Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_700.381239123951600.0
YPL137C1276104625280.0
CAGL0M02607g1204103022480.0
Scas_640.21119999821820.0
YOR227W124692021400.0
Kwal_26.86871088104019840.0
ACR113W110298918820.0
KLLA0D07216g127892418840.0
CAGL0J04026g119870417090.0
KLLA0E11847g12646436372e-67
YJL042W (MHP1)13984416203e-65
Kwal_23.548811124426163e-65
CAGL0J00803g13146336167e-65
Scas_690.3314234456123e-64
ACR059W12164444918e-50
Kwal_33.149891214193761.1
KLLA0F05401g102745723.3
CAGL0K00363g1227168696.8
Scas_578.81297157688.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_700.38
         (1239 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_700.38                                                          1992   0.0  
YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protei...   978   0.0  
CAGL0M02607g complement(298560..302174) similar to tr|Q03016 Sac...   870   0.0  
Scas_640.21                                                           845   0.0  
YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unkno...   828   0.0  
Kwal_26.8687                                                          768   0.0  
ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH] co...   729   0.0  
KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058 Sacch...   730   0.0  
CAGL0J04026g complement(376899..380495) similar to tr|Q12276 Sac...   662   0.0  
KLLA0E11847g complement(1044591..1048385) some similarities with...   249   2e-67
YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interac...   243   3e-65
Kwal_23.5488                                                          241   3e-65
CAGL0J00803g complement(83483..87427) similar to sp|P43638 Sacch...   241   7e-65
Scas_690.33                                                           240   3e-64
ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH] complement(...   193   8e-50
Kwal_33.14989                                                          34   1.1  
KLLA0F05401g 529272..532355 gi|29420855|dbj|BAC66649.1 Kluyverom...    32   3.3  
CAGL0K00363g complement(37452..41135) similar to sp|P12866 Sacch...    31   6.8  
Scas_578.8                                                             31   8.9  

>Scas_700.38
          Length = 1239

 Score = 1992 bits (5160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1010/1239 (81%), Positives = 1010/1239 (81%)

Query: 1    MNPTPSDFDVPLEWLYXXXXXXXXXXXXXXXXXXXXXXXVIQNPAEXXXXXXXXXXXXXX 60
            MNPTPSDFDVPLEWLY                       VIQNPAE              
Sbjct: 1    MNPTPSDFDVPLEWLYKGGKSKRRTKSRTKSSTGKLTSTVIQNPAETTTSTSRRTRSSSI 60

Query: 61   XXXXXXXXHLPLINTSSSSAIEDDEEGEQMAVLTPIXXXXXXXXXXPVIMKKSRNRSTSI 120
                    HLPLINTSSSSAIEDDEEGEQMAVLTPI          PVIMKKSRNRSTSI
Sbjct: 61   SNAALSSNHLPLINTSSSSAIEDDEEGEQMAVLTPITSTTNSTNNSPVIMKKSRNRSTSI 120

Query: 121  TNAVVSNKAXXXXXXXXXXXXXXXXXXXXXXXLNEKPKKSLLGSLFGRXXXXXXXXXXXX 180
            TNAVVSNKA                       LNEKPKKSLLGSLFGR            
Sbjct: 121  TNAVVSNKAPVVVPTKSTTSSSTSNSVKRSSSLNEKPKKSLLGSLFGRKLSSSSKTKPTI 180

Query: 181  XXXXXXXXXXXXXVASKLISETLKEPNSPDVNMNSQSTIISTPLGDXXXXXXXXXXXXXX 240
                         VASKLISETLKEPNSPDVNMNSQSTIISTPLGD              
Sbjct: 181  IPPKLKPIKTTSTVASKLISETLKEPNSPDVNMNSQSTIISTPLGDSTASSPQVFQSSSS 240

Query: 241  XXXXXNEKLLHSEEKLAIQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDM 300
                 NEKLLHSEEKLAIQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDM
Sbjct: 241  SSTSSNEKLLHSEEKLAIQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDM 300

Query: 301  ISEVPSISMGISANTPQSTKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIA 360
            ISEVPSISMGISANTPQSTKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIA
Sbjct: 301  ISEVPSISMGISANTPQSTKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIA 360

Query: 361  DEVANFKATSSEQKSSIPVTLLPSTTAADSELNEKINNIDKPIHVHEHHFEQEISTGEVT 420
            DEVANFKATSSEQKSSIPVTLLPSTTAADSELNEKINNIDKPIHVHEHHFEQEISTGEVT
Sbjct: 361  DEVANFKATSSEQKSSIPVTLLPSTTAADSELNEKINNIDKPIHVHEHHFEQEISTGEVT 420

Query: 421  LDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINT 480
            LDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINT
Sbjct: 421  LDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINT 480

Query: 481  IIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDIS 540
            IIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDIS
Sbjct: 481  IIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDIS 540

Query: 541  QTKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKDLLHS 600
            QTKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKDLLHS
Sbjct: 541  QTKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKDLLHS 600

Query: 601  ISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVGKLS 660
            ISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVGKLS
Sbjct: 601  ISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVGKLS 660

Query: 661  SLTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYLP 720
            SLTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYLP
Sbjct: 661  SLTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYLP 720

Query: 721  RFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAAASDSSTNVVGPE 780
            RFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAAASDSSTNVVGPE
Sbjct: 721  RFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAAASDSSTNVVGPE 780

Query: 781  SQSQFARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMDSTFQL 840
            SQSQFARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMDSTFQL
Sbjct: 781  SQSQFARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMDSTFQL 840

Query: 841  DELASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTXXXXXXXXXXXXHRVH 900
            DELASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVT            HRVH
Sbjct: 841  DELASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTKRYLLKKYLEKLHRVH 900

Query: 901  FNTQHKIDCMFEKRNSGEXXXXXXXXXXXXXXXXXXXXXXMEILGALPQVSSVLGSNKED 960
            FNTQHKIDCMFEKRNSGE                      MEILGALPQVSSVLGSNKED
Sbjct: 901  FNTQHKIDCMFEKRNSGELTLQEKENLLRLLLLEKNLSNLMEILGALPQVSSVLGSNKED 960

Query: 961  SMQPVYXXXXXXXXXXXXXXXXXXXXXXLKHXXXXXXXXXXXXTRPHLMATDSGRTVDVL 1020
            SMQPVY                      LKH            TRPHLMATDSGRTVDVL
Sbjct: 961  SMQPVYQQSQEGSTVTSGTSSESVSSVVLKHVESVEPIVVPPETRPHLMATDSGRTVDVL 1020

Query: 1021 TGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKSKETVNXXXXX 1080
            TGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKSKETVN     
Sbjct: 1021 TGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKSKETVNPPTPT 1080

Query: 1081 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTELRKAIIKAKGIDSIDDLIQNVNQ 1140
                                              GTELRKAIIKAKGIDSIDDLIQNVNQ
Sbjct: 1081 TPTTASTSTTSTATHTPTPTTSKTPIIIVPKIPSGTELRKAIIKAKGIDSIDDLIQNVNQ 1140

Query: 1141 DEDELINIYGKSVQPKLNHPTGKLVEDDISSITRITPKTNTPAANGNTAPHITLGAKNVS 1200
            DEDELINIYGKSVQPKLNHPTGKLVEDDISSITRITPKTNTPAANGNTAPHITLGAKNVS
Sbjct: 1141 DEDELINIYGKSVQPKLNHPTGKLVEDDISSITRITPKTNTPAANGNTAPHITLGAKNVS 1200

Query: 1201 VTTQEIDTSEDNCEKNCEQITEAYDKLLNNLSIKRPGKA 1239
            VTTQEIDTSEDNCEKNCEQITEAYDKLLNNLSIKRPGKA
Sbjct: 1201 VTTQEIDTSEDNCEKNCEQITEAYDKLLNNLSIKRPGKA 1239

>YPL137C (YPL137C) [5309] chr16 complement(292816..296646) Protein of
            unknown function, has low similarity to a region of S.
            cerevisiae Mhp1p, which is a microtubule-interacting
            protein that functions in stabilization of microtubules
            [3831 bp, 1276 aa]
          Length = 1276

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/1046 (52%), Positives = 674/1046 (64%), Gaps = 111/1046 (10%)

Query: 256  LAIQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGISAN- 314
            LA++ LS++ LKRV+FAVDKFE+DP QQLPSRTPK+GN+L+PDDMISEVPSIS+GIS++ 
Sbjct: 272  LAVKDLSTVSLKRVSFAVDKFESDPPQQLPSRTPKKGNILIPDDMISEVPSISVGISSSN 331

Query: 315  -----TPQSTKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKAT 369
                 T  + K P ++K SKEY LALENQ+ A++EA KHQ+EAHFAA RIA EVANFK  
Sbjct: 332  QSAKSTNSNIKGPLYTKKSKEYILALENQKLALREAAKHQQEAHFAANRIAFEVANFKTA 391

Query: 370  S------SEQKSSIPVT-----LLPSTTAADSEL-NEKIN------NIDKPIHVHEHHFE 411
            S      +E+ S   +T     + P    AD EL N K+        IDKPIH+HEH+F+
Sbjct: 392  SDAGGKLTEKSSEGTITKQREEVSPPNVEADRELENNKLAENLSKAGIDKPIHMHEHYFK 451

Query: 412  Q----------EISTGEVTLDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKP 461
            +           I   EVTLD++YTRCCHLREILPIPSTLRQVK KTAPLQ LKFLNPKP
Sbjct: 452  EPDQDKYQDGHSIENNEVTLDVIYTRCCHLREILPIPSTLRQVKDKTAPLQILKFLNPKP 511

Query: 462  TLIDILSFCDFISIVPINTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENW 521
            TLIDILSFCDFI+I PI+TI+FDNV+L  +MF+IIIS++V STVL+KL LRNV ID++ W
Sbjct: 512  TLIDILSFCDFITIAPIHTIVFDNVALNQDMFRIIISALVNSTVLDKLSLRNVRIDQDGW 571

Query: 522  KLLCKFMLNNKSIVKLDISQTKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILL 581
            KLLCKF+L NKS+ KLDISQTKI+  S+  E++YRHNMDW LF +VL  R  KP+EE+L 
Sbjct: 572  KLLCKFLLLNKSLNKLDISQTKIK--SDLAESLYRHNMDWNLFTDVLSQRSHKPIEELLF 629

Query: 582  NGIKFNNIPVHIFKDLLHSISSQRNATSVGIRVGLA---TSDISLDCLKAVMNWISANNV 638
            NGI+F+ IP   F  LL S ++Q+N    GIR+GLA   TS+IS DCLK + NW+S  NV
Sbjct: 630  NGIQFSKIPYSCFARLLTSFATQKNFPESGIRLGLAGATTSNISQDCLKFIFNWMSQYNV 689

Query: 639  QGVDLSFNDLAAFVKPLVGKLSSLTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKF 698
            QGVDL+FNDL+  +KP+VGKLS+L++ NL YF LN+TNIS+SYD+AL+LKYL KLPNL F
Sbjct: 690  QGVDLAFNDLSTMIKPMVGKLSALSYDNLRYFILNSTNISTSYDLALLLKYLSKLPNLIF 749

Query: 699  LDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSM 758
            LDLSNL Q +PD+LPYMYKYLPRFP LKRIH D+NNL+ KEL VVCNIL+KC SL+HVSM
Sbjct: 750  LDLSNLSQCFPDILPYMYKYLPRFPNLKRIHLDSNNLTLKELAVVCNILIKCKSLSHVSM 809

Query: 759  LSQ---------------LQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSPN 803
             +Q                Q+ T    DSS+ +   + + QFA+N+  +TLYA A+DSPN
Sbjct: 810  TNQNVENFYLMNGTDSPVQQTNTDGDLDSSSTL---DVKGQFAKNSFSSTLYAFARDSPN 866

Query: 804  LVGLDIDYDRIPEEIQQRIALCLMRNMNRAMDSTFQLDELASQDDLLFDGTLITETAEDV 863
            L+GLD DYD I EEIQ RIALCLMRNM R MDSTFQLDEL SQDDLLFDG+L+T TAE V
Sbjct: 867  LIGLDFDYDLISEEIQSRIALCLMRNMKRTMDSTFQLDELDSQDDLLFDGSLVTMTAESV 926

Query: 864  LTKLNKLNENTSASTDKKDVTXXXXXXXXXXXXHRVHFNTQHKIDCMFEKRNSGEXXXXX 923
            L KLN L++ ++    KKD T            H +H N QH ID MFEKR SGE     
Sbjct: 927  LEKLNLLSDKSTKV--KKDTTKRYLLKKYIEKFHILHHNVQHTIDTMFEKRKSGELPLQE 984

Query: 924  XXXXXXXXXXXXXXXXXMEILGALPQVSSVLGSNKEDSMQPVYXXXXXXXXXXXXXXXXX 983
                             +E+    P ++ VLGS+++DS + V                  
Sbjct: 985  KENLVRLLLLEQNLCNILELFSHNPNLNDVLGSSRDDSKESV-------------DSSED 1031

Query: 984  XXXXXLKHXXXXXXXXXXX--------XTRPHLMATDSGRTVDVLTGKPVLFRRGSSSTS 1035
                 LKH                     RPHLMATDSG+T+DV TGKP++F+  SSSTS
Sbjct: 1032 SKLPALKHVESGYHVPEEKIQPENDVITARPHLMATDSGKTIDVFTGKPLVFKHTSSSTS 1091

Query: 1036 VVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTK-----SKET-VNXXXXXXXXXXXXXX 1089
            V  KKQ EEEGELHKWG+FVQQQ S+YPENE T+     S +T +N              
Sbjct: 1092 VGCKKQEEEEGELHKWGFFVQQQRSLYPENESTRQTPFASGDTPINTETAGKSTSSPSVS 1151

Query: 1090 XXXXXXXXXXXXXXXXXXXXXXXXXGTELRKAIIKAKGIDSIDDLIQNVNQDEDELINIY 1149
                                     G  LR AI+KAKGIDSIDDLIQNVN +  EL NIY
Sbjct: 1152 TSNNETATTSLFSPANPKILPKIPSGAVLRSAIMKAKGIDSIDDLIQNVNSNNIELENIY 1211

Query: 1150 GKSVQPKLNHPTGKLVEDDISSITRITPKTNTPAANGNTAPHITLGAKNVSVTTQEIDTS 1209
            G+S+Q               +S +  TP  ++  +  NT        K    T   + T 
Sbjct: 1212 GESIQ---------------NSASTFTPGVDSDVSAPNT-------DKGSVETLPAVSTD 1249

Query: 1210 EDNCEKNCEQITEAYDKLLNNLSIKR 1235
            + NCE    ++T  YDKLLNNLS++R
Sbjct: 1250 DPNCEV---KVTATYDKLLNNLSMER 1272

>CAGL0M02607g complement(298560..302174) similar to tr|Q03016
            Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1204

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 494/1030 (47%), Positives = 637/1030 (61%), Gaps = 67/1030 (6%)

Query: 156  KPKK-SLLGSLFGRXXXXXXXXXXXXXXXXXXXXXXXXXVASKLISETLKEPNSPDVNMN 214
            KPKK SL GSLFGR                            K   + L  P SP V+ N
Sbjct: 153  KPKKTSLFGSLFGRSRSSSQSNDTEKKLDTAKRLAISTASEKKTYPQELLTPASP-VSAN 211

Query: 215  SQSTIISTPLGDXXXXXXXXXXXXXXXXXXXNEKLLHSEEKLAIQK---LSSIKLKRVTF 271
            S S  I                         N      +E  + ++   L+ I LKRV F
Sbjct: 212  SPSPDIRRSTSITKSAKEHRARNSDNTTTDKNTHQETQKESGSRERPTDLTKISLKRVKF 271

Query: 272  AVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGISANTPQSTKTPSFSKNSKEY 331
            AVDKFE DP QQLPSRTPK GN+++PDDMISE+P+IS+GI++N  ++   P F+K+S EY
Sbjct: 272  AVDKFETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKNNLGPQFTKDSIEY 331

Query: 332  RLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKATSSEQKSSIPVTLLPSTTAADS- 390
            + ALE  + A+KEAEKHQ+EAH AA+RIA EV+NF   S+ +++S P  +L     +D  
Sbjct: 332  KRALEIHQIALKEAEKHQQEAHHAARRIAHEVSNF---SNGKQASAPGFMLNLVAQSDQS 388

Query: 391  ---------------ELNEKIN--NIDKPIHVHEHHFEQEIST----GEVTLDIVYTRCC 429
                           +L+EK+N   ID PIH+HEHHF+   ST     E+TLD+VYTRCC
Sbjct: 389  KRDQNSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHFDDPGSTLEGNQEITLDVVYTRCC 448

Query: 430  HLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINTIIFDNVSLT 489
            HLREILPIPSTL+QV  KTAPLQTLKFLNPKPTLIDILSFCDFI+IVPI TI+FDNV+L+
Sbjct: 449  HLREILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDFIAIVPIQTIVFDNVNLS 508

Query: 490  SEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDISQTKIRTESN 549
            +EMFKI+ISSV  S+VLEK+ LRNV ++KE+W+LLCKF+L ++S+ K+DISQT+I+ E+ 
Sbjct: 509  TEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSLNKIDISQTRIKPETG 568

Query: 550  DLENIYRHNMDWELFANVLQYRLG--KPLEEILLNGIKFNNIPVHIFKDLLHSISSQRNA 607
                + R +MDW+LFA  L  R    +PLEEIL+NG+ F+NIP+  F++ L + ++Q++ 
Sbjct: 569  --TELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLEDFQNFLITFATQKHL 626

Query: 608  TSVGIRVGLAT---SDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVGKLSSLTF 664
            T+ GIR+GLA    S  S+   K ++ W+S  NVQGVDL FNDL+  +KP +GKLSSLT+
Sbjct: 627  TN-GIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSNLIKPTLGKLSSLTY 685

Query: 665  PNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQ 724
            PNL YFTLN+TNI S+ D+AL+LK L KLPNL+FLDLSNLPQ++PD+LPYMYKYLPRFPQ
Sbjct: 686  PNLHYFTLNSTNIQSTNDMALLLKALSKLPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQ 745

Query: 725  LKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQL--QSPTAAASDSSTNVVGPESQ 782
            LKR+H DN N+++KE+TVVCN+L KC  L HVSMLSQ    S T +A + STN     S 
Sbjct: 746  LKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAENLSTN-GDSNSG 804

Query: 783  SQFARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMDSTFQLDE 842
            + FA+NN  ATLYA  +DSPNLVGLDIDY  I +E+  R+ALCLMRNM R MDS+FQLDE
Sbjct: 805  TVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSFQLDE 864

Query: 843  LASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTXXXXXXXXXXXXHRVHFN 902
            L SQD+LLFDG+L+T TA+DVL +L +L  NT    +KKD T            H++H N
Sbjct: 865  LDSQDELLFDGSLVTMTAKDVLERLTQL--NTKQIIEKKDATKRYLLKKYVQKLHKIHNN 922

Query: 903  TQHKIDCMFEKRNSGEXXXXXXXXXXXXXXXXXXXXXXMEILGALPQVSSVLGSNKEDSM 962
             Q  ID +FEKR SG+                      ++I   +P +S VLG NK  S 
Sbjct: 923  VQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPNLSEVLGENKIASS 982

Query: 963  QPVYXXXXXXXXXXXXXXXXXXXXXXLKHXXXXXXXXXXXXTRPHLMATDSGRTVDVLTG 1022
              +                       L+              RPHLMAT+SGRT+D LTG
Sbjct: 983  DSLVDHPNLRHVVETDNLNENSNERDLQ-----VNENDNLQQRPHLMATESGRTIDTLTG 1037

Query: 1023 KPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKSKETVNXXXXXXX 1082
            +PV  RR SS+TS+  KKQ EEEG+ HKWG+++QQQ ++YP+ E    + +         
Sbjct: 1038 RPVFSRR-SSTTSLASKKQEEEEGDFHKWGFYIQQQKALYPDGESQYGESSA-------- 1088

Query: 1083 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTELRKAIIKAKGIDSIDDLIQNVNQ-- 1140
                                            G ELR AIIKAKG+ SI++LIQ +N   
Sbjct: 1089 ------VSASTSQTTLPSIDSKEKKIFTKLPSGPELRTAIIKAKGVSSIEELIQKINDYH 1142

Query: 1141 --DEDELINI 1148
              D + L NI
Sbjct: 1143 CCDIESLYNI 1152

>Scas_640.21
          Length = 1199

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/998 (47%), Positives = 628/998 (62%), Gaps = 76/998 (7%)

Query: 261  LSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGI------SAN 314
            +S+I L+RV F+VDKF  DP QQLPSR PK G+VL+P+DMISEVP IS+GI      S +
Sbjct: 249  ISNISLRRVKFSVDKFTDDPPQQLPSRKPKLGDVLIPNDMISEVPPISVGITTTDNNSGS 308

Query: 315  TPQSTKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEV---ANFKA--- 368
            T  + + P ++K+SKEY++ALE  + ++KE E+HQ+EA  AA+RIA EV   +  +A   
Sbjct: 309  TLITNQHPMYTKDSKEYKIALERYKKSLKEGERHQEEAQKAAERIAREVYSSSRHRANSL 368

Query: 369  TSSEQKSSIPVTLLPSTTAADSELNEKIN------NIDKPIHVHEHHFEQEIST---GEV 419
            TSS  K++   +  P +    +EL+ K++      +IDKPIH+H+++F  + ST    EV
Sbjct: 369  TSSLTKTTSNTSSNPLSKQNSNELDTKVDVKAKTLSIDKPIHMHQNNFGDDFSTHNTNEV 428

Query: 420  TLDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVPIN 479
            TLD++YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNP+PTLIDILSFCDFISI+PI+
Sbjct: 429  TLDVIYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPRPTLIDILSFCDFISIIPIH 488

Query: 480  TIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDI 539
            TI+FDNV+LTSEMF+I++SS+V S VLEKLGLRNV ID+E+WK+ CKF+++NKS++KLDI
Sbjct: 489  TIVFDNVALTSEMFRIVLSSIVNSNVLEKLGLRNVTIDEEDWKIFCKFLIDNKSLIKLDI 548

Query: 540  SQTKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKDLLH 599
            SQTKIR ES+   + YR NMDW LF  VL+ R GKPLEE+LLNG+KFN IP+ IF+DLLH
Sbjct: 549  SQTKIRPESS--ISCYRENMDWSLFCQVLKRRKGKPLEELLLNGVKFNRIPLGIFQDLLH 606

Query: 600  SISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVGKL 659
              +     T+V  R+GLA SDISL CLK +  W+S  +V+GVDL+FN+LA  +KP++  L
Sbjct: 607  VFAKMNPKTNV--RLGLAVSDISLGCLKILFPWMSKYSVEGVDLAFNNLADLLKPIIESL 664

Query: 660  SSLTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYL 719
            S+L F +L+YFTLN+TNISS  D+AL++KYL KLPNL+FLDLSNLPQ++P+++P ++KYL
Sbjct: 665  STLDFKHLKYFTLNSTNISSVDDMALLIKYLSKLPNLQFLDLSNLPQLFPNIIPDLHKYL 724

Query: 720  PRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAAASDSSTNVVGP 779
            P+FP LKRI+F+NN+L+++E++++CNIL KC  ++HVS+LSQ    T    +     +G 
Sbjct: 725  PQFPSLKRIYFENNDLTYREISMICNILQKCKLISHVSLLSQHPPSTLENENHIDTELGK 784

Query: 780  ESQSQ--FARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMDST 837
            +  ++  F R+ LWATLY+LA+ SPNLV LDIDYD + EE++ RIALCLMRNM R MDS+
Sbjct: 785  DDSNKDLFNRHTLWATLYSLARSSPNLVSLDIDYDELSEEMRSRIALCLMRNMQRTMDSS 844

Query: 838  FQLDELASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTXXXXXXXXXXXXH 897
            F+LDE   QD+LLFDG+LI+ETA+ VL KLN        S D  D T             
Sbjct: 845  FELDEALLQDNLLFDGSLISETADTVLNKLN------DESKDDIDPTRKYLLKKYLEKLE 898

Query: 898  RVHFNTQHKIDCMFEKRNSGEXXXXXXXXXXXXXXXXXXXXXXMEILGALPQVSSVLGSN 957
             +H + Q  ID MFEKR SGE                      +EI   +P +S V  S 
Sbjct: 899  NLHNSVQQTIDSMFEKRKSGELPLEEKENLVRLLLLEKNLSNILEIFSKIPFLSDVFNST 958

Query: 958  KEDSMQPVYXXXXXXXXXXXXXXXXXXXXXXLKHXXXXXXXXXXXXTRPHLMATDSGRTV 1017
               S                            +               PH+MAT++G  +
Sbjct: 959  LASSPIQTNQTTAITDDEVPVRRPQLKHLDSARLLHQAIVPSSENTGDPHIMATEAGSVI 1018

Query: 1018 DVLTGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKSKETVNXX 1077
            D  TGKPVL  + SS+TS+  KKQ EEEGELHKWG FVQQ+     EN V  S+ + N  
Sbjct: 1019 DTYTGKPVL-HKSSSNTSLFSKKQEEEEGELHKWGVFVQQKQQ--QENAVPGSESSSN-L 1074

Query: 1078 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTELRKAIIKAKGIDSIDDLIQN 1137
                                                 G +LR+AII AKGI SIDDLIQN
Sbjct: 1075 SKESISSQASPTHRSSPTSLQLEDKTATPKILPKIPSGPQLREAIINAKGIASIDDLIQN 1134

Query: 1138 VNQDEDELINIYGKSVQPKLNHPTGKLVEDDISSITRITPKTNTPAANGNTAPHITLGAK 1197
            VN+   E+ +I G  V    N       + + ++I+R    TNT +AN            
Sbjct: 1135 VNEKRVEVESINGDFVPIDCN-------KKNDTNISR--QPTNTSSAN------------ 1173

Query: 1198 NVSVTTQEIDTSEDNCEKNCEQITEAYDKLLNNLSIKR 1235
                        ED      E +TE YD++LNNLS  R
Sbjct: 1174 ------------ED------ETVTEKYDEILNNLSNDR 1193

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/16 (87%), Positives = 16/16 (100%)

Query: 153 LNEKPKKSLLGSLFGR 168
           L+EKPKKSLLGS+FGR
Sbjct: 163 LSEKPKKSLLGSIFGR 178

>YOR227W (YOR227W) [5018] chr15 (762825..766565) Protein of unknown
            function, interacts with Glc7p [3741 bp, 1246 aa]
          Length = 1246

 Score =  828 bits (2140), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/920 (48%), Positives = 593/920 (64%), Gaps = 49/920 (5%)

Query: 258  IQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGISANTPQ 317
            +QK+S + LKRVT AV +F +DP QQLPSR PK+GNVL+P+DMIS  P IS+GI+ ++ Q
Sbjct: 298  LQKVSKVNLKRVTIAVQEFNSDPPQQLPSRKPKRGNVLIPEDMISAPPLISLGITNSSDQ 357

Query: 318  STK----TPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKATSSEQ 373
            S+     +PS+SK+SKEY+LALEN + A KEAEKHQK+A++ A+R+A EVAN+KA    Q
Sbjct: 358  SSFQSNISPSYSKDSKEYKLALENFKKAAKEAEKHQKDAYYVAERMAQEVANYKA---RQ 414

Query: 374  KSSIPVTLLPSTTAADSELNEKIN---------NIDKPIHVHEHHFE-------QEISTG 417
              + P+T   + +AADS  +++ +         +IDKPI+V  H FE       +  S  
Sbjct: 415  LKTSPLTGA-TNSAADSATDQESSSLDARASKLHIDKPINVGAHPFETHQDDNIKYSSHL 473

Query: 418  EVTLDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVP 477
            E TLD+ YTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTL+DILSFCDFI+I P
Sbjct: 474  EQTLDVAYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLVDILSFCDFIAITP 533

Query: 478  INTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKL 537
            I+ IIFDNVSLT +MFKI+I S+V S V+EKLGLRNV+I++++WKLLCKF+L NK+++KL
Sbjct: 534  IHNIIFDNVSLTHDMFKIVICSLVTSPVVEKLGLRNVVINEQSWKLLCKFLLQNKTLIKL 593

Query: 538  DISQTKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKDL 597
            DISQTK RT+ ND  + YR  MDWELF  VL+ R G+PLEE+LLNG++F+ +    FK++
Sbjct: 594  DISQTKARTDLND--SNYRDQMDWELFCEVLRNREGRPLEELLLNGLRFDKMSFSHFKNI 651

Query: 598  LHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVG 657
            L +  +Q N  +  IR+G+A  + S +C   + NW+S  NVQGVDL++N+L +  K ++ 
Sbjct: 652  LLTF-AQMNPKN-PIRLGMANVEFSTECFDFLFNWMSEYNVQGVDLAYNNLESLAKRMIK 709

Query: 658  KLSSLTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYK 717
            KL+ L + +LEYFTLN+TNI+S  D++ ILKYL +LP++KFLDLSNLPQ++P +L   YK
Sbjct: 710  KLARLPYKHLEYFTLNSTNITSVDDMSYILKYLSRLPSIKFLDLSNLPQLFPGILTSGYK 769

Query: 718  YLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAAASDSSTNVV 777
            Y P+FPQLKRIHFD ++LS KE T++ +IL KC +L+HVS++   QSP   AS  S +  
Sbjct: 770  YFPQFPQLKRIHFDFDDLSIKETTMLVSILAKCETLSHVSLIG--QSPMPDASKISDSTD 827

Query: 778  GPE-------SQSQFARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNM 830
             P+        Q  F RN LWA+LYA  +DS NLV LD+DYD++P+EIQ RIALCLM NM
Sbjct: 828  EPDKSKDEKKEQIVFMRNTLWASLYAFVRDSHNLVSLDVDYDQVPDEIQSRIALCLMHNM 887

Query: 831  NRAMDSTFQLDELASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTXXXXXX 890
             R MDS+F+LDEL  QDDL+FDG+LITETAE+VL +LN        S  + DV       
Sbjct: 888  KRIMDSSFKLDELTVQDDLIFDGSLITETAEEVLKRLN------DKSLLQNDVGKKYLLK 941

Query: 891  XXXXXXHRVHFNTQHKIDCMFEKRNSGEXXXXXXXXXXXXXXXXXXXXXXMEILGALPQV 950
                   +VH N Q+ ID MFEKR SGE                      ++I  ++P +
Sbjct: 942  KYFEKMEKVHHNVQNTIDSMFEKRKSGELPLQEKENLLRLLLLEKNLSNILDIFASMPNI 1001

Query: 951  SSVLGSNKEDSMQPVYXXXXXXXXXXXXXXXXXXXXXXLKHXXXXXXXXXXXXTRPHLMA 1010
            + V+  +K D+  P                         +              RPHLMA
Sbjct: 1002 ADVVPFSKADNSFPNIGDSTVSANYNDGIRPSLKHLDSDRLINDVSIPENDSSIRPHLMA 1061

Query: 1011 TDSGRTVDVLTGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKS 1070
            TDSGR +DV TGK +LF + SS+TS+ GK+Q EEEGELHKWG FVQ Q S +     + +
Sbjct: 1062 TDSGRIIDVTTGKALLF-KSSSNTSLAGKRQEEEEGELHKWGVFVQHQSSRHNSGLPSSA 1120

Query: 1071 KETVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTELRKAIIKAKGIDS 1130
              +                                         G ELR AIIKAKGIDS
Sbjct: 1121 NSS-----RISGSLTPDSSVAGGKKGESSRTSGTRPKILPKIPTGAELRDAIIKAKGIDS 1175

Query: 1131 IDDLIQNVNQDEDELINIYG 1150
            +DDLI+NV  ++  L ++YG
Sbjct: 1176 VDDLIKNVTSEKVGLESLYG 1195

>Kwal_26.8687
          Length = 1088

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/1040 (43%), Positives = 597/1040 (57%), Gaps = 122/1040 (11%)

Query: 153  LNEKPKKSLLGSLFGRXX--------------XXXXXXXXXXXXXXXXXXXXXXXVASKL 198
            + EKPKKS+ G+LF R                                        AS L
Sbjct: 78   VTEKPKKSIFGTLFRRNSHGSGDRPSIPIPLPRARSTTNPSATHAPSTGAPAAHSTASGL 137

Query: 199  ---ISETLKEPNSPDVNMNSQSTIISTPLGDXXXXXXXXXXXXXXXXXXXNEKLLHSEEK 255
               +S+ LKEP+SP+V           P+ D                           + 
Sbjct: 138  NATVSQYLKEPSSPEVK-------DPAPIHDERQILNRNPH----------------RQS 174

Query: 256  LAIQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGIS--- 312
            L IQ L+   L+RVTFAVDKF  DP QQ+PSR PK+GNVLVP DM+   PSIS+GI+   
Sbjct: 175  LPIQSLAKTSLRRVTFAVDKFSTDPPQQIPSRKPKRGNVLVPQDMMCPTPSISVGITNTQ 234

Query: 313  ANTPQSTKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKA---- 368
             N  QS     F +NSKEY+LALE  R A++E+EKHQ+EAH+AA+RIA EV  FK     
Sbjct: 235  GNIEQSAS--PFDENSKEYKLALEEHRKALRESEKHQQEAHYAAQRIAHEVLKFKTRPLS 292

Query: 369  ------TSSEQKSSIPVTLLPSTTAADSELNEKINNIDKPIHVHEHHFEQEISTG----- 417
                  T+S   +++  +    TT A  +   K   IDKPIH+HEHHF+ + S+      
Sbjct: 293  GAPHQLTASSSNTNVESSAPSGTTNAAIDERAKNLEIDKPIHMHEHHFQDDTSSSAENGD 352

Query: 418  EVTLDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVP 477
            ++TLD +YTRCCHLREILPIPSTL+QVKGK+APLQTLKFLNP+PTLID+LSFCDFI+IVP
Sbjct: 353  KLTLDKIYTRCCHLREILPIPSTLKQVKGKSAPLQTLKFLNPRPTLIDVLSFCDFIAIVP 412

Query: 478  INTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKL 537
            I+ ++FDNVSLTSEM K +ISS+V S V+EK+G RNV+ + + W LLCKF++   S++KL
Sbjct: 413  IHNVVFDNVSLTSEMLKNVISSLVTSKVIEKVGFRNVVFNSDTWILLCKFLMRTSSLLKL 472

Query: 538  DISQTKIRTESNDLE-NIYRHNMDWELFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKD 596
            DISQTKI+    DLE N+YR NMDW+LF +VLQ R G+PLEE+L+NG+K  +     F  
Sbjct: 473  DISQTKIKP---DLEKNLYRANMDWDLFIDVLQRRSGRPLEELLINGVKIESF--DSFVS 527

Query: 597  LLHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLV 656
            LL++ ++   +T  G R+G+A S++S D LK +M+W+S   +QGVD++FND +  V+PLV
Sbjct: 528  LLNTFAA--GSTQNGKRLGIAQSELSADHLKFLMSWMSDFKIQGVDMAFNDFSELVRPLV 585

Query: 657  GKLSSLTFPNLEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMY 716
            GKLSSL F +L+YFTLNNTNI ++YD AL+L+ L +LPNL FLDLSNLPQ++P++ PY+ 
Sbjct: 586  GKLSSLPFQHLQYFTLNNTNIPTAYDAALLLRALSRLPNLYFLDLSNLPQVFPEIFPYLN 645

Query: 717  KYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAAASDSSTNV 776
            KYLPR   LKR+H D+N  + +E+ ++ ++L KC+ L H+S++               N+
Sbjct: 646  KYLPRMANLKRLHLDSNEFTSREVVMITSVLSKCNELLHLSLM---------------NI 690

Query: 777  VGPESQSQFARNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMDS 836
                 Q  F    + A LY   +    L  LD+ Y  IPEEI  RIA+CLMR M R    
Sbjct: 691  ----PQESFT-TGMCANLYDCVRQCSKLTNLDVTYAYIPEEISSRIAICLMRRMQR---- 741

Query: 837  TFQLDELASQDDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTXXXXXXXXXXXX 896
             F+LD+L +QDDLLFDGTL++ETAE+VL KLN   +  +      DVT            
Sbjct: 742  DFELDDLTNQDDLLFDGTLLSETAENVLEKLNNFEDLET------DVTRRYLLKKYWEKF 795

Query: 897  HRVHFNTQHKIDCMFEKRNSGEXXXXXXXXXXXXXXXXXXXXXXMEILGALPQVSSVLGS 956
            +RVH N Q  ID MFEKR++GE                      +++L + PQV+ V G 
Sbjct: 796  NRVHDNVQSTIDQMFEKRSAGELNLQSKENLLRLLFLENNLSHILDVLKSYPQVADVAG- 854

Query: 957  NKEDSMQPVYXXXXXXXXXXXXXXXXXXXXXXLKHXXXXXXXXXXXXTRPHLMATDSGRT 1016
                 ++P                        LK              RPHLMATDSGRT
Sbjct: 855  -----IEP--------------NARSAGSDHLLK--GITSEAENNSHVRPHLMATDSGRT 893

Query: 1017 VDVLTGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKSK-ETVN 1075
            +DV TG PVL  +  S  S+VGK+Q EEEGE HKWG+FVQQQ SIYP++    +  E   
Sbjct: 894  IDVTTGTPVLV-KTPSHVSLVGKRQEEEEGEFHKWGFFVQQQNSIYPDHHSRNTNDEPPE 952

Query: 1076 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTELRKAIIKAKGIDSIDDLI 1135
                                                   G ELR+A+++AKGIDSI++LI
Sbjct: 953  KRPGSAASSTESPKSSQPSAISQTASQAAAHALISKIPSGAELREAVMRAKGIDSIEELI 1012

Query: 1136 QNVNQDEDELINIYGKSVQP 1155
            +NVN +   L NIYG  + P
Sbjct: 1013 ENVNGNRVTLDNIYGVPLHP 1032

>ACR113W [1160] [Homologous to ScYOR227W - SH; ScYPL137C - SH]
            complement(550378..553686) [3309 bp, 1102 aa]
          Length = 1102

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/989 (43%), Positives = 563/989 (56%), Gaps = 103/989 (10%)

Query: 257  AIQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGISANTP 316
            ++Q LS ++L+RV FAVDKF  DP QQ+PSR P++GNVL+PD+++ EVP+IS GIS   P
Sbjct: 204  SLQLLSGVQLRRVAFAVDKFSTDPPQQIPSRRPRRGNVLIPDEILGEVPTISQGIS--NP 261

Query: 317  QS---TKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKATSSEQ 373
            +     K    +K+SKEY++ALEN R A+KE++KHQ+EAH AA R A+EVA FK   S  
Sbjct: 262  EGICGQKESQLTKDSKEYKIALENYRKALKESKKHQQEAHMAALRTANEVAAFKYKQSHS 321

Query: 374  KSSIPVTLLPSTTAADSELNEKINNIDKPIHVHEHHFEQEI------STGEVTLDIVYTR 427
            +      L+P     D     K   IDKP   +E  F+ E       S  E+TLD +YTR
Sbjct: 322  QRE----LVPEAAVDD---RAKHLEIDKPTQANETSFDGEDTECGDESGKELTLDQIYTR 374

Query: 428  CCHLREILPIPSTLRQVKGKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINTIIFDNVS 487
            CCHLREILPIPSTL+QVK KTAPL TLKFLNPKPTLID+LSFCDFI++VPI+ ++FDNV+
Sbjct: 375  CCHLREILPIPSTLKQVKNKTAPLHTLKFLNPKPTLIDLLSFCDFIAVVPIHNVVFDNVN 434

Query: 488  LTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDISQTKIRTE 547
            LT EMFKI+I+S+V ST LE+L +RNV+ D + W  LCKF+L+N+S++KLDISQTK+R  
Sbjct: 435  LTPEMFKIMITSLVNSTALERLSIRNVVTDADCWAALCKFILSNRSLIKLDISQTKVR-- 492

Query: 548  SNDL-ENIYRHNMDWELFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKDLLHSISSQRN 606
              DL   +YR NM+W LF  VLQ R   PLEE+LLNGI+F ++   IF  LLH+ + +  
Sbjct: 493  -QDLARTLYRSNMNWPLFIEVLQRRQHAPLEELLLNGIQFFDL--SIFNGLLHAFTLRPA 549

Query: 607  ATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVGKLSSLTFPN 666
            +     R+G+A S +  + LK + +W S  NVQG+DL+FN+L   VKP+V KL+++ F +
Sbjct: 550  SKK---RLGVAHSFLKEEHLKLLFDWASTYNVQGIDLAFNNLTDLVKPMVSKLTTMNFDH 606

Query: 667  LEYFTLNNTNISSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLK 726
            L YFTLN+T +    D AL L+ L KLPNL FLDLS+LP I+P++ P++ KYLPRFP LK
Sbjct: 607  LHYFTLNSTALGFC-DAALCLRALSKLPNLYFLDLSSLPAIFPEIFPFLNKYLPRFPFLK 665

Query: 727  RIHFDNNNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAAASDSSTNVVGPESQSQFA 786
            R+H D+N+     ++++  IL KC  L H+SML Q                 PES    +
Sbjct: 666  RLHLDSNDFMMDHISLLSQILQKCKELLHLSMLYQ-----------------PESSYGMS 708

Query: 787  RNNLWATLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMDSTFQLDELASQ 846
                 A LY    +SP L  LD+DY+ IPEEI  RIA+CL+RN  ++++  F+LDEL SQ
Sbjct: 709  ---ACAALYDFVANSPKLKNLDVDYEYIPEEISSRIAVCLIRNAQKSLNEDFELDELTSQ 765

Query: 847  DDLLFDGTLITETAEDVLTKLNKLNENTSASTDKKDVTXXXXXXXXXXXXHRVHFNTQHK 906
            DDLLFDG LIT+TA  +L+KL      TS+     D +            +RVH N Q  
Sbjct: 766  DDLLFDGELITKTAGGILSKL-----GTSSEKSNDDSSRRYLLKKYWQKINRVHTNVQST 820

Query: 907  IDCMFEKRNSGEXXXXXXXXXXXXXXXXXXXXXXMEILGALPQVSSVLGSNKEDSMQPVY 966
            ID +FEKR+  E                      +EIL    +V+S+L  N E    P  
Sbjct: 821  IDDLFEKRSKDELTLQGKENLLRLLFVENTLSKILEILADSQEVASLLDDNPEGISAPNL 880

Query: 967  XXXXXXXXXXXXXXXXXXXXXXLKHXXXXXXXXXXXXTRPHLMATDSGRTVDVLTGKPVL 1026
                                    +             RPH MATDSGRT+DV TG+PV+
Sbjct: 881  EAVDSSTLLMPATRLED------GYLDTQGISASTQVDRPHFMATDSGRTIDVTTGRPVV 934

Query: 1027 FRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPENEVTKSKETVNXXXXXXXXXXX 1086
             R+ SS TS+V KKQ EEEGELHKWGYFV Q+ S  P  +                    
Sbjct: 935  LRQ-SSQTSIVCKKQEEEEGELHKWGYFVAQKRSGLPLPQYVSEHPA------------- 980

Query: 1087 XXXXXXXXXXXXXXXXXXXXXXXXXXXXGTELRKAIIKAKGIDSIDDLIQNVNQDEDELI 1146
                                        G EL+ AIIKAKGI S++DLI NVN +   L 
Sbjct: 981  ------QSQPSQADNATDMRVIISKIPSGAELKAAIIKAKGIASMEDLIDNVNHNRVHLD 1034

Query: 1147 NIYGKSVQPKLNHPTGKLVEDDISSITRITPKTNTPAANGNTAPHITLGAKNVSVTTQEI 1206
            NIYG    P    P    V  D +S++  +    TP     +AP                
Sbjct: 1035 NIYGI---PYSTRP----VSADRASVSSQSRSVCTPNEEPVSAP---------------- 1071

Query: 1207 DTSEDNCEKNCEQITEAYDKLLNNLSIKR 1235
                D  E+  E + E YDKLLNNLS  R
Sbjct: 1072 -LPPDGHEELDEHVGETYDKLLNNLSRVR 1099

>KLLA0D07216g 614450..618286 weakly similar to sgd|S0006058
            Saccharomyces cerevisiae YPL137c, start by similarity
          Length = 1278

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/924 (45%), Positives = 556/924 (60%), Gaps = 115/924 (12%)

Query: 199  ISETLKEPNSPDVNMNSQSTIISTPLGDXXXXXXXXXXXXXXXXXXXNEKLLHSEEKLAI 258
            IS+ LKEPNSP+V                                  N+    S+  L I
Sbjct: 225  ISQFLKEPNSPEVK---------------------DMAPIQHDRVVLNKNPNKSKHPLPI 263

Query: 259  QKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMGISANTPQS 318
            ++L+ I LKRVTFAVD+F  DP QQ+PSR PK GNVLVP+DMIS++PSIS GI+     S
Sbjct: 264  KELTEINLKRVTFAVDEFGMDPPQQIPSRKPKLGNVLVPNDMISDIPSISQGITTTAQPS 323

Query: 319  TK---------TPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFK-- 367
            +            +++K+SKEY+LALEN +  +KE+EKHQ+EAH+AA+RIA EVA FK  
Sbjct: 324  SHGNDQHGALPASAYTKDSKEYQLALENHKKCLKESEKHQQEAHYAAQRIASEVAGFKLK 383

Query: 368  -ATSSEQKSSIPVTLLPSTTAADSELN--------EKINN--IDKPIHVHEHHFE----- 411
             +TS++ K S   T+  S  A D E N        EKI +  IDKPIH+HEHHF+     
Sbjct: 384  PSTSTDLKPSANGTVPKSGAATDDEANAEAGVVADEKIKSLEIDKPIHMHEHHFKESSGS 443

Query: 412  ------------------QEISTGEVTLDIVYTRCCHLREILPIPSTLRQVKGKTAPLQT 453
                              Q+ +  E+ LD+VYTRCCHLREILPIPSTLRQ+K K APLQT
Sbjct: 444  SNGTGSEHGANPSSTSGTQDENGNELMLDVVYTRCCHLREILPIPSTLRQLKEKKAPLQT 503

Query: 454  LKFLNPKPTLIDILSFCDFISIVPINTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRN 513
            LKFLNP+PTLIDILSF DFI+IVPI+ ++FDNV L+ EMFKI+ISS+VKS  LE+L +RN
Sbjct: 504  LKFLNPRPTLIDILSFSDFIAIVPIHNVVFDNVGLSPEMFKIVISSLVKSITLERLSMRN 563

Query: 514  VIIDKENWKLLCKFMLNNKSIVKLDISQTKIRTESNDLE-NIYRHNMDWELFANVLQYRL 572
            V+ D+  WKLLCKF++ NKS+ KLDISQTKIR   +DL+  ++R  MDW LF +VL  R 
Sbjct: 564  VVFDERGWKLLCKFLMRNKSLTKLDISQTKIR---HDLDLKLHRSQMDWSLFIDVLHKRQ 620

Query: 573  GKPLEEILLNGIKFNNIPVHIFKDLLHSISSQRNATSVGIRVGLATSDI-SLDCLKAVMN 631
            GKPLEE+LLNG+ F N  +H F++++++ SS +N  S   ++GLA S I S + L+ +  
Sbjct: 621  GKPLEELLLNGVSFAN-NLHTFENMINAFSSTKNEFSRKRKLGLAQSQIASSEQLEILFR 679

Query: 632  WISANNVQGVDLSFNDLAAFVKPLVGKLSSLTFPNLEYFTLNNTNISSSYDVALILKYLC 691
            W+S N++ GVDL+FND     KP++ +LS  +F +L+YFTLN+TNI S  + ALI++ L 
Sbjct: 680  WMSENDIIGVDLAFNDFENLTKPIIKELSQRSFDSLQYFTLNSTNIQSVQEAALIIRELS 739

Query: 692  KLPNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCH 751
            KLP L FLDLS LP ++P + PY+ KYLPRFP LKR+HFD+N  ++K++++V  IL KC 
Sbjct: 740  KLPKLYFLDLSGLPSLFPAIFPYLNKYLPRFPSLKRLHFDSNEWTYKDISLVTQILPKCK 799

Query: 752  SLAHVSMLSQLQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSPNLVGLDIDY 811
             L HVSM++Q Q   A ++                       LY   K+S  L+ LD +Y
Sbjct: 800  ELLHVSMMNQPQESWAMSAA--------------------VFLYDCIKNSDKLINLDFNY 839

Query: 812  DRIPEEIQQRIALCLMRNMNRAMDSTFQLDELASQDDLLFDGTLITETAEDVLTKLNKLN 871
            + IPEEI  RIA+ L+RN  +++DS +QLDEL+SQDDLLFDG LI+ETA ++L KLN   
Sbjct: 840  ENIPEEINSRIAIALVRNAQKSIDSNWQLDELSSQDDLLFDGELISETAGNILDKLN--- 896

Query: 872  ENTSASTDKKDVTXXXXXXXXXXXXHRVHFNTQHKIDCMFEKRNSGEXXXXXXXXXXXXX 931
                ++  ++D T            H +H N Q  ID MFE+R S E             
Sbjct: 897  ---DSAKLQEDSTKRYLLKRYWEKIHTIHANVQKTIDSMFEQRISKELSLQSKENLLRLI 953

Query: 932  XXXXXXXXXMEILGALPQVSSV-LGSNKED------SMQPVYXXXXXXXXXXXXXXX--- 981
                     +E L   P +  +    NK+D        +PV                   
Sbjct: 954  FMENTLGNILEYLSTNPYIQELNYAKNKDDDNYSSSDERPVLKHVDSERIMYAKPLVDPI 1013

Query: 982  XXXXXXXLKHXXXXXXXXXXXXTRPHLMATDSGRTVDVLTGKPVLFRRGSSSTSVVGKKQ 1041
                   L+H             +PHLMATDSGRT+DV TG+P+L  + SS  S+ GKKQ
Sbjct: 1014 DQDIDQELEH------EQDSNSAKPHLMATDSGRTIDVTTGRPIL-TKTSSQRSIFGKKQ 1066

Query: 1042 IEEEGELHKWGYFVQQQCSIYPEN 1065
             EEEGELHKWG+FVQQQ SIYPEN
Sbjct: 1067 EEEEGELHKWGFFVQQQRSIYPEN 1090

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 63/128 (49%), Gaps = 19/128 (14%)

Query: 1115 GTELRKAIIKAKGIDSIDDLIQNVNQDEDELINIYGKSVQPKLNHPTGKLVEDDISSITR 1174
            GTELR+AIIKAKGI+SI+DLI NVN  + +L NIYG  V+P  +                
Sbjct: 1167 GTELREAIIKAKGINSIEDLIDNVNCQQVKLDNIYGIQVEPPAD---------------- 1210

Query: 1175 ITPKTNTPAA--NGNTAPHITLGAKNVSVTTQEIDTS-EDNCEKNCEQITEAYDKLLNNL 1231
              P   +P    +GN +      A+     ++  D+  ED        + E YDKLLNNL
Sbjct: 1211 AKPLVLSPGGRPDGNVSHDERHSAQENGFPSESEDSYVEDETTTEQLNVDETYDKLLNNL 1270

Query: 1232 SIKRPGKA 1239
            S  R  + 
Sbjct: 1271 SRVRSNRG 1278

>CAGL0J04026g complement(376899..380495) similar to tr|Q12276
           Saccharomyces cerevisiae YOR227w or tr|Q03016
           Saccharomyces cerevisiae YPL137c, hypothetical start
          Length = 1198

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/704 (48%), Positives = 466/704 (66%), Gaps = 50/704 (7%)

Query: 251 HSEEKLAIQKLSSIKLKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDDMISEVPSISMG 310
            S +K +I+KL+ I LKRV+FA+DKF  +PAQQLPSR PK G+++VP+DMISE P IS+G
Sbjct: 218 QSRDKESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVG 277

Query: 311 I---SANTPQSTKTPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFK 367
           I   S N   S     +SK+S+EY++ LEN +   KE+E+ Q EAH  A+RIA+EV  ++
Sbjct: 278 ITTTSDNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYR 337

Query: 368 ATS-----SEQKSSIPVTLLPS------------TTAADSELNEKINNIDKPIHVHEHHF 410
             S     +   + +   L PS            T A DS + E    IDKPIH HE  F
Sbjct: 338 IRSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAEL--TIDKPIHAHETFF 395

Query: 411 EQE---ISTGEVT-------------LDIVYTRCCHLREILPIPSTLRQVKGKTAPLQTL 454
           E E    ST +V              LD+VYTRCCHLREILPIPSTLRQVKGKTAPLQTL
Sbjct: 396 ETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTL 455

Query: 455 KFLNPKPTLIDILSFCDFISIVPINTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNV 514
           KFLNPKPTLIDILSFCDFISI PI  ++FDNV+L S+M +I++SS++ S  +EKLG+RNV
Sbjct: 456 KFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNV 515

Query: 515 IIDKENWKLLCKFMLNNKSIVKLDISQTKIRTESNDL-ENIYRHNMDWELFANVLQYRLG 573
           ++  ++W++LCKF+L NKSI++LD+SQTKI+    DL    YRHNM+W+LF NVL+ R G
Sbjct: 516 VLSSKDWEMLCKFLLVNKSIIRLDLSQTKIKP---DLPAECYRHNMNWKLFCNVLRERTG 572

Query: 574 KPLEEILLNGIKFNNIPVHIFKDLLHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWI 633
           +PLEE+LLNG+ F+ +    ++DLL + +S+   +S   R+G+A +  S  C+  + + I
Sbjct: 573 RPLEELLLNGVHFDEMSFDDYQDLLLTFASKN--SSPNKRLGMAAASFSEKCMSFLFDVI 630

Query: 634 SANNVQGVDLSFNDLAAFVKPLVGKLSSLTFPNLEYFTLNNTNISSSYDVALILKYLCKL 693
           S  +VQGVDL FN+L  ++  ++ KLS+L + NLEYFTLN+++ S + ++  +LKYL +L
Sbjct: 631 SQFSVQGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYLSRL 690

Query: 694 PNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSL 753
           PNL+FLD+SN+P+++P V  Y+YKYLP FP L+RIHFD+N L++K+  ++C IL KC  L
Sbjct: 691 PNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKL 750

Query: 754 AHVSMLSQLQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSPNLVGLDIDYDR 813
           AHVSM ++L  P A       +    +S  +FA   L ATLY   +D   L+GLD+DY  
Sbjct: 751 AHVSMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTLLGLDVDYGD 810

Query: 814 IPEEIQQRIALCLMRNMNRAMDSTFQLDELASQDDLLFDGTLITETAEDVLTKLNKLNEN 873
           I +EIQ RIA+ LM NM + +DS F  DE+ SQDDLLFDG +I+E AE +L +L      
Sbjct: 811 ISDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRL------ 864

Query: 874 TSASTDKKDVTXXXXXXXXXXXXHRVHFNTQHKIDCMFEKRNSG 917
           TS   D+ D T              +H+  Q KID MFEKR +G
Sbjct: 865 TSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETG 908

 Score =  117 bits (292), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 119/235 (50%), Gaps = 48/235 (20%)

Query: 1006 PHLMATDSGRTVDVLTGKPVLFRRGSSSTSVVGKKQIEEEGELHKWGYFVQQQCSIYPEN 1065
            PH MAT+SG+ VD  TGK +L++  SSSTS++ KKQ  EEGE HKWG+FV Q+ +  P+ 
Sbjct: 1009 PHSMATESGKVVDATTGKALLYK-TSSSTSLLVKKQEHEEGEFHKWGFFVHQKGTTNPDT 1067

Query: 1066 EVTKS--KETVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTELRKAII 1123
            +  KS  ++T N                                       G ELR+AII
Sbjct: 1068 DDKKSGPEKTPN------------------VSENTNAPERVTVPKIQTVPSGNELREAII 1109

Query: 1124 KAKGIDSIDDLIQNVNQDEDELINIYGKSVQPKLNHPTGKLVEDDISSITRITPKTNTPA 1183
            KAKGIDSI+DLI+ V++D+  L  IYG+S++P    P   L   D+   +R   + NT A
Sbjct: 1110 KAKGIDSIEDLIKKVSKDDHGLKKIYGESLKP---FPI--LGAQDVDYTSRNASEGNTEA 1164

Query: 1184 ANGNTAPHITLGAKNVSVTTQEIDTSEDNCEKNCEQITEAYDKLLNNLSIKRPGK 1238
            +  +T+                 D+  D      E +TE YD+LLN++S KR  K
Sbjct: 1165 SGRSTS----------------TDSKTD------ELVTEKYDELLNSISQKRTSK 1197

>KLLA0E11847g complement(1044591..1048385) some similarities with
            sp|P43638 Saccharomyces cerevisiae YJL042w MHP1
            microtubule-associated protein, hypothetical start
          Length = 1264

 Score =  249 bits (637), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 188/643 (29%), Positives = 312/643 (48%), Gaps = 123/643 (19%)

Query: 266  LKRVTFAVDKFEADPAQQLPSRTPKQGNV------------LVPDDMISEVPSISMGISA 313
            LKRV FA + +  DP QQ+ SR P++G V            L P++    +   S GI  
Sbjct: 435  LKRVAFAANTYFNDPPQQICSRNPRKGEVEVKADGSVVIHRLTPEEKREILEKSSCGIVV 494

Query: 314  NTPQSTK-----TPSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVANFKA 368
                  K      P+ S +        +N+  A+K    H ++ H A++R   E+A  +A
Sbjct: 495  GGTGQLKLINQDAPATSPD--------QNEGAALK---LHAEDDH-ASQRRHIELAAAEA 542

Query: 369  TSSEQKSSIPVTLLPSTTAADSELNEKINN------IDKPIHVHEHHFEQEISTG----- 417
             +  +    P+ L  + T  + E+   +NN      IDKP+          +++      
Sbjct: 543  AAEARAKDAPLDLQRTVTNNEEEVG--VNNTLEKVTIDKPMTSRRKGSSTSLASMISSDS 600

Query: 418  -----------------EVTLDIVYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNP 459
                             ++  D+VYTRCCHLREILPIP+T++Q+K G T P+  L+  NP
Sbjct: 601  ALVPSEDENELLPPRNIKIPHDVVYTRCCHLREILPIPATMKQLKKGSTEPIPFLQLRNP 660

Query: 460  KPTLIDILSFCDFISIVPINTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKE 519
            KP+ +++LSF DF+SI P+  +  D VSL+ EM +II+SS+      EKL LRN  +D +
Sbjct: 661  KPSKVEVLSFSDFLSIAPVLCLSLDGVSLSVEMLRIILSSITYKDKFEKLSLRNTPVDHD 720

Query: 520  NWKLLCKFMLNNKSIVKLDISQ--------TKIRTESN---------DLENIYRHNMDWE 562
             WK+L  F+   KS+  LD++          K    SN         ++EN  R +M+W 
Sbjct: 721  GWKVLSYFVSKCKSLNSLDVTMIPGLALNVQKPSKSSNGSTVPRMVCNMEN--RSDMNWS 778

Query: 563  LFANVLQYRLGKPLEEILLNGIKFNNIPVHIFKDLLHSISSQRNATSVGIRVGLATSDIS 622
            L +  +  + G  LEE++++G   N + +  F D+         A +  +R+GLA ++++
Sbjct: 779  LLSAAVAAKGG--LEEMIVSGAFMNQVQLQNFIDI---------AWTKTLRLGLAYNNLT 827

Query: 623  LDCLKAVMNWISANNVQGVDLSFNDLAAFVKPLVGKLSSLTFPN---LEYFTLNNTNI-- 677
            L+  + +  W++ + +QGVD+ +NDL   + P +  +   T       ++ +LN+TN+  
Sbjct: 828  LEQCQCLATWMTNSKIQGVDVGYNDLNGKLGPFISAVIEKTKKGKNVFKFLSLNSTNLSV 887

Query: 678  -----SSSYDVALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDN 732
                 S   +V  +L  LC   +LKFLDLSN P ++P  +  +   LP F  L R+H DN
Sbjct: 888  PKGAKSEDNEVLSLLNGLCYCDSLKFLDLSNNPGLFPYGMRTLTAILPVFVSLLRLHLDN 947

Query: 733  NNLSFKELTVVCNILLKCHSLAHVSMLSQLQSPTAAASDSSTNVVGPESQSQFARNNLWA 792
            NNLS   +     +L  C  + ++S+L              TN+               +
Sbjct: 948  NNLSTTAVMQFAEVLPMCQRINYISLL-------------GTNL----------NIISAS 984

Query: 793  TLYALAKDSPNLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMD 835
             L A  K+S  ++ +DIDY  +P+ I+++I++  MRN  R ++
Sbjct: 985  ALAAAVKNSKTIITMDIDYAHVPDRIKEKISVYSMRNTQRELE 1027

>YJL042W (MHP1) [2870] chr10 (361165..365361) Microtubule-interacting
            protein, functions in stabilization of microtubules [4197
            bp, 1398 aa]
          Length = 1398

 Score =  243 bits (620), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 152/441 (34%), Positives = 239/441 (54%), Gaps = 70/441 (15%)

Query: 422  DIVYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINT 480
            DIVYTRCCHLREILPIP+TL+Q+K G T P+  L+  NP+P++++I SF DF+SI P+  
Sbjct: 639  DIVYTRCCHLREILPIPATLKQLKKGSTDPIPILQLRNPRPSMVEIWSFSDFLSIAPVLC 698

Query: 481  IIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDIS 540
            +  D V LT +M +II+SS+V     +KL LRN  +D+E WK+LC F+   KS+  +D++
Sbjct: 699  LSLDGVQLTVQMLRIILSSLVYKQHFQKLSLRNTPLDEEGWKVLCYFVSKAKSLHSIDLT 758

Query: 541  QTK------------------IRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLN 582
                                 +R + N LEN  R +M+W+L    +    G  LEEI+++
Sbjct: 759  MVPSIKTNVQKPSKSSLKSKILRMQCN-LEN--RSDMNWDLLTASIALMGG--LEEIVIS 813

Query: 583  GIKFNNIPVHIFKDLLHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVD 642
            G K N+     F  L+  I+++        R+GLA + +S      +  W+  + V G+D
Sbjct: 814  GAKMNSAQFKNFI-LVACIATE--------RLGLAYNGLSKSQCDDLAKWMVQSKVTGLD 864

Query: 643  LSFND----LAAFVKPLVGKLSSLTFPNL-EYFTLNNTNIS-------SSYDVALILKYL 690
            + FND    L++F   ++GK+      N+ ++ +LN TN+         + +V  ++  L
Sbjct: 865  VGFNDLNGKLSSFTDAVLGKIQKANEKNVFKFLSLNGTNLRVNEHDTFENNEVLKLISVL 924

Query: 691  CKLPNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKC 750
            C L NLKFLD+SN P I+P  +P +  +LP F  L R+H D NNLS   + ++  IL  C
Sbjct: 925  CYLENLKFLDISNNPAIFPHCVPTLIDFLPVFVNLVRLHIDYNNLSSTSVVMLAEILPMC 984

Query: 751  HSLAHVSML-SQLQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSPNLVGLDI 809
              L + SML ++L   ++ A                        L    + S +L+ LD+
Sbjct: 985  SRLNYFSMLGTELDLASSKA------------------------LAEAVRKSSSLMTLDV 1020

Query: 810  DYDRIPEEIQQRIALCLMRNM 830
            DY  +PE I+++I+L  +RN+
Sbjct: 1021 DYVYMPENIKEKISLYALRNI 1041

>Kwal_23.5488
          Length = 1112

 Score =  241 bits (616), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 146/442 (33%), Positives = 234/442 (52%), Gaps = 64/442 (14%)

Query: 422 DIVYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINT 480
           D+VYTRCCHLREILPIP+TL+Q+K G T P+  L+  NPKP+LI++LSF DF+ I P+  
Sbjct: 572 DLVYTRCCHLREILPIPATLKQLKKGSTDPIPLLQMRNPKPSLIEVLSFSDFLGITPVLC 631

Query: 481 IIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDI- 539
           +  D V+L++ M +II+ S++     EKL LRN  +D E WK+LC F+   KS+  +D+ 
Sbjct: 632 LSLDGVNLSAGMLRIILCSLMNKKQFEKLSLRNTPLDHEGWKILCYFISQCKSLNSIDLT 691

Query: 540 --------------SQTKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLNGIK 585
                         S  + R          R  M+W L    L    G  LEEI+++G K
Sbjct: 692 MVPGISINVQKPSKSSQRSRVVRMTCSMTDRKEMNWNLLVASLISVEG--LEEIIISGAK 749

Query: 586 FNNIPVHIFKDLLHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSF 645
            +   +  FKD L     Q   T   +R+GLA ++++ +    +  W++ +NV G+D+ F
Sbjct: 750 MS---LKEFKDFL-----QLGCTKT-LRLGLAYNELTTEQCNVLAGWLAHSNVTGIDIGF 800

Query: 646 ND----LAAFVKPLVGKLSSLTFPNLEYFTLNNTNISSSYDVA-------LILKYLCKLP 694
           ND    L AF   ++ +  S +    +YF+L++TN+  S D          ++  LC   
Sbjct: 801 NDLRGKLGAFASGIIDRTKS-SRNVFKYFSLSSTNLEVSEDSTPENDDFLKLISVLCYCE 859

Query: 695 NLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLA 754
           +LK LD+SN P+++P V  ++  Y+P F  L R+H DNNN+    +  +  +L  C  L+
Sbjct: 860 DLKLLDISNNPKLFPYVTSHLTNYMPVFVNLLRLHMDNNNIPAPSVVALAEVLPMCQKLS 919

Query: 755 HVSML-SQLQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSPNLVGLDIDYDR 813
           HVSM  ++L   T  A                        L A  + S +L+ +D+D + 
Sbjct: 920 HVSMRGTKLDYATGCA------------------------LAAAMRQSSSLLTIDLDAEN 955

Query: 814 IPEEIQQRIALCLMRNMNRAMD 835
           +P +I+ +++L  M+NM + ++
Sbjct: 956 LPNKIKDKMSLYSMKNMEKTLN 977

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 266 LKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDD 299
            ++V+FA + +  DP QQ+ S+ P++G V V  D
Sbjct: 389 FRKVSFATNTYFNDPPQQICSKNPRRGEVEVKPD 422

>CAGL0J00803g complement(83483..87427) similar to sp|P43638
           Saccharomyces cerevisiae YJL042w MHP1, hypothetical
           start
          Length = 1314

 Score =  241 bits (616), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 191/633 (30%), Positives = 310/633 (48%), Gaps = 96/633 (15%)

Query: 265 KLKRVTFAVDKFEADPAQQLPSRTPKQGNV------------LVPDDMISEVPSISMGIS 312
           +LK V FA   +  DP QQ+ S+ P++G V            L P++    + + S GI 
Sbjct: 327 QLKHVAFATTTYFNDPPQQICSKNPRKGEVEVKPNGSVIIHRLTPEERKKIMETSSAGIV 386

Query: 313 ANTPQSTKT-------PSFSKNSKEYRLALENQRFAIKEAEKHQKEAHFAAKRIADEVAN 365
                  K         S  ++S++  +A+  +  A +    ++KE      ++A  +  
Sbjct: 387 VGGSGQLKVLNPIEQQSSDDEDSQKRNIAIAAEEAAAEARGNNKKEEDIEVSKLASHLTI 446

Query: 366 FKATSSEQKSSIPV-TLLPSTTAADSELNEKINNIDKPIHVHEHHF---EQEISTG---E 418
            K   S +    P+ T   S+  +     E  N  D+     E      E+EI      +
Sbjct: 447 DKPMVSRRPRENPIRTSSSSSLLSILSDEENKNGTDQSPKGSESDSGTDEEEIYPPPNLK 506

Query: 419 VTLDIVYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLIDILSFCDFISIVP 477
           +  D+VYTRCCHLREILPIP+TL+Q+K G T P+  L+  NP+P+L++I SF DF+SI P
Sbjct: 507 IPHDVVYTRCCHLREILPIPATLKQIKKGSTDPIPLLQLRNPRPSLLEIWSFSDFLSISP 566

Query: 478 INTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFML-NNKSIVK 536
           +  +  D VSLT EM +II+SS+V +  LEKL +RN  ++++ WK+L  F+    K+ V 
Sbjct: 567 VLCVSLDGVSLTEEMLRIILSSLVSNPHLEKLTMRNTPLNEDGWKILSYFITKQKKNFVA 626

Query: 537 LDI-------------SQTKIRTESNDLENIYR-----HN---MDWELFANVLQYRLGKP 575
           LD+             S++ +   +N+   + R     HN   M+W+L    +  + G  
Sbjct: 627 LDLTMVPTIKTNVQKPSKSSLAKNANNPNLLKRMECNTHNRSDMNWDLLTAAVATKEGG- 685

Query: 576 LEEILLNGIKFNNIPVHIFKDLLHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWISA 635
           +EE +L G   +      F +L         A +   R+GLA + ++++  K +  WI  
Sbjct: 686 IEEFVLAGACMSYTQFKNFIEL---------ACTNTDRLGLAYNKLTMEQCKVLAEWIVT 736

Query: 636 NNVQGVDLSFNDL----AAFVKPLVGKLSSLTFPN-LEYFTLNNTNISSSYD-------V 683
           +N++G+DL FNDL    + F   +  K+ ++   N ++Y +LN+TN+S   D       V
Sbjct: 737 SNIRGLDLGFNDLKGKTSVFTDAVANKVQNVGEKNEMKYISLNSTNLSVEADTTPENNEV 796

Query: 684 ALILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVV 743
             +L  LC   NLKFLDLSN P+I+P  +  +   LP +  L R+H D N+L    + V+
Sbjct: 797 LRLLSVLCYSENLKFLDLSNNPKIFPHCIKTLTTSLPVYVNLIRLHLDYNDLDCASIVVL 856

Query: 744 CNILLKCHSLAHVSML-SQLQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSP 802
              L  C  L H+S+L S+L   +A A   + N                         S 
Sbjct: 857 AESLPLCSKLHHLSLLGSKLNLASAKALTEAVN------------------------KSN 892

Query: 803 NLVGLDIDYDRIPEEIQQRIALCLMRNMNRAMD 835
            L+ LD++Y+ +PE I++R++L  MRN+   +D
Sbjct: 893 TLMTLDLEYNTVPESIKERMSLYTMRNIQNELD 925

>Scas_690.33
          Length = 1423

 Score =  240 bits (612), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 152/445 (34%), Positives = 242/445 (54%), Gaps = 70/445 (15%)

Query: 418  EVTLDIVYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLIDILSFCDFISIV 476
            ++  D+VYTRCCHLREILPIP+TL+Q+K G T P+  L+  NP+P++++I SF DF+SI 
Sbjct: 661  KIPYDVVYTRCCHLREILPIPATLKQLKPGSTDPIPLLQLRNPRPSMVEIWSFSDFLSIA 720

Query: 477  PINTIIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVK 536
            P++ +  D VSLT +M K++++S+     LEK+ LRN  +D E WKLLC F+  ++S+V 
Sbjct: 721  PVSCLSLDGVSLTVDMLKVLLASLSAKRNLEKISLRNTPLDDEGWKLLCYFISKSRSLVS 780

Query: 537  LDISQ-----------TKIRTESN------DLENIYRHNMDWELFANVLQYRLGKPLEEI 579
            +D++            +K   +SN      DL+N  + N  W L A  +  + G  LEE+
Sbjct: 781  IDLTMVPHIKTNVQKPSKSSLKSNIIRMECDLDNRTKRN--WNLLAGSIAMKGG--LEEL 836

Query: 580  LLNGIKFNNIPVHIFKDLLH--SISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANN 637
            +++G+K +   ++ FK+ +    IS++        R+GLA +++S +    +  W+  + 
Sbjct: 837  VVSGVKMS---LNHFKNFIEVACISTE--------RLGLAYNNLSKEQCDILAKWLVKSK 885

Query: 638  VQGVDLSFNDLAA----FVKPLVGKLSSLTFPNL-EYFTLNNTNI-------SSSYDVAL 685
            V G+DL FNDL      F   +  K+ S    N+ +Y +LN+T++       S + +V  
Sbjct: 886  VTGLDLGFNDLRGKLTTFSDAVWQKIQSNEVKNVFKYLSLNDTSLEVEEGATSETNEVLR 945

Query: 686  ILKYLCKLPNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCN 745
            +L  LC   +LKFLDLSN P+ +P  L  + K LP F  L RIH DN  L+   + ++  
Sbjct: 946  LLSILCYSEDLKFLDLSNNPKCFPHCLDTLVKCLPVFVNLVRIHLDNEQLTSTNIIMLAE 1005

Query: 746  ILLKCHSLAHVSMLSQLQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSPNLV 805
             L  C  L H SML    +P   AS                       L    + S +L+
Sbjct: 1006 ALPLCSRLIHFSMLG---TPLDLAS--------------------CKALAEAFRRSTSLL 1042

Query: 806  GLDIDYDRIPEEIQQRIALCLMRNM 830
             LD++Y  +P+ I+++I +  MRNM
Sbjct: 1043 TLDVNYVYMPDNIKEKITMYSMRNM 1067

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 266 LKRVTFAVDKFEADPAQQLPSRTPKQGNVLV 296
           LK V+F+ + +  DP QQ+ S+ P++G V V
Sbjct: 455 LKHVSFSTNTYFNDPPQQICSKNPRKGEVEV 485

>ACR059W [1107] [Homologous to ScYJL042W (MHP1) - SH]
           complement(459751..463401) [3651 bp, 1216 aa]
          Length = 1216

 Score =  193 bits (491), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 132/444 (29%), Positives = 223/444 (50%), Gaps = 68/444 (15%)

Query: 422 DIVYTRCCHLREILPIPSTLRQVK-GKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINT 480
           D++YTRCC+LREILPIP+ L+Q+K G + P+  L+  NPKP++I+ILS  DF+SI P+  
Sbjct: 475 DMLYTRCCYLREILPIPAMLKQLKPGSSDPIPLLQLRNPKPSMIEILSLGDFLSIAPVLC 534

Query: 481 IIFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNNKSIVKLDIS 540
              D VSL+ +M  II+SS+     LEKL +RN  +D+E WK L  F+ ++K++  LD++
Sbjct: 535 FSMDGVSLSVQMLHIILSSLRCMGRLEKLSMRNTPLDEEGWKTLAYFISSSKTLRGLDLT 594

Query: 541 -----------------QTKIRTESNDLENIYRHNMDWELFANVLQYRLGKPLEEILLNG 583
                            Q  I     DL +  R   +W LF   +   +   LEE++++G
Sbjct: 595 MIPGIPLNVQKPSKSSGQCSIPRMKCDLTS--RAEQNWNLFTAAIA--INGNLEELIISG 650

Query: 584 IKFNNIPVHIFKDL-LHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVD 642
            K +     I  D+  HS+           R+GLA +D+S    +A+ +W+    V G+D
Sbjct: 651 AKISLGQFKILLDIGCHSLE----------RLGLAFNDLSHGHCEALASWLPGCKVTGLD 700

Query: 643 LSFNDLAAFVKPLVGKL---SSLTFPNLEYFTLNNTNIS-------SSYDVALILKYLCK 692
           + FN L   ++PL   L   S +   ++   +LN+T+++        + DV  +L  L  
Sbjct: 701 IGFNPLNGKMRPLAEALMRKSKVGNNSIACISLNSTDLAIPPNATVETSDVVALLSALGY 760

Query: 693 LPNLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHS 752
             NLKFL LSN P ++   +  +   LP      R+  D NNLS   +  +  +L  C +
Sbjct: 761 CENLKFLPLSNNPNMFIYGMKPLTDILPVLVGFARLQLDYNNLSSTSIITLAEVLPMCTT 820

Query: 753 LAHVSML-SQLQSPTAAASDSSTNVVGPESQSQFARNNLWATLYALAKDSPNLVGLDIDY 811
           + ++S++ S+L + + AA                        L    K S +L  +D D+
Sbjct: 821 IGYLSLVGSKLDTSSGAA------------------------LVLALKKSGSLFTIDADF 856

Query: 812 DRIPEEIQQRIALCLMRNMNRAMD 835
             +P+ I+  +++  ++N+   ++
Sbjct: 857 SEMPDAIRHDVSIYSLKNLENVLE 880

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 266 LKRVTFAVDKFEADPAQQLPSRTPKQGNVLVPDD 299
           LKRV+FA + +   P QQ+ SR P++G V V  D
Sbjct: 335 LKRVSFARNTYFNSPPQQICSRNPRKGEVEVKAD 368

>Kwal_33.14989
          Length = 1214

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 48/193 (24%), Positives = 84/193 (43%), Gaps = 30/193 (15%)

Query: 475  IVPINTI---IFDNVSLTSEMFKIIISSVVKSTVLEKLGLRNVIIDKENWKLLCKFMLNN 531
            IVP NT    IF N S      ++I+SS       +K   +N+II+++  +    F  ++
Sbjct: 921  IVPANTGASSIFTNDSD-----ELILSSNNALFNPDKKSFKNLIINRKKMEETADFKQDD 975

Query: 532  KSIVKLDISQTKIRTESNDLENIYR-HNMDWELFANVLQYRLGKPLEEILLNGIKFNNIP 590
              ++++  S      E+ + +N+ +  N D  +F  V    L    ++  L G+   +  
Sbjct: 976  DQVLRITFSSDGDSVETGERQNVTKITNADTPVFDGVQDTPL---RKDNKLEGLYKKSAS 1032

Query: 591  VHIFKDLLHSISSQRNATSVGIRVGLATSDISLDCLKAVMNWISANNVQGVDLSFNDLAA 650
              + K++L S +         I+     SD S D  K  M  I      G D+SF D   
Sbjct: 1033 TPLSKNVLSSST---------IK---GASDTSKDINKRSMGSI------GDDISFTDDGY 1074

Query: 651  FVKPLVGKLSSLT 663
            ++ P +  LSS+T
Sbjct: 1075 YMTPSLETLSSMT 1087

>KLLA0F05401g 529272..532355 gi|29420855|dbj|BAC66649.1
           Kluyveromyces lactis vacuolar membrane ATPase subunit a
           precursor, start by similarity
          Length = 1027

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 6/45 (13%)

Query: 605 RNATSVGIRVGLA------TSDISLDCLKAVMNWISANNVQGVDL 643
           R A S+GIRV         T  +S D LK+V NW S +N++ VD+
Sbjct: 607 RLARSLGIRVSGKKQNQEYTLTLSGDALKSVSNWTSTSNIEKVDV 651

>CAGL0K00363g complement(37452..41135) similar to sp|P12866
           Saccharomyces cerevisiae YKL209c STE6, hypothetical
           start
          Length = 1227

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 69/168 (41%), Gaps = 21/168 (12%)

Query: 339 RFAIKEAEKHQKEAHFAAKRIADEVANFKATSSEQKSSIPVTLLPSTTAADSELNEKIN- 397
           ++  K  EK   E+  AA+R+A  + N +           +++     A  +E   K + 
Sbjct: 195 KYIHKYTEKENTESECAAERLAWMLKNIEFVRLHNGDDFEISMYTHYIAQANEYYIKASL 254

Query: 398 ----------NIDKPIHVHEHHFEQE-ISTGEVTLDIVYT--RCCHLREILPIPSTLRQV 444
                      +   + V    F    I  G++ +D V T   CC +   + I S L Q 
Sbjct: 255 FISANISILRLLSLLMFVQGFWFGSSMIKQGKLNIDSVITSFHCCLMLGSI-INSALGQA 313

Query: 445 ----KGKTAPLQTLKFLNPKPTLIDILSFCDFISIVPINTIIFDNVSL 488
               KG  A  + LK ++  P   + L+F D IS + +  I+F+NVS 
Sbjct: 314 VVLQKGDVAMKRLLKMIDRTPR--ESLAFIDAISGIDLLPIVFNNVSF 359

>Scas_578.8
          Length = 1297

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 65/157 (41%), Gaps = 5/157 (3%)

Query: 636  NNVQGVDLSFNDLAAFVKPLVGKLSSLTFPNLEYFTLNNTNISSSYDVALILKYLCK-LP 694
            N VQG +  F      V+  V   +S+T PN  Y  +++T+ +S+ D    L  L   LP
Sbjct: 895  NQVQGSN-QFVPQDENVQGYVQSTNSMTLPNGSY--MHSTSENSALDDRFSLGSLTSALP 951

Query: 695  NLKFLDLSNLPQIYPDVLPYMYKYLPRFPQLKRIHFDNNNLSFKELTVVCNILLKCHSLA 754
             +    L   P I P+  P+       FP ++      +  S  +  V    L   H+  
Sbjct: 952  GMPTHQLPGPPGIVPNA-PFGMPSWNNFPNMQDSAVQQSFPSNNQPAVPSLGLPNNHTNQ 1010

Query: 755  HVSMLSQLQSPTAAASDSSTNVVGPESQSQFARNNLW 791
              S+  +LQS T   S +  +       + F +N+LW
Sbjct: 1011 RKSLADELQSLTTMLSSAGLDDSNFSPPATFQQNSLW 1047

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.314    0.131    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 33,336,676
Number of extensions: 1354146
Number of successful extensions: 4034
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4090
Number of HSP's successfully gapped: 65
Length of query: 1239
Length of database: 16,596,109
Length adjustment: 113
Effective length of query: 1126
Effective length of database: 12,684,275
Effective search space: 14282493650
Effective search space used: 14282493650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)