Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.4545045020610.0
YOR042W (CUE5)4113628061e-103
CAGL0L09933g4083587293e-92
Kwal_55.215874644105001e-57
KLLA0F15994g4273894367e-49
ACR083C3753483154e-32
YDR273W (DON1)365561634e-12
Scas_615.8d581681102e-05
CAGL0M08580g19772930.001
Scas_626.847548655.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.45
         (450 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.45                                                           798   0.0  
YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing ...   315   e-103
CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces...   285   3e-92
Kwal_55.21587                                                         197   1e-57
KLLA0F15994g complement(1484383..1485666) weakly similar to sgd|...   172   7e-49
ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -...   125   4e-32
YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the p...    67   4e-12
Scas_615.8d                                                            47   2e-05
CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08...    40   0.001
Scas_626.8                                                             30   5.3  

>Scas_699.45
          Length = 450

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/450 (90%), Positives = 406/450 (90%)

Query: 1   MSEETNTDIKEKVPVEDLEATSNNEETKQSETNANEDTDKDSLVEVSEEATKIQXXXXXX 60
           MSEETNTDIKEKVPVEDLEATSNNEETKQSETNANEDTDKDSLVEVSEEATKIQ      
Sbjct: 1   MSEETNTDIKEKVPVEDLEATSNNEETKQSETNANEDTDKDSLVEVSEEATKIQLEDNTE 60

Query: 61  XXXXXXXXXXXXXXVQKETNEDDATNDKNEEDEGPPLPTRRKTEPEAEESENPILKQLKE 120
                         VQKETNEDDATNDKNEEDEGPPLPTRRKTEPEAEESENPILKQLKE
Sbjct: 61  LEEKEEKKDEPSSEVQKETNEDDATNDKNEEDEGPPLPTRRKTEPEAEESENPILKQLKE 120

Query: 121 AFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAANATPALPQRRK 180
           AFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAANATPALPQRRK
Sbjct: 121 AFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAANATPALPQRRK 180

Query: 181 LTQLEQDALLARQLNEEYNKAHDPPRGAVRDNGXXXXXXXXXXXXXANXXXXXXXXXXXS 240
           LTQLEQDALLARQLNEEYNKAHDPPRGAVRDNG             AN           S
Sbjct: 181 LTQLEQDALLARQLNEEYNKAHDPPRGAVRDNGRRTRPQQQRRQRTANDDDLDFSQEDDS 240

Query: 241 WAQFVEKDLPDITARAKGSLQETAMKVGSWFSKNVIGEEDPNQPQPQGMNNRNGNSDFTD 300
           WAQFVEKDLPDITARAKGSLQETAMKVGSWFSKNVIGEEDPNQPQPQGMNNRNGNSDFTD
Sbjct: 241 WAQFVEKDLPDITARAKGSLQETAMKVGSWFSKNVIGEEDPNQPQPQGMNNRNGNSDFTD 300

Query: 301 EQIKQQQKEWSYYQKQKKGPENPERRRFNSFGAQVGEDSLESHGIALHDNENLSDEDEDV 360
           EQIKQQQKEWSYYQKQKKGPENPERRRFNSFGAQVGEDSLESHGIALHDNENLSDEDEDV
Sbjct: 301 EQIKQQQKEWSYYQKQKKGPENPERRRFNSFGAQVGEDSLESHGIALHDNENLSDEDEDV 360

Query: 361 PPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFIDTPEGSAKPKWQPVAPEPLNG 420
           PPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFIDTPEGSAKPKWQPVAPEPLNG
Sbjct: 361 PPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFIDTPEGSAKPKWQPVAPEPLNG 420

Query: 421 TPTKINASGQAKIKNPDEDEDFLINSDDEL 450
           TPTKINASGQAKIKNPDEDEDFLINSDDEL
Sbjct: 421 TPTKINASGQAKIKNPDEDEDFLINSDDEL 450

>YOR042W (CUE5) [4853] chr15 (408424..409659) Protein containing a
           CUE domain, has low similarity to uncharacterized C.
           albicans Orf6.1738p [1236 bp, 411 aa]
          Length = 411

 Score =  315 bits (806), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 224/362 (61%), Gaps = 39/362 (10%)

Query: 95  PPLPTRRKTEPEAEESENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDP 154
           PPLP RRK+E E  + ENPIL++LK+AFPN+EEKY+K V+IASQG L PAF ALLFLSDP
Sbjct: 83  PPLPARRKSEEEPSK-ENPILQELKDAFPNLEEKYIKAVIIASQGVLSPAFNALLFLSDP 141

Query: 155 NSSKDIELPTKPIAANATPALPQRRKLTQLEQDALLARQLNEEYNKAHDPPRGAVRDNGX 214
            S KDIELPT+P+  N  P  P RR+ TQLEQD LLARQL+E++N +H   R   R    
Sbjct: 142 ESGKDIELPTQPVRKN--PEAPARRRQTQLEQDELLARQLDEQFNSSHSRRRNRDRATRS 199

Query: 215 XXXXXXXXXXXXANXXXXXXXXXXXSWAQFVEKDLPDITARAKGSLQETAMKVGSWFSKN 274
                                    SW+QFVEKDLP++T RA  SLQ+TA KV +W S  
Sbjct: 200 MHEQRRRRHNPNEREQHHEDSEEEDSWSQFVEKDLPELTDRAGRSLQDTANKVSNWISDA 259

Query: 275 VIGEEDPNQPQPQGMNNRNGNSDFTDEQIKQQQKEW-----SYYQKQKKG-PENPERRRF 328
                          N  +GN    ++   Q Q+EW        Q  K   P+ PERRRF
Sbjct: 260 Y------------RRNFASGNEQNDNQHGHQDQQEWEPEIVDLSQGGKNSRPQQPERRRF 307

Query: 329 NSFGAQVGEDSLESHGIALHDNENLSDEDEDVPPQLPTREKSVDSNTQNDETNATATPKD 388
           NSFG QVG+DSLESHGI LH NE+  ++DEDVPPQLPTR KS +S               
Sbjct: 308 NSFGVQVGDDSLESHGITLH-NEDGFEDDEDVPPQLPTRTKSGEST-------------- 352

Query: 389 KAKVVAQTTFIDTPEGSAKPKWQPVAPEPLNGTPTKINASGQAKIKNPDEDEDFLINSDD 448
             KVVA+TT+IDTP+   K KWQP+ PEPL+ TPTK+NA  + K KNPDEDE FLINSDD
Sbjct: 353 -GKVVAETTYIDTPDTETKKKWQPLPPEPLDTTPTKVNAVSRNK-KNPDEDE-FLINSDD 409

Query: 449 EL 450
           E+
Sbjct: 410 EM 411

>CAGL0L09933g 1067488..1068714 similar to tr|Q08412 Saccharomyces
           cerevisiae YOR042w, hypothetical start
          Length = 408

 Score =  285 bits (729), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 227/358 (63%), Gaps = 43/358 (12%)

Query: 111 ENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAAN 170
           ENP+L QLKEAFPNIEE+YVK V+IASQGALDPAF ALLFLSDP S KDIELP +P+  N
Sbjct: 76  ENPLLLQLKEAFPNIEEQYVKAVIIASQGALDPAFNALLFLSDPESGKDIELPREPVQQN 135

Query: 171 ATPALPQRRKLTQLEQDALLARQLNEEYNKAHDPPRGAVRDNGXXXXXXXXXXXXXANXX 230
             P+LP RRK TQLEQD +LARQL++EYN+     RG  R +               +  
Sbjct: 136 --PSLPPRRKQTQLEQDEMLARQLDKEYNRKR---RGERRHHNEREAGRNYERYNNDDLE 190

Query: 231 XXXXXXXXXSWAQFVEKDLPDITARAKGSLQETAMKVGSWFS---KNVIGEEDPNQP--Q 285
                    SW+QFVEKDLP+ITARAKGSLQETA KVG+WF+   KN IGE + N     
Sbjct: 191 ED-------SWSQFVEKDLPEITARAKGSLQETATKVGTWFNGVKKNFIGEGEENDSAYY 243

Query: 286 PQGMNNRNGNSDFTDEQIKQQQKEWSYYQKQKKGPENP-----------ERRRFNSFGAQ 334
               + R+ + D+    ++QQ++      +Q++G ++P            R RFNSFGA 
Sbjct: 244 QDDSHGRDLDEDYGT-YVEQQER------RQRRGVQDPGYRRGDEQRLNARHRFNSFGAS 296

Query: 335 VGEDSLESHGIALHDNENLSDEDEDVPPQLPTREKSVDSNTQNDETNATATPKDKAKVVA 394
             +D     GI+L D E   DEDE+VPPQLP+R +S DS   ++E       KD  KVVA
Sbjct: 297 ATDDV--EGGISLRDEEFGEDEDEEVPPQLPSRARSNDSKKDSEEVKPQEGKKD--KVVA 352

Query: 395 QTTFIDTPEG--SAKPKWQPVAPEPLNGTPTKINASGQAKIKNPDEDEDFLINSDDEL 450
           +TT+IDTPE     K KWQP+ PEPLN TPTK+NAS + K KN  EDE FLINSD+EL
Sbjct: 353 ETTYIDTPENKEKTKRKWQPLPPEPLNATPTKVNASTK-KNKNESEDE-FLINSDEEL 408

>Kwal_55.21587
          Length = 464

 Score =  197 bits (500), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 149/410 (36%), Positives = 205/410 (50%), Gaps = 86/410 (20%)

Query: 89  NEEDEGPPLPTRRKTEPEAEESENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEAL 148
           N+E+  P LP R+ +     E  NPIL QL EAFP I+ KYVK VLIASQGALDPAF AL
Sbjct: 93  NDEEVRPALPKRKTSTQNVHE--NPILAQLTEAFPGIDAKYVKAVLIASQGALDPAFNAL 150

Query: 149 LFLSDPNSSKDIELPTKPIAANATPALPQRRK---------LTQLEQDALLARQLNEEYN 199
           LFLSDP+   +  +PT         A+PQ  +         ++QL+QD +LARQL+ ++N
Sbjct: 151 LFLSDPSFEAEATVPT---------AVPQSSQSGNSRSPTAVSQLQQDEILARQLDAQFN 201

Query: 200 KAHDPPRGAVR--DNGXXXXXXXXXXXXXANXXXXXXXXXXXS----------------- 240
           K H   RGA R  D+                           S                 
Sbjct: 202 KGH-ARRGAPRSMDDERRARERRIRERQREFERRTAHGAGPLSPEEQRRYERMEAEDQED 260

Query: 241 ---WAQFVEKDLPDITARAKGSLQETAMKVGSW---FSKNVIGEEDPNQPQPQG--MNNR 292
               +Q V+KDLP++  +    +QET  KV  W   F KN   ++   Q   Q    ++R
Sbjct: 261 NDFLSQLVDKDLPELREKVGRQVQETGRKVNDWLSGFRKNWAQDQSSQQQSSQYPEFSDR 320

Query: 293 NGNSDFTDEQIKQQQKEWSYYQKQKKGPENPERR--RFNSFGAQVGEDS------LESHG 344
             +        +    E+  Y +       PE R  RFNSFGA+VG+DS      L SHG
Sbjct: 321 QQSQRRDTSSRRSSDSEFEDYTR-------PEHRTARFNSFGAKVGDDSTTSSAKLASHG 373

Query: 345 IALHD--NENLSDE-DEDVPPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFIDT 401
           I+L++  ++++ DE D D+ PQLP+R K+ D                   +  +TT+IDT
Sbjct: 374 ISLYNKGDKDVEDESDADIAPQLPSRNKAKD-------------------IQPETTYIDT 414

Query: 402 PEGSAKPKWQPVAPEPLNGTPTKINASGQAKIKNPD-EDEDFLINSDDEL 450
           PE   + KWQP+ PEP+N TP+K+NA+     +N D  D+DFLIN+DDEL
Sbjct: 415 PEAGTRKKWQPLPPEPINVTPSKVNATASKNKRNSDVNDDDFLINTDDEL 464

>KLLA0F15994g complement(1484383..1485666) weakly similar to
           sgd|S0005568 Saccharomyces cerevisiae YOR042w, start by
           similarity
          Length = 427

 Score =  172 bits (436), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 185/389 (47%), Gaps = 122/389 (31%)

Query: 89  NEEDEGPPLPTRRKTEPEAE-ESENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEA 147
           +E+D  PPLP R+   PE + E ENP+LKQLKEAFPNIEEKYVK VLIASQG LDPAF A
Sbjct: 68  DEDDSAPPLPVRKSVSPEEQSEKENPMLKQLKEAFPNIEEKYVKAVLIASQGQLDPAFNA 127

Query: 148 LLFLSDPNSSKDIELPTKPIAANATPALPQRRK-LTQLEQDALLARQLNEEYNKAHD--- 203
           LLF+SDP+  K+  LPT+P+ A   P    RR+  TQLEQD  LARQL++++NK  +   
Sbjct: 128 LLFISDPDFEKEAPLPTRPVQA---PTRGVRREPKTQLEQDEELARQLDKKFNKHGNSAS 184

Query: 204 -------------------------PPRGAVRDNGXXXXXXXXXXXXXANXXXXXXXXXX 238
                                    PP+G    +G             +N          
Sbjct: 185 ERTARERRIRQRERDYERRYGAGAIPPKGRRDSDGYDNFEDDGEDDVFSN---------- 234

Query: 239 XSWAQFVEKDLPDITARAKGSLQETAMKVGSWFS---KNVIGEEDPNQPQPQGMNNRNGN 295
                FV+K+LP I      ++QET  K+ +WFS   KN++ ++DPN             
Sbjct: 235 -----FVDKELPQIRENLNRNIQETGKKISTWFSGITKNLV-DDDPN------------- 275

Query: 296 SDFTDEQIKQQQKEWSYYQKQKKGPENPERRRFNSFGAQV--------GEDSLESHGIAL 347
             +++ + K  Q                   RFNSFG +         G+  L++ GI+L
Sbjct: 276 --YSESRPKYSQS------------------RFNSFGDRYRDGNDNVDGQTKLQNAGISL 315

Query: 348 HDNENLSDEDEDVPPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFIDTPE---- 403
           H+++     D+D+PPQLP+R K                     KVVA+TT+IDTPE    
Sbjct: 316 HNDDLDFGSDDDIPPQLPSRAK---------------------KVVAETTYIDTPEQVRG 354

Query: 404 ---GSAKPKWQPVAPEPLNGTPT-KINAS 428
               S      P +  P   TPT K+N S
Sbjct: 355 KNNRSPLKTLAPHSESPTRSTPTSKLNTS 383

>ACR083C [1130] [Homologous to ScYOR042W - SH; ScYDR273W (DON1) -
           SH] (505794..506921) [1128 bp, 375 aa]
          Length = 375

 Score =  125 bits (315), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 116/348 (33%), Positives = 156/348 (44%), Gaps = 79/348 (22%)

Query: 111 ENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAAN 170
           EN IL +LK AFPN+EEK VK V+IASQG LDPAF ALLFLSDP   ++  L     A  
Sbjct: 99  ENSILSELKAAFPNVEEKIVKAVIIASQGILDPAFSALLFLSDPTFEEEAAL-PTQAAPA 157

Query: 171 ATPALPQRRKLTQLEQDALLARQLNEEYNKAHDPPRGAVRDNGXXXXXXXXXXXXXANXX 230
           A   +P    ++QL+QD +LARQL+E++NK         +D                   
Sbjct: 158 AQATVP----ISQLQQDEMLARQLDEQFNK---------KDLRAERAARERRIREREEEF 204

Query: 231 XXXXXXXXXSWAQFVEKDLPDITARAKGSLQETAMKVGSWFSKNVIGEEDPNQPQPQGM- 289
                     +  +  +D  D        LQET+ KVG W+                G+ 
Sbjct: 205 QRKQQRLRSEYGGYGSEDDEDFIDVLNRGLQETSKKVGKWWD---------------GIK 249

Query: 290 NNRNGNSDFTDEQIKQQQKEWSYYQKQKKGPENPERRRFNSFGAQVGEDS---LESHGIA 346
            N N   D  D              +   GP    ++RFNSFGA+  E      +  G++
Sbjct: 250 KNFNEELDGPD-------------ARASAGPPRARQQRFNSFGARDDETYPTEQQLRGVS 296

Query: 347 LHDNENLSDEDEDVPPQLPTREKSVDSNTQNDETNATATPKDKAKVVAQTTFIDTPEGSA 406
           LHD     + D++  P+LP R  S             A P             D P    
Sbjct: 297 LHD-----EHDDEPAPRLPPRRTSTGP--------LPARP-------------DGPNVER 330

Query: 407 KPKWQPVAPEPLNGTPTKINASG----QAKIKNPDEDEDFLINSDDEL 450
           K +WQP+ PEP++  PTK+ A G    Q K ++PD+D D+LINSDDEL
Sbjct: 331 K-RWQPLPPEPVS-APTKVTAGGRNHAQNKKRDPDQD-DYLINSDDEL 375

>YDR273W (DON1) [1104] chr4 (1010168..1011265) Component of the
           prospore membrane [1098 bp, 365 aa]
          Length = 365

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 40/56 (71%)

Query: 114 ILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAA 169
           +LK+LK AFP +++  +K +LIASQG L+PAF +LL+ S P  + D  LP KPI+ 
Sbjct: 86  VLKELKIAFPEVDDTLIKAILIASQGVLEPAFNSLLYYSSPEENTDFALPMKPISV 141

>Scas_615.8d
          Length = 581

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 42/68 (61%), Gaps = 9/68 (13%)

Query: 117 QLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPIAANATPALP 176
           +L +AFP+++   +K++L AS+G + PAF ALLFL++  + + I +         T  LP
Sbjct: 286 ELAKAFPSVDINVIKSLLFASEGEVLPAFHALLFLTNQQNLETITI---------TQVLP 336

Query: 177 QRRKLTQL 184
           ++  L++L
Sbjct: 337 KKNILSEL 344

>CAGL0M08580g complement(855443..856036) weakly similar to tr|Q08412
           Saccharomyces cerevisiae YOR042w, hypothetical start
          Length = 197

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 15/72 (20%)

Query: 108 EESENPILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSDPNSSKDIELPTKPI 167
           E  +N   ++L +AFP +++  ++ +L+A++G L PAF ALL L    + +DI+L     
Sbjct: 24  EVEQNVHYEKLVKAFPTVDKLIIRAILLAARGDLAPAFNALLSL----TGEDIQL----- 74

Query: 168 AANATPALPQRR 179
                  LP RR
Sbjct: 75  ------GLPMRR 80

>Scas_626.8
          Length = 475

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 107 AEESENP-ILKQLKEAFPNIEEKYVKTVLIASQGALDPAFEALLFLSD 153
            EE+EN   L  L+  FP ++++ ++ V IA +  + P  + LL LSD
Sbjct: 428 MEENENQETLDTLQSMFPGMDKELIEDVCIAKKYRIGPCVDILLTLSD 475

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.302    0.123    0.341 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 16,005,610
Number of extensions: 766057
Number of successful extensions: 4359
Number of sequences better than 10.0: 171
Number of HSP's gapped: 4261
Number of HSP's successfully gapped: 186
Length of query: 450
Length of database: 16,596,109
Length adjustment: 105
Effective length of query: 345
Effective length of database: 12,961,219
Effective search space: 4471620555
Effective search space used: 4471620555
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 63 (28.9 bits)