDLARPIYLP 360

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.320    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 4,406,897
Number of extensions: 164803
Number of successful extensions: 419
Number of sequences better than 10.0: 19
Number of HSP's gapped: 419
Number of HSP's successfully gapped: 19
Length of query: 161
Length of database: 16,596,109
Length adjustment: 93
Effective length of query: 68
Effective length of database: 13,376,635
Effective search space: 909611180
Effective search space used: 909611180
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 57 (26.6 bits)