Hit NameLength (aa)HSP LengthHSP ScoreHSP Significance
Scas_699.4428228215320.0
YOR040W (GLO4)28528210121e-139
Sklu_1159.128227810091e-139
Kwal_55.215822842799981e-137
CAGL0I00924g2742759791e-134
YDR272W (GLO2)2742759661e-132
ACR084C2932839451e-129
KLLA0F16016g2832829421e-128
CAGL0K01771g66267644.0
Kwal_23.386734743634.6
Sklu_1773.323366625.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Scas_699.44
         (282 letters)

Database: blastdb 
           34,618 sequences; 16,596,109 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Scas_699.44                                                           594   0.0  
YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 ...   394   e-139
Sklu_1159.1 YOR040W, Contig c1159 273-1121                            393   e-139
Kwal_55.21582                                                         389   e-137
CAGL0I00924g complement(75399..76223) similar to sp|Q05584 Sacch...   381   e-134
YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825...   376   e-132
ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W (...   368   e-129
KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320 S...   367   e-128
CAGL0K01771g complement(158558..160546) similar to sp|P80235 Sac...    29   4.0  
Kwal_23.3867                                                           29   4.6  
Sklu_1773.3 YNR057C, Contig c1773 4329-5030                            28   5.4  

>Scas_699.44
          Length = 282

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/282 (100%), Positives = 282/282 (100%)

Query: 1   MLRQVGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIR 60
           MLRQVGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIR
Sbjct: 1   MLRQVGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIR 60

Query: 61  AIVNTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEV 120
           AIVNTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEV
Sbjct: 61  AIVNTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEV 120

Query: 121 VCLRTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEG 180
           VCLRTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEG
Sbjct: 121 VCLRTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEG 180

Query: 181 VGEPNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDD 240
           VGEPNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDD
Sbjct: 181 VGEPNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDD 240

Query: 241 ELKFNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKMKNSM 282
           ELKFNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKMKNSM
Sbjct: 241 ELKFNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKMKNSM 282

>YOR040W (GLO4) [4852] chr15 (407063..407920) Glyoxalase-II [858 bp,
           285 aa]
          Length = 285

 Score =  394 bits (1012), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 178/282 (63%), Positives = 223/282 (79%)

Query: 1   MLRQVGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIR 60
           +L+Q+  M+VKPIKMRW TGGVNYSYLLS++D+ +SWLIDPAE  EV P L  +E+ +I 
Sbjct: 4   LLQQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKKSID 63

Query: 61  AIVNTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEV 120
           AIVNTHHHYDHS GN+++ + L Q+ + H +KII GSKSSPGV+E+P +LQ+Y LGNL V
Sbjct: 64  AIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGNLRV 123

Query: 121 VCLRTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEG 180
            C+RTPCHT+DSICYY+KD +T EQC+FTGDTLF  GCGRFFEG G++MD ALN+ +L  
Sbjct: 124 TCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIMLRA 183

Query: 181 VGEPNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDD 240
           VGE NWN  ++YPGHEYTK NV FIR  +Y ++G N+  D LE++CKS+E TTG FTL D
Sbjct: 184 VGETNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFTLRD 243

Query: 241 ELKFNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKMKNSM 282
           EL +NPFMRLDD  VR AVGD    + RS VM+ LRK+KN+M
Sbjct: 244 ELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKLKNAM 285

>Sklu_1159.1 YOR040W, Contig c1159 273-1121
          Length = 282

 Score =  393 bits (1009), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 180/278 (64%), Positives = 224/278 (80%), Gaps = 1/278 (0%)

Query: 5   VGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIRAIVN 64
           +  M+VK IKMRW TGGVNYSYLLS+QDK  SWLIDPAE  EV+P L  +E  +I A+VN
Sbjct: 6   IRSMHVKAIKMRWLTGGVNYSYLLSTQDKTKSWLIDPAEPLEVLPKLTDKEIGSIEAVVN 65

Query: 65  THHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEVVCLR 124
           THHHYDHS GNI +I  LK+ G Q+ V +I GS +SPG +E+P  LQKY+LG+LEV+C+R
Sbjct: 66  THHHYDHSGGNIPVIAALKKAG-QNAVSVICGSHTSPGATEVPQDLQKYKLGDLEVLCIR 124

Query: 125 TPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEGVGEP 184
           TPCHTQDS+CY+VKD DT E+C+FTGDTLFT GCGRFFEG G+EMD+ALN+ +LE  GE 
Sbjct: 125 TPCHTQDSVCYFVKDFDTGERCIFTGDTLFTAGCGRFFEGTGEEMDRALNRNLLEHTGEE 184

Query: 185 NWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDDELKF 244
           NW+ T+VYPGHEYTK NV+F+R  +Y+  G+N+A DKLE FC  +EVTTG FTL DEL F
Sbjct: 185 NWSTTKVYPGHEYTKSNVEFVRAAIYKTPGENKAFDKLEHFCDKNEVTTGCFTLKDELDF 244

Query: 245 NPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKMKNSM 282
           NPFMRL+ P+VRK+VGDA+  W +++VM+ LR+MKN M
Sbjct: 245 NPFMRLNCPMVRKSVGDAQGAWPKARVMDKLRQMKNHM 282

>Kwal_55.21582
          Length = 284

 Score =  389 bits (998), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 174/279 (62%), Positives = 221/279 (79%), Gaps = 1/279 (0%)

Query: 4   QVGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIRAIV 63
           Q   M+VK IKMRW TGGVNY YLLS+QDK  SWLIDPAE  EV+  L  +E   ++A+V
Sbjct: 7   QTRSMHVKAIKMRWLTGGVNYCYLLSTQDKTKSWLIDPAEPLEVMTALKAEEANTVQAVV 66

Query: 64  NTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEVVCL 123
           NTHHHYDHS GN +++ EL++ G  H+  +I GS +SPG ++IP +LQ+Y LG+L++ C+
Sbjct: 67  NTHHHYDHSGGNSAIVGELRKMGVSHL-DVICGSNTSPGATKIPKNLQEYSLGDLKIKCI 125

Query: 124 RTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEGVGE 183
           RTPCHTQDS+CYYV D +T E+C+FTGDTLFT GCGRFFEG G+EMD ALN++IL+GVGE
Sbjct: 126 RTPCHTQDSVCYYVSDPNTGEKCIFTGDTLFTAGCGRFFEGTGEEMDVALNRSILDGVGE 185

Query: 184 PNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDDELK 243
           PNW++T+VYPGHEYTK NVKF+RK VY+  G+N +LD+LE  C  H+VTTG FT+ DEL 
Sbjct: 186 PNWDITKVYPGHEYTKSNVKFVRKAVYKTPGENSSLDRLEHVCNKHDVTTGMFTIHDELA 245

Query: 244 FNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKMKNSM 282
           +NPFMRLDDP VR A+ D+     R++VM+ LRKMKNSM
Sbjct: 246 YNPFMRLDDPTVRDAIKDSNGSLSRAQVMDQLRKMKNSM 284

>CAGL0I00924g complement(75399..76223) similar to sp|Q05584
           Saccharomyces cerevisiae YDR272w GLO2 glyoxalase II,
           start by similarity
          Length = 274

 Score =  381 bits (979), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 173/275 (62%), Positives = 216/275 (78%), Gaps = 1/275 (0%)

Query: 8   MYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIRAIVNTHH 67
           M+VKPIKMRW TGGVNYSYL+S+QD+  SWLIDPAE  EV P L   ER ++ A+VNTHH
Sbjct: 1   MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPELSESERESVVALVNTHH 60

Query: 68  HYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEVVCLRTPC 127
           HYDH+ GN S++ + K+   + + ++I GS+    V+ IPTH QK ++GNL+V C+RTPC
Sbjct: 61  HYDHAGGNTSLLKQFKETVGKPL-QVIGGSEECDNVTLIPTHSQKLKIGNLDVTCIRTPC 119

Query: 128 HTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEGVGEPNWN 187
           HTQDS+CYY++D +T+E+C+FTGDTLFT GCGRFFEG G+EMD ALNK ILEGVG+ NW+
Sbjct: 120 HTQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEEMDAALNKYILEGVGKNNWS 179

Query: 188 MTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDDELKFNPF 247
            T VYPGHEYTK NVKF+R  +Y     N   D+LE+FC  HEVTTG+FTL DEL FNPF
Sbjct: 180 STLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFCNEHEVTTGKFTLADELLFNPF 239

Query: 248 MRLDDPIVRKAVGDAEEKWERSKVMETLRKMKNSM 282
           M+LDDPIVR AVGD+E +W  + VM+ LRKMKN+M
Sbjct: 240 MKLDDPIVRAAVGDSENQWTSAAVMDKLRKMKNAM 274

>YDR272W (GLO2) [1103] chr4 (1009002..1009826) Glyoxalase-II [825
           bp, 274 aa]
          Length = 274

 Score =  376 bits (966), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 170/275 (61%), Positives = 213/275 (77%), Gaps = 1/275 (0%)

Query: 8   MYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIRAIVNTHH 67
           M VK IKMRW +GGVNY YLLS    + SWLIDPAE  EV+P L   E++++ AIVNTHH
Sbjct: 1   MQVKSIKMRWESGGVNYCYLLSDSKNKKSWLIDPAEPPEVLPELTEDEKISVEAIVNTHH 60

Query: 68  HYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLEVVCLRTPC 127
           HYDH+DGN  ++  LK+      V++I GSK  P V+ IP +L+K  LG+LE+ C+RTPC
Sbjct: 61  HYDHADGNADILKYLKEKNPTSKVEVIGGSKDCPKVTIIPENLKKLHLGDLEITCIRTPC 120

Query: 128 HTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILEGVGEPNWN 187
           HT+DSICYYVKD  T+E+C+FTGDTLFT GCGRFFEG G+EMD ALN +ILE VG  NW+
Sbjct: 121 HTRDSICYYVKDPTTDERCIFTGDTLFTAGCGRFFEGTGEEMDIALNNSILETVGRQNWS 180

Query: 188 MTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLDDELKFNPF 247
            TRVYPGHEYT DNVKF+RK +Y ++G+N+ALD+LE+FC  HEVT G FTL DE++FNPF
Sbjct: 181 KTRVYPGHEYTSDNVKFVRK-IYPQVGENKALDELEQFCSKHEVTAGRFTLKDEVEFNPF 239

Query: 248 MRLDDPIVRKAVGDAEEKWERSKVMETLRKMKNSM 282
           MRL+DP V+KA GD    W+R+++M+ LR MKN M
Sbjct: 240 MRLEDPKVQKAAGDTNNSWDRAQIMDKLRAMKNRM 274

>ACR084C [1131] [Homologous to ScYOR040W (GLO4) - SH; ScYDR272W
           (GLO2) - SH] (507338..508219) [882 bp, 293 aa]
          Length = 293

 Score =  368 bits (945), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 172/283 (60%), Positives = 215/283 (75%), Gaps = 5/283 (1%)

Query: 1   MLRQVGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNIR 60
           M RQ+ KM+VK IKMRW TGGVNYSYL+S+QDK+ SWLIDPAE+ EV+P L   E+ +IR
Sbjct: 15  MYRQLRKMHVKAIKMRWLTGGVNYSYLVSTQDKKASWLIDPAEALEVLPALSHDEKQSIR 74

Query: 61  AIVNTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGN-LE 119
           AIVNTHHHYDH+ GN+++   LK++G    V +IAGS +SP  ++IP HLQKY LG+ +E
Sbjct: 75  AIVNTHHHYDHAGGNLAIRAALKREGVA--VPVIAGSTTSPVSTDIPEHLQKYTLGDSVE 132

Query: 120 VVCLRTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILE 179
           V+C+RTPCHTQDSICY+++D+ T +Q LFTGDTLFT GCGRFFEG  +EMD ALN  +LE
Sbjct: 133 VLCIRTPCHTQDSICYFMRDTKTGQQALFTGDTLFTAGCGRFFEGTAEEMDAALNSRLLE 192

Query: 180 GVGEPNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTLD 239
            V   +   T+VYPGHEYTK NV FIR  +Y   GDN A D+LE F  ++ VTTG+FTL 
Sbjct: 193 HV--QDHAATKVYPGHEYTKGNVHFIRSAIYMSEGDNPAFDRLESFANANAVTTGQFTLQ 250

Query: 240 DELKFNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKMKNSM 282
           DE ++NPFMRLDDP +R+ VGD    W R+ VM  LR MKN+M
Sbjct: 251 DETEYNPFMRLDDPTIRRRVGDLHRTWARADVMAKLRSMKNTM 293

>KLLA0F16016g complement(1486406..1487257) similar to sp|Q12320
           Saccharomyces cerevisiae YOR040w GLO4 glyoxalase II
           (hydroxyacylglutathione hydrolase), start by similarity
          Length = 283

 Score =  367 bits (942), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 171/282 (60%), Positives = 216/282 (76%), Gaps = 3/282 (1%)

Query: 1   MLRQ-VGKMYVKPIKMRWSTGGVNYSYLLSSQDKEHSWLIDPAESDEVIPHLDPQERLNI 59
           M++Q + KM+VK IKMRW TGGVNYSYLLS+QDK+ SWLIDPAE+ EV+  L   E  +I
Sbjct: 1   MIKQSIRKMHVKAIKMRWLTGGVNYSYLLSTQDKKKSWLIDPAETLEVMNDLGSDEAKSI 60

Query: 60  RAIVNTHHHYDHSDGNISMINELKQDGNQHIVKIIAGSKSSPGVSEIPTHLQKYQLGNLE 119
            A+VNTHHHYDH+ GN+S +  L + GN +I ++IAGS+ SP  ++IP +L +Y LGNL+
Sbjct: 61  EALVNTHHHYDHAGGNVSTLAALNEKGN-NISRVIAGSQRSPIANDIPDNLHEYTLGNLK 119

Query: 120 VVCLRTPCHTQDSICYYVKDSDTNEQCLFTGDTLFTGGCGRFFEGNGQEMDQALNKTILE 179
           ++C+RTPCHTQDS CYYV+D +T EQ +FTGDTLFTGGCGRFFEG  +EMD ALN  +L 
Sbjct: 120 ILCIRTPCHTQDSTCYYVRDPETKEQAIFTGDTLFTGGCGRFFEGTAEEMDDALNFRLLG 179

Query: 180 GVGE-PNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEVTTGEFTL 238
             G+  NW   +VYPGHEYT  NV FIR ++Y +  DN+  +KLE F K HEVTTG FT+
Sbjct: 180 NTGDTSNWKNVKVYPGHEYTAGNVSFIRNYIYLKKSDNDHFNKLESFTKEHEVTTGHFTI 239

Query: 239 DDELKFNPFMRLDDPIVRKAVGDAEEKWERSKVMETLRKMKN 280
            DEL FNPFMRLDDPIVR+ VGD++  W R++VM+ LR MKN
Sbjct: 240 ADELSFNPFMRLDDPIVRRQVGDSQGCWTRAQVMDKLRNMKN 281

>CAGL0K01771g complement(158558..160546) similar to sp|P80235
           Saccharomyces cerevisiae YAR035w, hypothetical start
          Length = 662

 Score = 29.3 bits (64), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 9/67 (13%)

Query: 172 ALNKTILEGVGEPNWNMTRVYPGHEYTKDNVKFIRKFVYQELGDNEALDKLEKFCKSHEV 231
           A+ KT L G  E       + P    T D++KF++        D E +D L + C+ H  
Sbjct: 487 AMTKTFLNGRTEA------IRP---VTHDSIKFVKSVFNHRSTDTERIDLLHRACQEHTR 537

Query: 232 TTGEFTL 238
            T E ++
Sbjct: 538 ITRECSM 544

>Kwal_23.3867
          Length = 347

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 21/43 (48%)

Query: 209 VYQELGDNEALDKLEKFCKSHEVTTGEFTLDDELKFNPFMRLD 251
           VY+ +  N+ +D +E+ C  H+      T D+ LKF      D
Sbjct: 278 VYKTVDLNDVVDSVEEVCSHHDTGFAVITYDERLKFRALNERD 320

>Sklu_1773.3 YNR057C, Contig c1773 4329-5030
          Length = 233

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query: 136 YVKDSDTNEQCLFTGDTLFTGGCGRFFEG--NGQEMDQALNKTILEGVGEPNWNMTRVYP 193
           +V  +DT+    F    L       +++    G E DQ   KT+L+  G+ +W+ T   P
Sbjct: 19  FVTGTDTDVGKTFISSLLVHSWSANYWKPVQTGIESDQGDTKTVLQFSGKSSWSPTLFPP 78

Query: 194 GHEYTK 199
            +E  K
Sbjct: 79  RYELLK 84

  Database: blastdb
    Posted date:  Apr 3, 2006  3:33 PM
  Number of letters in database: 16,596,109
  Number of sequences in database:  34,618
  
Lambda     K      H
   0.317    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 34618
Number of Hits to DB: 10,435,186
Number of extensions: 485485
Number of successful extensions: 1325
Number of sequences better than 10.0: 19
Number of HSP's gapped: 1315
Number of HSP's successfully gapped: 19
Length of query: 282
Length of database: 16,596,109
Length adjustment: 100
Effective length of query: 182
Effective length of database: 13,134,309
Effective search space: 2390444238
Effective search space used: 2390444238
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)