Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.46d1881888441e-117
CAGL0L09999g134701596e-14
YOR044W1571641397e-11
YDR275W (BSC2)23563840.005
ACR081C9655710.073
YIL048W (NEO1)115131607.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.46d
         (188 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.46d                                                          329   e-117
CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416 S...    66   6e-14
YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of unkno...    58   7e-11
YDR275W (BSC2) [1105] chr4 (1012244..1012951) Protein of unknown...    37   0.005
ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678) [...    32   0.073
YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the Drs2p-...    28   7.4  

>Scas_699.46d
          Length = 188

 Score =  329 bits (844), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 165/188 (87%), Positives = 165/188 (87%)

Query: 1   MLESIENLFILAFCTMFRVFQYCCYIGIVILLIPFVGFYSFDLFLYIYRLLQYFIECLIY 60
           MLESIENLFILAFCTMFRVFQYCCYIGIVILLIPFVGFYSFDLFLYIYRLLQYFIECLIY
Sbjct: 1   MLESIENLFILAFCTMFRVFQYCCYIGIVILLIPFVGFYSFDLFLYIYRLLQYFIECLIY 60

Query: 61  KRNQNKRLGKEETPMPLEKTSSENPHPFRELLIXXXXXXXXXXXXXXXXXXXXXXXDGVG 120
           KRNQNKRLGKEETPMPLEKTSSENPHPFRELLI                       DGVG
Sbjct: 61  KRNQNKRLGKEETPMPLEKTSSENPHPFRELLIKKSETNQQQQQRSSSNQDKNSSKDGVG 120

Query: 121 NSLHFNSVMLSKLRANLTRFISERLVDLGLDSSIDHYGIEKHSKREEIREVSTGRLVEPY 180
           NSLHFNSVMLSKLRANLTRFISERLVDLGLDSSIDHYGIEKHSKREEIREVSTGRLVEPY
Sbjct: 121 NSLHFNSVMLSKLRANLTRFISERLVDLGLDSSIDHYGIEKHSKREEIREVSTGRLVEPY 180

Query: 181 EMKSVSAG 188
           EMKSVSAG
Sbjct: 181 EMKSVSAG 188

>CAGL0L09999g 1072123..1072527 some similarities with tr|Q08416
          Saccharomyces cerevisiae YOR044w, start by similarity
          Length = 134

 Score = 65.9 bits (159), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%)

Query: 5  IENLFILAFCTMFRVFQYCCYIGIVILLIPFVGFYSFDLFLYIYRLLQYFIECLIYKRNQ 64
          +++  +L F +   V QY CY  + +LLIPF+G Y+FDLFLY+YRL+ Y +  + Y++  
Sbjct: 2  VKDYLLLLFRSFVLVVQYSCYAAVALLLIPFLGLYAFDLFLYVYRLVDYSVRLITYRKKL 61

Query: 65 NKRLGKEETP 74
            R  +  T 
Sbjct: 62 TNREQQASTS 71

>YOR044W (YOR044W) [4855] chr15 (413006..413479) Protein of unknown
           function [474 bp, 157 aa]
          Length = 157

 Score = 58.2 bits (139), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 47/164 (28%), Positives = 73/164 (44%), Gaps = 32/164 (19%)

Query: 1   MLESIENLFILAFCTMFRVFQYCCYIGIVILLIPFVGFYSFDLFLYIYRLLQYFIECLIY 60
           M+E++E + +L   ++    QY C   I  LLIPF+G Y+FDLFLY+YR++ Y  +   Y
Sbjct: 1   MIEALEIVLLLVIQSL----QYICRTCIAFLLIPFLGLYAFDLFLYVYRMILYLSQMFNY 56

Query: 61  KRNQNKRLGKEETPMPLEKTSSENPHPFRELLIXXXXXXXXXXXXXXXXXXXXXXXDGVG 120
           KR    +LG+ +T        +  PH  R   I                         +G
Sbjct: 57  KR----KLGRSKT--------NNRPHSPRLHKIYSSGDCMDTL---------------IG 89

Query: 121 NSLHFNSVMLSKLRANLTRFISERL-VDLGLDSSIDHYGIEKHS 163
                   +LS + ++  RF S R     G++S+ID   +E  S
Sbjct: 90  QVRDLRVFLLSTIHSHSKRFFSTRFQTKSGINSAIDANDVETTS 133

>YDR275W (BSC2) [1105] chr4 (1012244..1012951) Protein of unknown
           function [708 bp, 235 aa]
          Length = 235

 Score = 37.0 bits (84), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 16  MFRVFQYCCYIGIVILLIPFVGFYSFDLFLYIYRLLQYFIECLIYKRNQ-NKRLGKEETP 74
           MF +FQ  C +G+++LL+P +   + DLFLY+ RLL Y  +   Y R+      GKE+T 
Sbjct: 67  MFGIFQLMCSLGVIVLLLPIIILDAIDLFLYMCRLLDYGCKLFHYNRSSLPVADGKEKTS 126

Query: 75  MPL 77
            P+
Sbjct: 127 GPI 129

>ACR081C [1128] [Homologous to ScYOR044W - SH] (503388..503678)
          [291 bp, 96 aa]
          Length = 96

 Score = 32.0 bits (71), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 24 CYIGIVILLIPFVGFYSFDLFLYIYRLLQYFI-----ECLIYKRNQNKRLGKEET 73
          C +   +LL P V  Y++D  LY+ RL +  +       L   R   +RL K+ET
Sbjct: 26 CKVLAWLLLGPLVAVYAYDFCLYVLRLARSLVLRPRTRALCNPRWLRRRLTKDET 80

>YIL048W (NEO1) [2619] chr9 (261436..264891) Member of the
           Drs2p-like ATPases family in the superfamily of P-type
           ATPases, overproduction confers neomycin resistance
           [3456 bp, 1151 aa]
          Length = 1151

 Score = 27.7 bits (60), Expect = 7.4,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 18/31 (58%)

Query: 24  CYIGIVILLIPFVGFYSFDLFLYIYRLLQYF 54
           C   + ILL+ F GF++ D ++ I R L  F
Sbjct: 421 CVFALSILLVAFAGFHNDDWYIDILRYLILF 451

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.327    0.144    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 5,028,263
Number of extensions: 180941
Number of successful extensions: 702
Number of sequences better than 10.0: 6
Number of HSP's gapped: 701
Number of HSP's successfully gapped: 6
Length of query: 188
Length of database: 16,596,109
Length adjustment: 96
Effective length of query: 92
Effective length of database: 13,272,781
Effective search space: 1221095852
Effective search space used: 1221095852
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 58 (26.9 bits)