Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.47*61613041e-38
YOR045W (TOM6)61612034e-23
Kwal_55.2160657611894e-21
ACR080C58611564e-16
Sklu_2129.3141953590.68
YOR372C (NDD1)55457525.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.47*
         (61 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.47*                                                          121   1e-38
YOR045W (TOM6) [4856] chr15 (413851..414036) Mitochondrial integ...    83   4e-23
Kwal_55.21606                                                          77   4e-21
ACR080C [1127] [Homologous to ScYOR045W (TOM6) - SH] (503127..50...    65   4e-16
Sklu_2129.3 YIL115C, Contig c2129 2430-6689 reverse complement         27   0.68 
YOR372C (NDD1) [5147] chr15 complement(1034803..1036467) Protein...    25   5.3  

>Scas_699.47*
          Length = 61

 Score =  121 bits (304), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 61/61 (100%), Positives = 61/61 (100%)

Query: 1  MSAMFGMPGLGATGGAPTKPKSRFEQFRETPVFTVLLNGTLFVAGVAFIQSPLMDMLAPQ 60
          MSAMFGMPGLGATGGAPTKPKSRFEQFRETPVFTVLLNGTLFVAGVAFIQSPLMDMLAPQ
Sbjct: 1  MSAMFGMPGLGATGGAPTKPKSRFEQFRETPVFTVLLNGTLFVAGVAFIQSPLMDMLAPQ 60

Query: 61 L 61
          L
Sbjct: 61 L 61

>YOR045W (TOM6) [4856] chr15 (413851..414036) Mitochondrial
          integral outer membrane protein associated with the
          protein translocation complex and the general import
          complex [186 bp, 61 aa]
          Length = 61

 Score = 82.8 bits (203), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 40/61 (65%), Positives = 48/61 (78%)

Query: 1  MSAMFGMPGLGATGGAPTKPKSRFEQFRETPVFTVLLNGTLFVAGVAFIQSPLMDMLAPQ 60
          M  MF MPG  A   +P +PKSRF+ F+E+P++T+ LNG  FVAGVAFIQSPLMDMLAPQ
Sbjct: 1  MDGMFAMPGAAAGAASPQQPKSRFQAFKESPLYTIALNGAFFVAGVAFIQSPLMDMLAPQ 60

Query: 61 L 61
          L
Sbjct: 61 L 61

>Kwal_55.21606
          Length = 57

 Score = 77.4 bits (189), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 46/61 (75%), Gaps = 4/61 (6%)

Query: 1  MSAMFGMPGLGATGGAPTKPKSRFEQFRETPVFTVLLNGTLFVAGVAFIQSPLMDMLAPQ 60
          MSA F  PG     GAP K  SRFEQFR+TP F V++N  LFVAGVAFIQSPLM+M+APQ
Sbjct: 1  MSARFTAPG----AGAPAKKASRFEQFRQTPAFPVIVNLGLFVAGVAFIQSPLMEMMAPQ 56

Query: 61 L 61
          L
Sbjct: 57 L 57

>ACR080C [1127] [Homologous to ScYOR045W (TOM6) - SH]
          (503127..503303) [177 bp, 58 aa]
          Length = 58

 Score = 64.7 bits (156), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 3/61 (4%)

Query: 1  MSAMFGMPGLGATGGAPTKPKSRFEQFRETPVFTVLLNGTLFVAGVAFIQSPLMDMLAPQ 60
          M+  +G+PG GA+  AP K +S F+QFR++P + V++N  LF  GVAF+QS LMDM+APQ
Sbjct: 1  MNGAYGIPGAGAS--APKK-QSMFQQFRDSPAYPVVVNLALFGVGVAFVQSSLMDMMAPQ 57

Query: 61 L 61
          L
Sbjct: 58 L 58

>Sklu_2129.3 YIL115C, Contig c2129 2430-6689 reverse complement
          Length = 1419

 Score = 27.3 bits (59), Expect = 0.68,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 8   PGLGATGGAPTKPKSRFEQFRETPVFTVLLNGTLFVAGVAFIQSPLMDMLAPQ 60
           PGLGA+G AP    +  ++ +    F    NG    A V   QSP  ++ + Q
Sbjct: 645 PGLGASGSAPFGSFNPSQKDKTDSPFAAFANGKSPFAQVNSGQSPFAEIGSKQ 697

>YOR372C (NDD1) [5147] chr15 complement(1034803..1036467) Protein
           required for nuclear division, positively but indirectly
           affects transcription of a subset of genes required for
           the cell cycle [1665 bp, 554 aa]
          Length = 554

 Score = 24.6 bits (52), Expect = 5.3,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 23/57 (40%), Gaps = 9/57 (15%)

Query: 1   MSAMFGMPGLGATGGAPTKPKSRFEQFRETPVFTVLLN--GTLFVAGVAFIQSPLMD 55
           M+ MF  P        PT P  RF     TP    +LN  GT +   +    S L+D
Sbjct: 243 MNLMFNQP-------LPTSPSKRFSSLSLTPYGRKILNDVGTPYAKALISSNSALVD 292

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.324    0.139    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 1,902,677
Number of extensions: 56797
Number of successful extensions: 152
Number of sequences better than 10.0: 7
Number of HSP's gapped: 152
Number of HSP's successfully gapped: 7
Length of query: 61
Length of database: 16,596,109
Length adjustment: 34
Effective length of query: 27
Effective length of database: 15,419,097
Effective search space: 416315619
Effective search space used: 416315619
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 54 (25.4 bits)