Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.4651251221310.0
YOR043W (WHI2)48651512961e-175
Kwal_55.2160044251210441e-138
KLLA0F15972g4585159481e-123
ACR082C4225129131e-119
Scas_615.84473427034e-87
Sklu_1533.11922024429e-52
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.46
         (512 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.46                                                           825   0.0  
YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in...   503   e-175
Kwal_55.21600                                                         406   e-138
KLLA0F15972g complement(1481761..1483137) similar to sp|P12611 S...   369   e-123
ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH] (503954..50...   356   e-119
Scas_615.8                                                            275   4e-87
Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement         174   9e-52

>Scas_699.46
          Length = 512

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/512 (82%), Positives = 421/512 (82%)

Query: 1   MQNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60
           MQNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ
Sbjct: 1   MQNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60

Query: 61  XXXXXXXXXXXXXXXGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120
                          GVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL
Sbjct: 61  LMSLPESLLLCLFPSGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120

Query: 121 NYPVEKYFDKASNHKLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHDLLHQKP 180
           NYPVEKYFDKASNHKLI                                  EHDLLHQKP
Sbjct: 121 NYPVEKYFDKASNHKLINSAKGFFGFGSSNSLSNVNSNTSSGTAASTTTTSEHDLLHQKP 180

Query: 181 AIIVLREDLDYYCVPQETFQFAKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGLF 240
           AIIVLREDLDYYCVPQETFQFAKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGLF
Sbjct: 181 AIIVLREDLDYYCVPQETFQFAKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGLF 240

Query: 241 SSNRLKDSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQESGK 300
           SSNRLKDSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQESGK
Sbjct: 241 SSNRLKDSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQESGK 300

Query: 301 TVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNSIVP 360
           TVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNSIVP
Sbjct: 301 TVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNSIVP 360

Query: 361 XXXXXXXXXXXXXXXXXXXXGPRESRKKNRLATLADNVXXXXXXXXXXXXXXXXXXXXXX 420
                               GPRESRKKNRLATLADNV                      
Sbjct: 361 SRSSTSVNIASNSNSSSKQSGPRESRKKNRLATLADNVRSHSTSRNSSLTRLRSSKSLEL 420

Query: 421 PKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLPHED 480
           PKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLPHED
Sbjct: 421 PKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLPHED 480

Query: 481 KDIEQQLNKIRIPVRLHIRRVWTLELSVVGVQ 512
           KDIEQQLNKIRIPVRLHIRRVWTLELSVVGVQ
Sbjct: 481 KDIEQQLNKIRIPVRLHIRRVWTLELSVVGVQ 512

>YOR043W (WHI2) [4854] chr15 (410869..412329) Protein involved in
           growth regulation and stress response [1461 bp, 486 aa]
          Length = 486

 Score =  503 bits (1296), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 275/515 (53%), Positives = 333/515 (64%), Gaps = 32/515 (6%)

Query: 1   MQNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60
           M +IITQV  +N+ +    P+    Q       + N+++ GDSLIHLNIQENHYFITRDQ
Sbjct: 1   MDDIITQVSPDNAESA---PILQEQQQQQNSQYEGNEEDYGDSLIHLNIQENHYFITRDQ 57

Query: 61  XXXXXXXXXXXXXXXGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120
                          GVFLDR GQVI+NL+ DDEVYIVNFPPDCFEYIME+YTKA DDL 
Sbjct: 58  LMSLPESLLLCLFPSGVFLDRCGQVITNLTRDDEVYIVNFPPDCFEYIMEIYTKAHDDLY 117

Query: 121 NYPVEKYFDKASNHKLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHDLLHQKP 180
           N+PVEK+FD+ S+  +                                   E D+LHQKP
Sbjct: 118 NHPVEKFFDRPSSSFV----------------SNAKGFFGLSSNNSISSNNEQDILHQKP 161

Query: 181 AIIVLREDLDYYCVPQETFQF-AKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGL 239
           AIIVLREDLDYYCVPQE FQF + NE  ENN+DLL +FMAQVK+AAGSYLT KTSIF+GL
Sbjct: 162 AIIVLREDLDYYCVPQEEFQFDSTNE--ENNEDLLRHFMAQVKMAAGSYLTSKTSIFQGL 219

Query: 240 FSSNRLKDSHR--KTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQE 297
           +SSNRLK   +  K  + +N  ++ KS  +KLGPAEQHLMDMLCSSGF   + WGNRTQE
Sbjct: 220 YSSNRLKQQQQQQKIEKGSNSSSNTKSTSKKLGPAEQHLMDMLCSSGFTKETCWGNRTQE 279

Query: 298 SGKTVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNS 357
           +GKTVISSL+LCRLANE+T+ FR  ++ AK KWE EH  +QD         +Q+N + NS
Sbjct: 280 TGKTVISSLSLCRLANETTEGFRQKFNEAKAKWEAEHKPSQDNF----ITPMQSNISINS 335

Query: 358 IVPXXXXXXXXXXXXXXXXXXXXGPRESRKKNRLATLADNVXXXXXXXXXXXXXXXXXXX 417
           +                           ++K+RL+ LADNV                   
Sbjct: 336 LSASKSNSTISTARNLTSGSTAPATARDKRKSRLSKLADNV---RSHSSSRHSSQTRSKP 392

Query: 418 XXXPKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLP 477
              PKLYDLVPKP+INAKLLLFWRKPARKCWWGEEDIE+E+E++G W D+ KKII+L LP
Sbjct: 393 PELPKLYDLVPKPNINAKLLLFWRKPARKCWWGEEDIELEVEVFGSWKDESKKIIELILP 452

Query: 478 HEDKDIEQQLNKIRIPVRLHIRRVWTLELSVVGVQ 512
             + D E +L+KI +PVRLHIRRVWTLELSV+GVQ
Sbjct: 453 -TNVDPEAELHKIIVPVRLHIRRVWTLELSVIGVQ 486

>Kwal_55.21600
          Length = 442

 Score =  406 bits (1044), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 227/512 (44%), Positives = 295/512 (57%), Gaps = 70/512 (13%)

Query: 1   MQNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60
           MQ++ITQV     +   G      +QN  F D+DS        LIHLNIQENHY+ITRDQ
Sbjct: 1   MQSVITQV-----SADQGPIPVMQEQNQEFLDDDS--------LIHLNIQENHYYITRDQ 47

Query: 61  XXXXXXXXXXXXXXXGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120
                          GVF++R+GQVI+NL+  DEVYI NFPP CFEYIME Y +AQ+DLL
Sbjct: 48  LMSLPESLLLCLFPSGVFMNRTGQVITNLTSQDEVYIGNFPPACFEYIMENYVRAQEDLL 107

Query: 121 NYPVEKYFDKASNHKLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHDLLHQKP 180
           N+PV++ FD+  +                                      E ++LH+KP
Sbjct: 108 NFPVDEIFDRGLSSP--------------KEQSRFFGFPSSHSSMQNSSGGEAEILHEKP 153

Query: 181 AIIVLREDLDYYCVPQETFQFAKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGLF 240
           +IIVLREDLDYYCVPQ    +  +   E  ++LL  FMA+VK+AAGSYL+++TS+F+GL 
Sbjct: 154 SIIVLREDLDYYCVPQMKLAYPPDTPQELRNELLDNFMAEVKLAAGSYLSQQTSVFQGLC 213

Query: 241 SSNRLKDSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQESGK 300
           SSNRLK            KNS+   +QKLGPAEQHLMDMLCSSGF D S WGNR QE GK
Sbjct: 214 SSNRLKRPQ---------KNSNGENKQKLGPAEQHLMDMLCSSGFHDSSTWGNRAQEPGK 264

Query: 301 TVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNSIVP 360
           TVISSL+LCRLANE+TQ+FRD    AK K E E    +   D   S++ + + ++ S  P
Sbjct: 265 TVISSLSLCRLANETTQDFRDKVDAAKRKHEDELKSLRGAQDSTYSLTPKGSRSSPSAQP 324

Query: 361 XXXXXXXXXXXXXXXXXXXXGPRESRKKNRLATLADNVXXXXXXXXXXXXXXXXXXXXXX 420
                                  + ++K+RL++LADNV                      
Sbjct: 325 -----------------------DPKRKSRLSSLADNV---RSRSASRNRSSSRQRVDQA 358

Query: 421 PKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLPHED 480
           P LY+LVP+PDIN+KLLLFW+KPARKCWWGEED  +E+++YG       +++  Q     
Sbjct: 359 PTLYELVPRPDINSKLLLFWKKPARKCWWGEEDTSLELKLYGELDSSTGELVLRQ----- 413

Query: 481 KDIEQQLNKIRIPVRLHIRRVWTLELSVVGVQ 512
                 +  + +PV+LHIRRVWTLELS+VGV+
Sbjct: 414 ---SGPVVSLSVPVKLHIRRVWTLELSIVGVE 442

>KLLA0F15972g complement(1481761..1483137) similar to sp|P12611
           Saccharomyces cerevisiae YOR043w WHI2 growth regulation
           protein singleton, start by similarity
          Length = 458

 Score =  369 bits (948), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/515 (41%), Positives = 288/515 (55%), Gaps = 69/515 (13%)

Query: 2   QNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQX 61
           Q+IITQV  +    +         Q+ S+ D +  ++E  D+LIHLNIQE HY+ITR Q 
Sbjct: 9   QSIITQVTPDGGGASG----ALLGQDGSYIDYEQYNEE--DTLIHLNIQEKHYYITRTQL 62

Query: 62  XXXXXXXXXXXXXXGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLLN 121
                         GVF+DR GQ+I+NL+PDDEVYI NF  +CFEYIM+VY +A  D LN
Sbjct: 63  MSLPESLLLCLFPSGVFMDRDGQIITNLTPDDEVYIPNFSTECFEYIMDVYNQAHTDYLN 122

Query: 122 YPVEKYFDKASNHKLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHDLLHQKPA 181
           +PV + F++   +                                     E ++LH+KP 
Sbjct: 123 FPVNEIFNRKGTNG---------------SSSGGNNFFNFGSSNNSSSSQESEILHEKPG 167

Query: 182 IIVLREDLDYYCVPQETFQFAKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGLFS 241
           IIVLREDLDYYCVPQ + ++ +  S    ++LLH  M Q+K+AAGS+L K+TS+F GL S
Sbjct: 168 IIVLREDLDYYCVPQVSVEYPEGSSDMEKEELLHNLMVQIKLAAGSHLLKQTSVFLGLKS 227

Query: 242 SNRLKDSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQESGKT 301
           SNR K    K++Q +  K+S  +   KLG AEQHLMDMLCSSGF   S+WGNR+QE  KT
Sbjct: 228 SNRAKKP-TKSNQVDGTKSSTGTV--KLGSAEQHLMDMLCSSGFKTESVWGNRSQEMDKT 284

Query: 302 VISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNSIVPX 361
           VISSL+LCRLANE+TQEFRD    AK K++          DD  S++    N T+S    
Sbjct: 285 VISSLSLCRLANETTQEFRDAVAVAKAKYD----------DDQKSIASTMTNDTSS---- 330

Query: 362 XXXXXXXXXXXXXXXXXXXGPRESR----KKNRLATLADNVXXXXXXXXXXXXXXXXXXX 417
                               P  SR    +K+RL+  ++NV                   
Sbjct: 331 ---------------NMKLTPTPSRTDVKRKSRLSVFSENV---RSRSRSRNRSASRQRA 372

Query: 418 XXXPKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLP 477
              P LY+LVPKPDIN KLLLFW+KPARKCWWG+E +++E++    + +    I     P
Sbjct: 373 NESPTLYELVPKPDINTKLLLFWKKPARKCWWGQELVDLEVDFPAIFENDTLTI----FP 428

Query: 478 HEDKDIEQQLNKIRIPVRLHIRRVWTLELSVVGVQ 512
              K     + K+++PV++HIRRVWTLELSV+G+Q
Sbjct: 429 DNSK-----IQKLKVPVKIHIRRVWTLELSVIGIQ 458

>ACR082C [1129] [Homologous to ScYOR043W (WHI2) - SH]
           (503954..505222) [1269 bp, 422 aa]
          Length = 422

 Score =  356 bits (913), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/512 (41%), Positives = 273/512 (53%), Gaps = 95/512 (18%)

Query: 2   QNIITQV-PENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60
           Q+IITQV PE       G+ L +      +YD ++        LIHLNIQ  HY+ITR+Q
Sbjct: 5   QSIITQVSPEQQ---LGGSQLMTEQIEPDYYDENT--------LIHLNIQGRHYYITREQ 53

Query: 61  XXXXXXXXXXXXXXXGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120
                          GVF++R GQVI+NL+P+DEVYI NFPP CFE IME YT AQ DL 
Sbjct: 54  LMSLPESLLLCFFPSGVFMNREGQVITNLTPEDEVYIANFPPKCFESIMETYTTAQRDLE 113

Query: 121 NYPVEKYFDKASNHKLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHDLLHQKP 180
           N+PV ++  +A +                                      E  +LH+KP
Sbjct: 114 NFPVGEFGRRAPH--------------------AGPKGFLGLTPSQSQPMSESQILHEKP 153

Query: 181 AIIVLREDLDYYCVPQETFQFAKNESFENNDDLLHYFMAQVKIAAGSYLTKKTSIFEGLF 240
           AIIVLREDLDYYCVP  +    ++ S E  D LL   MAQVK AAGS+L ++ S+F+GL+
Sbjct: 154 AIIVLREDLDYYCVPSVSLAL-EDGSREGQDILLEQLMAQVKNAAGSHLCQQRSVFKGLY 212

Query: 241 SSNRLKDSHRKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRSIWGNRTQESGK 300
           SSNR++            +   + +  +LGPAEQHLMDMLC+SGF + S WGNR+QE GK
Sbjct: 213 SSNRVR------------RPDAQHQPDQLGPAEQHLMDMLCASGFREHSDWGNRSQEPGK 260

Query: 301 TVISSLALCRLANESTQEFRDMYHRAKTKWELEHNVNQDQIDDVSSVSLQNNNTTNSIVP 360
           TVISSL+LCRL NE+ QEFRD    A+ +++ +H V  D      S              
Sbjct: 261 TVISSLSLCRLMNETVQEFRDQVAAARRRYDEDH-VTPDAASAPPS-------------- 305

Query: 361 XXXXXXXXXXXXXXXXXXXXGPRESRKKNRLATLADNVXXXXXXXXXXXXXXXXXXXXXX 420
                                 R+ ++K+RL+T  DNV                      
Sbjct: 306 ----------------------RDQKRKSRLSTFTDNV-----RSRSSSRTRSSSRAPRE 338

Query: 421 PKLYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGHWVDQEKKIIKLQLPHED 480
           P LYDLVP+P+IN KLLLFW+KPARKCWWG E I V++++ GH+ D E   + L      
Sbjct: 339 PSLYDLVPRPEINTKLLLFWKKPARKCWWGLETITVDVQLNGHY-DSESGTLVLSR---- 393

Query: 481 KDIEQQLNKIRIPVRLHIRRVWTLELSVVGVQ 512
                 L  + IPV LHIRRVWTLELSVVG+Q
Sbjct: 394 ---NSPLCVLTIPVNLHIRRVWTLELSVVGMQ 422

>Scas_615.8
          Length = 447

 Score =  275 bits (703), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 159/342 (46%), Positives = 200/342 (58%), Gaps = 48/342 (14%)

Query: 1   MQNIITQVPENNSTTTTGNPLTSSDQNTSFYDNDSNDKENGDSLIHLNIQENHYFITRDQ 60
           M+NIITQVP+N +      P    +Q +     D ++ +NG+SL+HLNIQENHYF+TRDQ
Sbjct: 1   MENIITQVPQNGAV-----PNGFINQ-SGLEQEDLSNYDNGNSLVHLNIQENHYFLTRDQ 54

Query: 61  XXXXXXXXXXXXXXXGVFLDRSGQVISNLSPDDEVYIVNFPPDCFEYIMEVYTKAQDDLL 120
                          GVFLDR+ QVI+NL+ +DEV+I NFP  CFEYIME Y KA DDLL
Sbjct: 55  LMTLPESLLLCLFPSGVFLDRADQVITNLTAEDEVFITNFPATCFEYIMEFYMKANDDLL 114

Query: 121 NYPVEKYFDK---ASNHKLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEHD-LL 176
           N+PV + F     A+NH                                     E D +L
Sbjct: 115 NFPVLEQFPSIRNANNHT-------------------------RYQHPQTQQQFEQDAIL 149

Query: 177 HQKPAIIVLREDLDYYCVPQETFQFAKNESFEN------NDDLLHYFMAQVKIAAGSYLT 230
           H+ P+IIVLREDLDYYCVPQ  F+F               DDLL + M+Q+K+AAGSYL 
Sbjct: 150 HENPSIIVLREDLDYYCVPQLEFEFEPLPEGRPPLDQYMKDDLLQHCMSQLKVAAGSYLL 209

Query: 231 KKTSIFEGLFSSNRLKDSH-RKTSQRNNGKNSHKSRRQKLGPAEQHLMDMLCSSGFGDRS 289
            +TSIF+GL+ SN++      +     +GK+S       LGPAEQHLMDMLCSSGF   S
Sbjct: 210 NQTSIFQGLYLSNKIHQHEVSQVPLHGSGKSS------TLGPAEQHLMDMLCSSGFLPES 263

Query: 290 IWGNRTQESGKTVISSLALCRLANESTQEFRDMYHRAKTKWE 331
            WGNRTQE GKT+ISSL+LCRL NEST++FR+   R    W+
Sbjct: 264 QWGNRTQEFGKTIISSLSLCRLYNESTEDFRNAVTREMKNWK 305

 Score =  110 bits (275), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 67/94 (71%), Gaps = 4/94 (4%)

Query: 423 LYDLVPKPDINAKLLLFWRKPARKCWWGEEDIEVEIEIYGH-WVDQEKKIIKLQLPHEDK 481
           +Y LVPKP IN KLLLFWRKPARK WW  E++E+E+EIYG          + L++P E+ 
Sbjct: 354 VYKLVPKPTINNKLLLFWRKPARKSWWSAENVELEVEIYGSIVNVNGVNKVVLRVPQENA 413

Query: 482 ---DIEQQLNKIRIPVRLHIRRVWTLELSVVGVQ 512
              D E   N ++IP++LHIRRVWTLELSVVG+Q
Sbjct: 414 NANDNEFVTNTVKIPIKLHIRRVWTLELSVVGIQ 447

>Sklu_1533.1 YOR043W, Contig c1533 830-1408 reverse complement
          Length = 192

 Score =  174 bits (442), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 98/202 (48%), Positives = 117/202 (57%), Gaps = 21/202 (10%)

Query: 35  SNDKENGDSLIHLNIQENHYFITRDQXXXXXXXXXXXXXXXGVFLDRSGQVISNLSPDDE 94
           S +  + DSLIHLNIQENHY+ITRD                GVF+DR GQVI+NL+ DDE
Sbjct: 5   SQEYSDDDSLIHLNIQENHYYITRDHLMSLPESLLLCLFPSGVFMDRMGQVITNLTSDDE 64

Query: 95  VYIVNFPPDCFEYIMEVYTKAQDDLLNYPVEKYFDKASNHKLIXXXXXXXXXXXXXXXXX 154
           VYI NFPPDCFEYIME Y+ AQ+DL+ Y  ++ F+K  N K                   
Sbjct: 65  VYIGNFPPDCFEYIMETYSAAQEDLVKYTFDETFNKNPNDK------------------E 106

Query: 155 XXXXXXXXXXXXXXXXXEHDLLHQKPAIIVLREDLDYYCVPQETFQFAKNESFENNDDLL 214
                            E D+LH+KP+IIVLREDLDYYCV Q    FA   S E  D LL
Sbjct: 107 HGRFFGFSCSSAPSSSNEADILHEKPSIIVLREDLDYYCVRQPEVTFA---SEEEKDTLL 163

Query: 215 HYFMAQVKIAAGSYLTKKTSIF 236
            + MA+VKIAAGSYL+ + SIF
Sbjct: 164 THLMAEVKIAAGSYLSNQCSIF 185

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.316    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 15,574,076
Number of extensions: 646200
Number of successful extensions: 2958
Number of sequences better than 10.0: 20
Number of HSP's gapped: 2972
Number of HSP's successfully gapped: 28
Length of query: 512
Length of database: 16,596,109
Length adjustment: 106
Effective length of query: 406
Effective length of database: 12,926,601
Effective search space: 5248200006
Effective search space used: 5248200006
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)